[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF09446.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2qk8A.bssp"
#ERROR : Can't open dsspfile "3fl8A.bssp"
#ERROR : Can't open dsspfile "3datA.bssp"
#ERROR : Can't open dsspfile "3e0bA.bssp"
#ERROR : Can't open dsspfile "3fl9C.bssp"
#ERROR : Can't open dsspfile "3fl9F.bssp"
#ERROR : Can't open dsspfile "3fl9A.bssp"
#ERROR : Can't open dsspfile "3fl9E.bssp"
#ERROR : Can't open dsspfile "3fl9D.bssp"
#ERROR : Can't open dsspfile "3fl9B.bssp"
#ERROR : Can't open dsspfile "1zdrB.bssp"
#ERROR : Can't open dsspfile "1zdrA.bssp"
#ERROR : Can't open dsspfile "3ia4A.bssp"
#ERROR : Can't open dsspfile "3ia5B.bssp"
#ERROR : Can't open dsspfile "3ia4C.bssp"
#ERROR : Can't open dsspfile "3ia5A.bssp"
#ERROR : Can't open dsspfile "1df7A.bssp"
#ERROR : Can't open dsspfile "2inqA.bssp"
#ERROR : Can't open dsspfile "3dauA.bssp"
#ERROR : Can't open dsspfile "2cigA.bssp"
#ERROR : Can't open dsspfile "1dyhA.bssp"
#ERROR : Can't open dsspfile "4dfrA.bssp"
#ERROR : Can't open dsspfile "1dhjA.bssp"
#ERROR : Can't open dsspfile "1draA.bssp"
#ERROR : Can't open dsspfile "1dhiA.bssp"
#ERROR : Can't open dsspfile "2d0kA.bssp"
#ERROR : Can't open dsspfile "1drbA.bssp"
#ERROR : Can't open dsspfile "2drcA.bssp"
#ERROR : Can't open dsspfile "3fl8H.bssp"
#ERROR : Can't open dsspfile "2w9tA.bssp"
#ERROR : Can't open dsspfile "2w9sA.bssp"
#ERROR : Can't open dsspfile "5dfrA.bssp"
#ERROR : Can't open dsspfile "3f0uX.bssp"
#ERROR : Can't open dsspfile "2w9gA.bssp"
#ERROR : Can't open dsspfile "3fyvX.bssp"
#ERROR : Can't open dsspfile "1ly3A.bssp"
#ERROR : Can't open dsspfile "1klkA.bssp"
#ERROR : Can't open dsspfile "1dyrA.bssp"
#ERROR : Can't open dsspfile "4cd2A.bssp"
#ERROR : Can't open dsspfile "2ithA.bssp"
#ERROR : Can't open dsspfile "1vdrA.bssp"
#ERROR : Can't open dsspfile "3f8yA.bssp"
#ERROR : Can't open dsspfile "3ghvA.bssp"
#ERROR : Can't open dsspfile "1mvsA.bssp"
#ERROR : Can't open dsspfile "1kmvA.bssp"
#ERROR : Can't open dsspfile "1kmsA.bssp"
#ERROR : Can't open dsspfile "1dhfA.bssp"
#ERROR : Can't open dsspfile "1vdrB.bssp"
#ERROR : Can't open dsspfile "3ghcA.bssp"
#ERROR : Can't open dsspfile "3k45A.bssp"
#ERROR : Can't open dsspfile "1hfqA.bssp"
#ERROR : Can't open dsspfile "3eigA.bssp"
#ERROR : Can't open dsspfile "3dfrA.bssp"
#ERROR : Can't open dsspfile "3d80A.bssp"
#ERROR : Can't open dsspfile "3f91A.bssp"
#ERROR : Can't open dsspfile "1dlrA.bssp"
#ERROR : Can't open dsspfile "1bozA.bssp"
#ERROR : Can't open dsspfile "1dlsA.bssp"
#ERROR : Can't open dsspfile "1u71A.bssp"
#ERROR : Can't open dsspfile "1u70A.bssp"
#ERROR : Can't open dsspfile "1ao8A.bssp"
#ERROR : Can't open dsspfile "1ai9A.bssp"
#ERROR : Can't open dsspfile "3hbbB.bssp"
#ERROR : Can't open dsspfile "2oipC.bssp"
#ERROR : Can't open dsspfile "2oipD.bssp"
#ERROR : Can't open dsspfile "2h2qA.bssp"
#ERROR : Can't open dsspfile "3cl9A.bssp"
#ERROR : Can't open dsspfile "1qzfA.bssp"
#ERROR : Can't open dsspfile "2oipE.bssp"
#ERROR : Can't open dsspfile "2oipA.bssp"
#ERROR : Can't open dsspfile "3dl6E.bssp"
#ERROR : Can't open dsspfile "3dl6B.bssp"
#ERROR : Can't open dsspfile "3dl6A.bssp"
#ERROR : Can't open dsspfile "3dl5B.bssp"
#ERROR : Can't open dsspfile "3dl5A.bssp"
#ERROR : Can't open dsspfile "3k2hA.bssp"
#ERROR : Can't open dsspfile "3hbbD.bssp"
#ERROR : Can't open dsspfile "3clbC.bssp"
#ERROR : Can't open dsspfile "3clbA.bssp"
#ERROR : Can't open dsspfile "3clbD.bssp"
#ERROR : Can't open dsspfile "3clbB.bssp"
#ERROR : Can't open dsspfile "3i3rA.bssp"
#ERROR : Can't open dsspfile "8dfrA.bssp"
#ERROR : Can't open dsspfile "3i3rB.bssp"
#ERROR : Can't open dsspfile "2h2qB.bssp"
#ERROR : Can't open dsspfile "2blcA.bssp"
#ERROR : Can't open dsspfile "2blaA.bssp"
#ERROR : Can't open dsspfile "2bl9A.bssp"
#ERROR : Can't open dsspfile "2blbA.bssp"
#ERROR : Can't open dsspfile "3cseA.bssp"
#ERROR : Can't open dsspfile "1cz3B.bssp"
#ERROR : Can't open dsspfile "1cz3A.bssp"
#ERROR : Can't open dsspfile "1juvA.bssp"
#ERROR : Can't open dsspfile "1j3jB.bssp"
#ERROR : Can't open dsspfile "1j3iB.bssp"
#ERROR : Can't open dsspfile "1j3iA.bssp"
#ERROR : Can't open dsspfile "3dgaB.bssp"
#ERROR : Can't open dsspfile "3dgaA.bssp"
#ERROR : Can't open dsspfile "1j3kB.bssp"
#ERROR : Can't open dsspfile "1j3jA.bssp"
#ERROR : Can't open dsspfile "1j3kA.bssp"

## Summary of PDB Search
:166
    1e-43  49%  2qk8A  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-43  49%  3fl8A  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-43  49%  3datA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-43  50%  3e0bA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-42  50%  3fl9C  [x.x.x] DIHYDROFOLATE REDUCTASE (DHFR)
    2e-42  50%  3fl9F  [x.x.x] DIHYDROFOLATE REDUCTASE (DHFR)
    7e-42  48%  3fl9A  [x.x.x] DIHYDROFOLATE REDUCTASE (DHFR)
    9e-42  48%  3fl9E  [x.x.x] DIHYDROFOLATE REDUCTASE (DHFR)
    9e-42  49%  3fl9D  [x.x.x] DIHYDROFOLATE REDUCTASE (DHFR)
    3e-40  50%  3fl9B  [x.x.x] DIHYDROFOLATE REDUCTASE (DHFR)
    5e-38  47%  1zdrB  [x.x.x] DIHYDROFOLATE REDUCTASE
    5e-38  47%  1zdrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    3e-37  46%  3ia4A  [x.x.x] DIHYDROFOLATE REDUCTASE
    5e-36  46%  3ia5B  [x.x.x] DIHYDROFOLATE REDUCTASE
    5e-36  46%  3ia4C  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-35  46%  3ia5A  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-34  50%  1df7A  [c.71.1] DIHYDROFOLATE REDUCTASE
    9e-34  42%  2inqA  [x.x.x] DIHYDROFOLATE REDUCTASE
    9e-34  42%  3dauA  [c.71.1 (1ddrA)] DIHYDROFOLATE REDUCTASE
    9e-34  49%  2cigA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-33  42%  1dyhA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-33  42%  4dfrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-33  41%  1dhjA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-33  41%  1draA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-33  41%  1dhiA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-33  42%  2d0kA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-32  41%  1drbA  [c.71.1] DIHYDROFOLATE REDUCTASE
    2e-32  41%  2drcA  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-32  46%  3fl8H  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-31  42%  2w9tA  [x.x.x] DIHYDROFOLATE REDUCTASE TYPE 1
    2e-31  42%  2w9sA  [x.x.x] DIHYDROFOLATE REDUCTASE TYPE 1 FROM TN4003
    6e-31  43%  5dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-30  42%  3f0uX  [x.x.x] TRIMETHOPRIM-SENSITIVE DIHYDROFOLATE REDUCTASE
    5e-30  41%  2w9gA  [x.x.x] DIHYDROFOLATE REDUCTASE
    5e-30  41%  3fyvX  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-25  47%  1ly3A  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-25  47%  1klkA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-25  47%  1dyrA  [c.71.1 (1e26A)] DIHYDROFOLATE REDUCTASE
    4e-25  47%  4cd2A  [c.71.1] DIHYDROFOLATE REDUCTASE
    8e-20  35%  2ithA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-19  35%  1vdrA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-18  42%  3f8yA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-18  42%  3ghvA  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-18  42%  1mvsA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-18  42%  1kmvA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-18  42%  1kmsA  [c.71.1] DIHYDROFOLATE REDUCTASE
    4e-18  42%  1dhfA  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-18  36%  1vdrB  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-18  42%  3ghcA  [x.x.x] DIHYDROFOLATE REDUCTASE
    7e-18  41%  3k45A  [x.x.x] DIHYDROFOLATE REDUCTASE
    7e-18  42%  1hfqA  [x.x.x] DIHYDROFOLATE REDUCTASE
    7e-18  42%  3eigA  [x.x.x] DIHYDROFOLATE REDUCTASE
    7e-18  38%  3dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    7e-18  42%  3d80A  [x.x.x] DIHYDROFOLATE REDUCTASE
    9e-18  42%  3f91A  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-17  41%  1dlrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    1e-17  42%  1bozA  [c.71.1] PROTEIN (DIHYDROFOLATE REDUCTASE)
    2e-17  41%  1dlsA  [x.x.x] DIHYDROFOLATE REDUCTASE
    2e-17  41%  1u71A  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-17  41%  1u70A  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-17  34%  1ao8A  [c.71.1 (1ludA)] DIHYDROFOLATE REDUCTASE
    5e-17  40%  1ai9A  [c.71.1] DIHYDROFOLATE REDUCTASE
    3e-15  47%  3hbbB  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    1e-14  39%  2oipC  [x.x.x] CHAIN A, CRYSTAL STRUCTURE OF DHFR
    1e-14  39%  2oipD  [x.x.x] CHAIN A, CRYSTAL STRUCTURE OF DHFR
    1e-14  47%  2h2qA  [x.x.x] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    1e-14  46%  3cl9A  [x.x.x] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    2e-14  38%  1qzfA  [c.71.1 - d.117.1] BIFUNCTIONAL DIHYDROFOLATE
    2e-14  38%  2oipE  [x.x.x] CHAIN A, CRYSTAL STRUCTURE OF DHFR
    2e-14  38%  2oipA  [x.x.x] CHAIN A, CRYSTAL STRUCTURE OF DHFR
    2e-14  38%  3dl6E  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    2e-14  38%  3dl6B  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    2e-14  38%  3dl6A  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    2e-14  38%  3dl5B  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    2e-14  38%  3dl5A  [x.x.x] DIHYDROFOLATE REDUCTASE, DHFR
    2e-14  34%  3k2hA  [x.x.x] DIHYDROFOLATE REDUCTASE/THYMIDYLATE SYNTHASE
    2e-14  46%  3hbbD  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    5e-14  48%  3clbC  [x.x.x] DHFR-TS
    5e-14  48%  3clbA  [x.x.x] DHFR-TS
    1e-13  47%  3clbD  [x.x.x] DHFR-TS
    1e-13  47%  3clbB  [x.x.x] DHFR-TS
    2e-13  33%  3i3rA  [x.x.x] DIHYDROFOLATE REDUCTASE/THYMIDYLATE SYNTHASE
    2e-13  36%  8dfrA  [x.x.x] DIHYDROFOLATE REDUCTASE
    4e-13  33%  3i3rB  [x.x.x] DIHYDROFOLATE REDUCTASE/THYMIDYLATE SYNTHASE
    8e-12  49%  2h2qB  [x.x.x] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    4e-10  32%  2blcA  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    6e-10  33%  2blaA  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    7e-10  32%  2bl9A  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    9e-10  32%  2blbA  [x.x.x] DIHYDROFOLATE REDUCTASE-THYMIDYLATE SYNTHASE
    2e-09  52%  3cseA  [x.x.x] DIHYDROFOLATE REDUCTASE
    6e-09  43%  1cz3B  [c.71.1] DIHYDROFOLATE REDUCTASE
    6e-09  43%  1cz3A  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-08  37%  1juvA  [c.71.1] DIHYDROFOLATE REDUCTASE
    1e-08  28%  1j3jB  [c.71.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    2e-08  28%  1j3iB  [c.71.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    2e-08  28%  1j3iA  [c.71.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    2e-08  28%  3dgaB  [x.x.x] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    2e-08  28%  3dgaA  [x.x.x] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    3e-08  27%  1j3kB  [c.71.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    3e-08  28%  1j3jA  [c.71.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    4e-08  27%  1j3kA  [c.71.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
:166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxLLTLIVARARNGVIGRNNTLPWRLPEDLQHFKRTTMGAPIIMGRKTWDSIGRPLPGRRNIVVTRNRDL
2qk8A           --IVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
3fl8A           --IVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
3datA           --IVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
3e0bA           ---VSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
3fl9C           --IVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
3fl9F           --IVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
3fl9A           --IVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
3fl9E           --IVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
3fl9D           --IVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
3fl9B           --IVSFMVAMDENRVIGKDN-LPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNEGY
1zdrB           --MISHIVAMDENRVIGKDNRLPWHLPADLAYFKRVTMGHAIVMGRKTFEAIGRPLPGRDNVVVTGNRSF
1zdrA           --MISHIVAMDENRVIGKDNRLPWHLPADLAYFKRVTMGHAIVMGRKTFEAIGRPLPGRDNVVVTGNRSF
3ia4A           --IVSMIAALANNRVIGLDNKMPWHLPAELQLFKRATLGKPIVMGRNTFESIGRPLPGRLNIVLSRQTDY
3ia5B           --IVSMIAALANNRVIGLDNKMPWHLPAELQLFKRATLGKPIVMGRNTFESIGRPLPGRLNIVLSR-QDY
3ia4C           --IVSMIAALANNRVIGLDNKMPWHLPAELQLFKRATLGKPIVMGRNTFESIGRPLPGRLNIVLSR-QDY
3ia5A           --IVSMIAALANNRVIGLDNKMPWHLPAELQLFKRATLGKPIVMGRNTFESIGRPLPGRLNIVL--STDY
1df7A           --MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPRPLPGRRNVVLSRQADF
2inqA           --MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPG-
3dauA           --MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
2cigA           --MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRVWDSLPRPLPGRRNVVLSRQADF
1dyhA           --MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
4dfrA           --MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
1dhjA           --MISLIAALAVDRVIGMENAMPWNLPASLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
1draA           --MISLIAALAVDRVIGMENAMPWNLPAELAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
1dhiA           --MISLIAALAVDRVIGMENAMPWNLPASLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
2d0kA           ---ISLIAALAVDRVIGNENALPWNLPADLAWFKRNTLNKPVIYGRHTWESIGRPLPGRKNIILSSQPGT
1drbA           --MISLIAALAVDRVIGMENAMPWNLPACLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
2drcA           --MISLIAALAVDRVIGMENAMPFNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
3fl8H           --IVSFMVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTRNCEV
2w9tA           ---LSIIVAHDKQRVIGYQNQLPWHLPNDLKHIKQLTTGNTLVMARKTFESIGKPLPNRRNVVLTNQASF
2w9sA           ---LSIIVAHDKQRVIGYQNQLPWHLPNDLKHIKQLTTGNTLVMARKTFESIGKPLPNRRNVVLTNQASF
5dfrA           --MISLIAALAVDRVIG-----PWNLPADLAWFKRNTLDKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
3f0uX           ---LSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSF
2w9gA           ---LSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSF
3fyvX           ---LSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSF
1ly3A           ---LTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPVLMGRKTWESIPRPLKGRINVVITRNESL
1klkA           ---LTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPVLMGRKTWESIPRPLKGRINVVITRNESL
1dyrA           ---LTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPVLMGRKTWESIPRPLKGRINVVITRNESL
4cd2A           ---LTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPVLMGRKTWESIPRPLKGRINVVITRNESL
2ithA           ---LVSVAALAENRVIGRDGELPWSIPADKKQYRSRVADDPVVLGRTTFESMRDDLPGSAQIVMSRSRSF
1vdrA           ---LVSVAALAENRVIGRDGELPWSIPADKKQYRSRIADDPVVLGRTTFESMRDDLPGSAQIVMSRSRSF
3f8yA           ---LNCIVAVSQNMGIGKNGDLPWPLRNEFRYFKRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
3ghvA           ---LNCIVAVSQNMGIGKNGDLPWPLRNEFRYFKRMTTTSSVIMGKKTWFSIPRPLKGRINLVLSRELKE
1mvsA           ---LNCIVAVSQNMGIGKNGDLPWPLRNEFRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
1kmvA           ---LNCIVAVSQNMGIGKNGDLPWPLRNEFRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
1kmsA           ---LNCIVAVSQNMGIGKNGDLPWPLRNEFRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
1dhfA           ---LNCIVAVSQNMGIGKNGDLPWPLRNEFRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
1vdrB           ---LVSVAALAENRVIGRDGELPWSIPADKKQYRSRIADDPVVLGRTTFESMRDDLPGSAQIVMSRSRSF
3ghcA           ---LNCIVAVSQNMGIGKNGDLPWPLRNEFRYFSRMTTTSSVIMGKKTWFSISRPLKGRINLVLSRELKE
3k45A           ---LNCIVAVSQNMGIGKNGDLPWPLRNEFKYFQRMTTTSSVIMGRKTWFSINRPLKDRINIVLSRELKE
1hfqA           ---LNCIVAVSQNMGIGKNGDLPWPLRNESRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
3eigA           ---LNCIVAVSQNMGIGKNGDLPWPLRNERRYFERMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
3dfrA           --------AQNRNGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFKRPLPERTNVVLTHQEDY
3d80A           ---LNCIVAVSQNMGIGKNGDLPWPLRNEFKYFQRMTTTSSVIMGRKTWFSINRPLKDRINIVLSRELKE
3f91A           ---LNCIVAVSQNMGIGKNGDLPWPLRNEFRYFSRMTTTSSVIMGKKTWFSIPRPLKGRINLVLSRELKE
1dlrA           ---LNCIVAVSQNMGIGKNGDFPWPLRNEFRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
1bozA           ---LNCIVAVSQNMGIGKNGDLPWPLRNEGRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
1dlsA           ---LNCIVAVSQNMGIGKNGDYPWPLRNEFRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
1u71A           ---LNCIVAVSQNMGIGKNGDRPWPLRNEFRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
1u70A           ---LNCIVAVSQNMGIGKNGDRPWPLRNEFKYFQRMTTTSSVIMGRKTWFSINRPLKDRINIVLSRELKE
1ao8A           --------AQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFKRPLPERTNVVLTHQEDY
1ai9A           ---VAIIVAALKPALIGYKGKMPWRLRKEIRYFKDVTTRTTVIMGRKTWESIPRPLPDRLNIILSRSYEN
3hbbB           ----SLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLAVVMGRKTWDSIPRPLPGRLNVVLSSTLDL
2oipC           ------------------NGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGR-RPLKNRIIVVISSSL
2oipD           ------------------NGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGR-RPLKNRIIVVISSSL
2h2qA           ----SLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLAVVMGRKTWDSIPRPLPGRLNVVLSEKRNL
3cl9A           ----SLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLAVVMGRKTWDSIPRPLPGRLNVVLSSTDNL
1qzfA           ------------------NGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGR-RPLKNRIIVVISSSL
2oipE           ------------------NGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGR-RPLKNRIIVVISSSL
2oipA           ------------------NGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGR-RPLKNRIIVVISSSL
3dl6E           ------------------NGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGR-RPLKNRIIVVISSSL
3dl6B           ------------------NGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGR-RPLKNRIIVVISSSL
3dl6A           ------------------NGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGR-RPLKNRIIVVISSSL
3dl5B           ------------------NGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGR-RPLKNRIIVVISSSL
3dl5A           ------------------NGQLPWSISEDLKFFSKITNNKALIMGRKTWDSIGR-RPLKNRIIVVISSSL
3k2hA           ---LTIFVAVALNKVIGHKNQIPWHITHDFRFLRNGTTYIPVIFGRKTYESIPKPLKNRINVILSRTVK-
3hbbD           ----SLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLAVVMGRKTWDSIPRPLPGRLNVVLSSTDGL
3clbC           ----SLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLAVVMGRKTWDSIPRPLPGRLNVVLSSTDGL
3clbA           ----SLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLAVVMGRKTWDSIPRPLPGRLNVVLSSTDGL
3clbD           ----SLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLAVVMGRKTWDSIPRPLPGRLNVVLSSTTTQ
3clbB           ----SLVVAVDERGGIGDGRSIPWNVPEDMKFFRDVTTKLAVVMGRKTWDSIPRPLPGRLNVVLSSTTTQ
3i3rA           ---LTIFVAVALNKVIGHKNQIPWHITHDFRFLRNGTTYIPVIFGRKTYE----PLKNRINVILSRTVK-
8dfrA           ---LNSIVAVCQNMGIGKDGNLPWPLRNEYKYFQRMTSTSAVIMGKKTWFSINRPLKDRINIVLSRELKE
3i3rB           ---LTIFVAVALNKVIGHKNQIPWHITHDFRFLRNGTTYIPVIFGRKTYE-----LKNRINVILSRTVK-
2h2qB           -----------------------WNVPEDMKFFRDVTTKLAVVMGRKTWDSIPRPLPGRLNVVLSSKRNL
2blcA           ---------------LGNKGTLPWKCNSDMKYFRSVTLQNVVVMGRSNWESIPKPLPNRINVVLSKTKED
2blaA           ---------------LGNKGTLPWKCNSDMKYFRSVTMNADVVMGRSNWESIPKPLPNRINVVLSKTKED
2bl9A           ---------------LGNKGTLPWKCNSDMKYFSSVTLQNVVVMGRSSWESIPKPLPNRINVVLSKTKED
2blbA           ---------------LGNKGTLPWKCNSDMKYFSSVTLQNVVVMGRSSWESIPKPLPNRINVVLSKTKED
3cseA           ---------------IGFQGNLPWRLAKEMKYFREVTKQNVVIMGRKTWESIPRPLPKRINVVVSRSFD-
1cz3B           -----------------------WSSFEDRKNFRKTTEIGNVVMGRITFEEIGRPLPERLNVVLTRRPKF
1cz3A           -----------------------WSSFEDRKNFRKTTEIGNVVMGRITFEEIGRPLPERLNVVLTRRPKF
1juvA           ----------------GLGDGLPWRVKKDLQNFKARTEGTIMIMGAKTFQSLPTLLPGRSHIVVTKDGDL
1j3jB           ---------------LGNKGVLPWKCNSDMKYFRAVTTYVNVVMGRTNWESIPKPLSNRINVILSRKKED
1j3iB           -----------------------------------------VVMGRTSWESIPKPLSNRINVILSRKKED
1j3iA           -----------------------------------------VVMGRTSWESIPKPLSNRINVILSRKKED
3dgaB           -----------------------------------------VVMGRTSWESIPKPLSNRINVILSRKKED
3dgaA           -----------------------------------------VVMGRTSWESIPKPLSNRINVILSRKKED
1j3kB           ---------------LGNKGVLPWKISLDMKYFRAVTLQNVVVMGRTNWESIPKPLSNRINVILSRKKED
1j3jA           -----------------------------------------VVMGRTNWESIPKPLSNRINVILSRKKED
1j3kA           ---------------LGNKGVLPWKISLDMKYFRAVTLQNVVVMGRTNWESIPKPLSNRINVILSRKKED


                         .         .         *         .         .         .         .:140
query           HIEGADVVGSIEDAQRLCIGAEQVFLIGGAQLYAEALPSADRLIVTEIDADVEGDAFFPAVDRTTWVETA
2qk8A           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVF
3fl8A           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVF
3datA           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVF
3e0bA           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVF
3fl9C           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMD-TNWKEVF
3fl9F           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMD-MTWKEVF
3fl9A           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDNWKEVFVE
3fl9E           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMWKEVFVE
3fl9D           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMD-MNWKEVF
3fl9B           HVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMD---WKEVF
1zdrB           RPEGCLVLHSLEEVQWIASRADEVFIIGGAELFRATMPIVDRLYVTKIFASFPGDTFYPPISDDEWIVSY
1zdrA           RPEGCLVLHSLEEVQWIASRADEVFIIGGAELFRATMPIVDRLYVTKIFASFPGDTFYPPISDDEWIVSY
3ia4A           QPEGVTVVATLEDAVVAAGDVEELMIIGGATIYNQCLAAADRLYLTHIELTTEGDTWFPDYEQYNWQEIE
3ia5B           QPEGVTVVATLEDAVVAAGDVEELMIIGGATIYNQCLAAADRLYLTHIELTTEGDTWFPDYEQYNWQEIE
3ia4C           QPEGVTVVATLEDAVVAAGDVEELMIIGGATIYNQCLAAADRLYLTHIELTTEGDTWFPDYEQYNWQEIE
3ia5A           QPEGVTVVATLEDAVVAAGDVEELMIIGGATIYNQCLAAADRLYLTHIELTTEGDTWFPDYEQYNWQEIE
1df7A           MASGAEVVGSLEEA----LTSPETWVIGGGQVYALALPYATRCEVTEVDIGLAGDALAPVLDE-TWRGET
2inqA           -TDDVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
3dauA           D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
2cigA           MASGAEVVGSLEEA----LTSPETWVIGGGQVYALALPYATRCEVTEVDIGLAGDALAPVLDE-TWRGET
1dyhA           D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
4dfrA           D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
1dhjA           D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVS
1draA           D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
1dhiA           D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
2d0kA           D-DRVTWVKSVDEAIAAAGDVPEIFVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
1drbA           D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
2drcA           D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
3fl8H           ---------AHSXXXXXXXXXXXXXXXGGAQIYDLFLPYVDKLYITKIHHAFEGDTFFPEMDMTNWKEVF
2w9tA           HHEGVDVINSLDEIKEL---SGHVFIFGGQTLYEAMIDQVDDMYITVIDGKFQGDTFFPPYTFEDWVESS
2w9sA           HHEGVDVINSLDEIKEL---SGHVFIFGGQTLYEAMIDQVDDMYITVIDGKFQGDTFFPPYTFEDWVESS
5dfrA           D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
3f0uX           NVEGVDVIHSIEDIYQL---PGHVFIFGGQTLYEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWVASS
2w9gA           NVEGVDVIHSIEDIYQL---PGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWVASS
3fyvX           NVEGVDVIHSIEDIYQL---PGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWVASS
1ly3A           DLNGIHSAKSLDHALELSVQINRIFVIGGAQLYKAAMPKLDRIMATIIYKDIHCDVFFPLSDLESWVGT-
1klkA           DLNGIHSAKSLDHALELSVQINRIFVIGGAQLYKAAMPKLDRIMATIIYKDIHCDVFFPLSDLESWVGT-
1dyrA           DLNGIHSAKSLDHALELSVQINRIFVIGGAQLYKAAMPKLDRIMATIIYKDIHCDVFFPLSDLESWVGT-
4cd2A           DLNGIHSAKSLDHALELSVQINRIFVIGGAQLYKAAMPKLDRIMATIIYKDIHCDVFFPLSDLESWVGT-
2ithA           SVDTAHRAASVEEAVDIALDAETAYVIGGAAIYALFQPHLDRMVLSRVPGEYEGDTYYP-----------
1vdrA           SVDTAHRAASVEEAVDIALDAETAYVIGGAAIYALFQPHLDRMVLSRVPGEYEGDTYYP-----------
3f8yA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
3ghvA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
1mvsA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
1kmvA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
1kmsA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
1dhfA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
1vdrB           SVDTAHRAASVEEAVDIALDAETAYVIGGAAIYALFQPHLDRMVLSRVP---EGDTYYP-----------
3ghcA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
3k45A           PPRGAHFLASLDDALRLASKVDMVWIVGGSSVYQEAMPGHLRLFVTRIMQEFESDTFFPEIDLGKYPEYP
1hfqA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
3eigA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
3dfrA           QAQGXXXXXXXXXKQHL---DQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGD---------------
3d80A           PPRGAHFLASLDDALRLIEQPEMVWIVGGSSVYQEAMPGHLRLFVTRIMQEFESDTFFPEIDLGKYPEYP
3f91A           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
1dlrA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
1bozA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
1dlsA           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
1u71A           PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
1u70A           PPRGAHFLASLDDALRLIEQPEMVWIVGGSSVYQEAMPGHLRLFVTRIMQEFESDTFFPEIDLGKYPEYP
1ao8A           QAQGXXXXXXXXXXXXXXHPDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGD---------------
1ai9A           EIIDDNIISSIESSLNLVSDVERVFIIGGAEIYNELINNSSHLLITEIEESIEMDTF-------------
3hbbB           HADSIVAVGGLEQALQLLASIETVYCIGGGSVYAEAL---------------------------------
2oipC           PQDEADVFRNLEDSIENLMSIENIFVCGGESIYRDALKDVDRIYLTRVAEDIEFDTYFPEIP-----ETF
2oipD           PQDEADVFRNLEDSIENLMSIENIFVCGGESIYRDALKDVDRIYLTRVAEDIEFDTYFPEIP-----ETF
2h2qA           HADSIVAVGGLEQALQLLASIETVYCIGGGSVYAEAL---------------------------------
3cl9A           HADSIVAVGGLEQALQLLASIETVYCIGGGSVYAEAL---------------------------------
1qzfA           PQDEADVFRNLEDSIENLMSIENIFVCGGESIYRDALKDVDRIYLTRVAEDIEFDTYFPEIP-----ETF
2oipE           PQDEADVFRNLEDSIENLMSIENIFVCGGESIYRDALKDVDRIYLTRVAEDIEFDTYFPEIP-----ETF
2oipA           PQDEADVFRNLEDSIENLMSIENIFVCGGESIYRDALKDVDRIYLTRVAEDIEFDTYFPEIP-----ETF
3dl6E           PQDEADVFRNLEDSIENLMSIENIFVCGGESIYRDALKDVDRIYLTRVAEDIEFDTYFPEIP-----ETF
3dl6B           PQDEADVFRNLEDSIENLMSIENIFVCGGESIYRDALKDVDRIYLTRVAEDIEFDTYFPEIP-----ETF
3dl6A           PQDEADVFRNLEDSIENLMSIENIFVCGGESIYRDALKDVDRIYLTRVAEDIEFDTYFPEIP-----ETF
3dl5B           PQDEADVFRNLEDSIENLMSIENIFVCGGESIYRDALKDVDRIYLTRVAEDIEFDTYFPEIP-----ETF
3dl5A           PQDEADVFRNLEDSIENLMSIENIFVCGGESIYRDALKDVDRIYLTRVAEDIEFDTYFPEIP-----ETF
3k2hA           EVPGCLVYEDLSTALRANVPHNKIFILGGSFLYKEVLDNCDKIYLTRLNKEYPGDTYFPDIPDTFEITAI
3hbbD           HADSIVAVGGLEQALQLLASIETVYCIGGGSVYAEAL---------------------------------
3clbC           PDEHADVNGGLEQALQLLASIETVYCIGGGSVYAEAL---------------------------------
3clbA           PDEHADVNGGLEQALQLLASIETVYCIGGGSVYAEAL---------------------------------
3clbD           HLDHADVNGGLEQALQLLASIETVYCIGGGSVYAEAL---------------------------------
3clbB           HLDEADVNGGLEQALQLLASIETVYCIGGGSVYAEAL---------------------------------
3i3rA           EVPGCLVYEDLSTALRANVPHNKIFILGGSFLYKEVLDNCDKIYLTRLNKEYPGDTYFPDIPDTFEITAI
8dfrA           APKGAHYXXXXXXXXELKSKVDMVWIVGGTAVYKAAMPINHRLFVTRILHEFESDTFFPEIDLTEYPGVP
3i3rB           EVPGCLVYEDLSTALRANVPHNKIFILGGSFLYKEVLDNCDKIYLTRLNKEYPGDTYFPDIPDTFEITAI
2h2qB           HADSIVAVGGLEQALQLLASIETVYCIGGGSVYAEAL---------------------------------
2blcA           VKEKVFIIDSIDDXXXXXXXXXXXFIIGGAQVYRECLSRIKQIYFTRINGAYPCDVFFPEFDESEFVTSV
2blaA           VKEKVFIIDSIDDXXXXXXXXXXXFIIGGAQVYRECLSRIKQIYFTRINGAYPCDVFFPEFDESEFVTSV
2bl9A           VKEKVFIIDSIDDXXXXXXXXXXXFIIGGAQVYRECLSRIKQIYFTRINGAYPCDVFFPEFDESEFVTSV
2blbA           VKEKVFIIDSIDDXXXXXXXXXXXFIIGGAQVYRECLSRIKQIYFTRINGAYPCDVFFPEFDESEFVTSV
3cseA           ----------------------------------------------------------------------
1cz3B           NGSPADVVKFLEGK-----GYERVAVIGGKTVFTEFLREVDELFVT------------------------
1cz3A           NGSPADVVKFLEGK-----GYERVAVIGGKTVFTEFLREVDELFVT------------------------
1juvA           YISGGEIQVSSPNAETMLDQNSKVSVIGGXXXXXXXXXXXDEVVVSRINSTVQLDAFLDDISKREMVET-
1j3jB           FDEDVYIINKVEDLIVLLLNYYKCFIIGGSVVYQEFLEKIKKIYFTRINSTYECDVFFPEINENEYIISV
1j3iB           FDEDVYIINKVEDLIVLLLNYYKCFIIGGSVVYQEFLEKIKKIYFTRINSTYECDVFFPEINENEYIISV
1j3iA           FDEDVYIINKVEDLIVLLLNYYKCFIIGGSVVYQEFLEKIKKIYFTRINSTYECDVFFPEINENEYIISV
3dgaB           FDEDVYIINKVEDLIVLLLNYYKCFIIGGSVVYQEFLEKIKKIYFTRINSTYECDVFFPEINENEYIISV
3dgaA           FDEDVYIINKVEDLIVLLLNYYKCFIIGGSVVYQEFLEKIKKIYFTRINSTYECDVFFPEINENEYIISV
1j3kB           FDEDVYIINKVEDLIVLLLNYYKCFILGGSVVYQEFLEKIKKIYFTRINSTYECDVFFPEINENEYIISV
1j3jA           FDEDVYIINKVEDLIVLLLNYYKCFIIGGSVVYQEFLEKIKKIYFTRINSTYECDVFFPEINENEYIISV
1j3kA           FDEDVYIINKVEDLIVLLLNYYKCFILGGSVVYQEFLEKIKKIYFTRINSTYECDVFFPEINENEYIISV


                         +         .         .         .         .         *         .:210
query           RELHHSETNGFDYAFVTYERPASGEx
2qk8A           VEKGTDEKNPYTYYYHVYEK------
3fl8A           VEKGTDEKNPYTYYYHVYEK------
3datA           VEKGTDEKNPYTYYYHVYEK------
3e0bA           VEKGTDEKNPYTYYYHVYEK------
3fl9C           VEKGTDEKNPYTYYYHVYEK------
3fl9F           VEKGTDEKNPYTYYYHVYEK------
3fl9A           KGL-TDEKNPYTYYYHVYEK------
3fl9E           KGL-TDEKNPYTYYYHVYEK------
3fl9D           VEKGTDEKNPYTYYYHVYEK------
3fl9B           VEKGTDEKNPYTYYYHVYEK------
1zdrB           TPGGKDEKNPYEHAFIIYER------
1zdrA           TPGGKDEKNPYEHAFIIYER------
3ia4A           HESYAADKNPHNYRFSLLER------
3ia5B           HESYAADKNPHNYRFSLLER------
3ia4C           HESYAADKNPHNYRFSLLER------
3ia5A           HESYAADKNPHNYRFSLLER------
1df7A           GEWRFSR-SGLRYRLYSYHR------
2inqA           SEFHDADANSHSYCFEILER------
3dauA           SEFHDADANSHSYCFEILER------
2cigA           GEWRFSR-SGLRYRLYSYHR------
1dyhA           SEFHDADANSHSYCFEILER------
4dfrA           SEFHDADANSHSYCFKILER------
1dhjA           SEFHDADANSHSYCFEILER------
1draA           SEFHDADANSHSYCFEILER------
1dhiA           SEFHDADANSHSYCFEILER------
2d0kA           SEFHDADANSHSYSFEILER------
1drbA           SEFHDADANSHSYCFEILER------
2drcA           SEFHDADANSHSYCFEILER------
3fl8H           VEKGTDEKNPYTYYYHVYEK------
2w9tA           VEGQLDEKNTIPHTFL----------
2w9sA           VEGQLDEKNTIPHTFL----------
5dfrA           SEFHDADANSHSYCFEILER------
3f0uX           VEGKLDEKNTIPHTFL----------
2w9gA           VEGKLDEKNTIPHTFL----------
3fyvX           VEGKLDEKNTIPHTFL----------
1ly3A           -KVPHGKINGFDYEFEMWTR------
1klkA           -KVPHGKINGFDYEFEMWTR------
1dyrA           -KVPHGKINGFDYEFEMWTR------
4cd2A           -KVPHGKINGFDYEFEMWTR------
2ithA           --------------------------
1vdrA           --------------------------
3f8yA           KLLPEQEEKGIKYKFEVYEK------
3ghvA           KLLPEQEEKGIKYKFEVYEK------
1mvsA           KLLPEQEEKGIKYKFEVYEK------
1kmvA           KLLPEQEEKGIKYKFEVYEK------
1kmsA           KLLPEQEEKGIKYKFEVYEK------
1dhfA           KLLPEQEEKGIKYKFEVYEK------
1vdrB           --------------------------
3ghcA           KLLPEQEEKGIKYKFEVYEK------
3k45A           GVLSEQEEKGIKYKFEVYEK------
1hfqA           KLLPEQEEKGIKYKFEVYEK------
3eigA           KLLPEQEEKGIKYKFEVYEK------
3dfrA           --------------------------
3d80A           GVLSEQEEKGIKYKFEVYEK------
3f91A           KLLPEQEEKGIKYKFEVYEK------
1dlrA           KLLPEQEEKGIKYKFEVYEK------
1bozA           KLLPEQEEKGIKYKFEVYEK------
1dlsA           KLLPEQEEKGIKYKFEVYEK------
1u71A           KLLPEQEEKGIKYKFEVYEK------
1u70A           GVLSEQEEKGIKYKFEVYEK------
1ao8A           --------------------------
1ai9A           --------------------------
3hbbB           --------------------------
2oipC           LPVYMSQTKNISYDFMIFEKPARGQ-
2oipD           LPVYMSQTKNISYDFMIFEKPARGQ-
2h2qA           --------------------------
3cl9A           --------------------------
1qzfA           LPVYMSQTKNISYDFMIFEK------
2oipE           LPVYMSQTKNISYDFMIFEK------
2oipA           LPVYMSQTKNISYDFMIFEK------
3dl6E           LPVYMSQTKNISYDFMIFEK------
3dl6B           LPVYMSQTKNISYDFMIFEK------
3dl6A           LPVYMSQTKNISYDFMIFEK------
3dl5B           LPVYMSQTKNISYDFMIFEK------
3dl5A           LPVYMSQTKNISYDFMIFEK------
3k2hA           SPTF--STDFVSYDFVIYER------
3hbbD           --------------------------
3clbC           --------------------------
3clbA           --------------------------
3clbD           --------------------------
3clbB           --------------------------
3i3rA           SPTF--STDFVSYDFVIYER------
8dfrA           ADI--QEEDGIQYKFEVYQK------
3i3rB           SPTF--STDFVSYDFVIYER------
2h2qB           --------------------------
2blcA           SEVYNSKGTTLDF-------------
2blaA           SEVYNSKGTTLDF-------------
2bl9A           SEVYNSKGTTLDF-------------
2blbA           SEVYNSKGTTLDF-------------
3cseA           --------------------------
1cz3B           --------------------------
1cz3A           --------------------------
1juvA           --------------------------
1j3jB           SDVYTSNNTTLD--FIIYKK------
1j3iB           SDVYTSNNTTLD--FIIYKK------
1j3iA           SDVYTSNNTTLD--FIIYKK------
3dgaB           SDVYTSNNTTLD--FIIYKK------
3dgaA           SDVYTSNNTTLD--FIIYKK------
1j3kB           SDVYTSNNTTLD--FIIYKK------
1j3jA           SDVYTSNNTTLD--FIIYKK------
1j3kA           SDVYTSNNTTLD--FIIYKK------