[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rmet0:ABF09694.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3ckyC.bssp"
#ERROR : Can't open dsspfile "3ckyB.bssp"
#ERROR : Can't open dsspfile "3ckyA.bssp"
#ERROR : Can't open dsspfile "1yb4A.bssp"
#ERROR : Can't open dsspfile "1vpdA.bssp"
#ERROR : Can't open dsspfile "2gf2D.bssp"
#ERROR : Can't open dsspfile "2gf2C.bssp"
#ERROR : Can't open dsspfile "2gf2B.bssp"
#ERROR : Can't open dsspfile "2gf2A.bssp"
#ERROR : Can't open dsspfile "3ckyD.bssp"
#ERROR : Can't open dsspfile "2uyyD.bssp"
#ERROR : Can't open dsspfile "2uyyA.bssp"
#ERROR : Can't open dsspfile "3cumA.bssp"
#ERROR : Can't open dsspfile "1wp4C.bssp"
#ERROR : Can't open dsspfile "1wp4A.bssp"
#ERROR : Can't open dsspfile "3dojA.bssp"
#ERROR : Can't open dsspfile "2cvzA.bssp"
#ERROR : Can't open dsspfile "3g0oA.bssp"
#ERROR : Can't open dsspfile "2w90B.bssp"
#ERROR : Can't open dsspfile "2w90A.bssp"
#ERROR : Can't open dsspfile "2w8zB.bssp"
#ERROR : Can't open dsspfile "2w8zA.bssp"
#ERROR : Can't open dsspfile "2zygB.bssp"
#ERROR : Can't open dsspfile "2zygA.bssp"
#ERROR : Can't open dsspfile "2zydA.bssp"
#ERROR : Can't open dsspfile "2zyaB.bssp"
#ERROR : Can't open dsspfile "2zyaA.bssp"
#ERROR : Can't open dsspfile "3fwnA.bssp"
#ERROR : Can't open dsspfile "1pgjA.bssp"
#ERROR : Can't open dsspfile "2iz1B.bssp"
#ERROR : Can't open dsspfile "2iz0B.bssp"
#ERROR : Can't open dsspfile "2iypC.bssp"
#ERROR : Can't open dsspfile "2iypB.bssp"
#ERROR : Can't open dsspfile "2iypA.bssp"
#ERROR : Can't open dsspfile "2iyoA.bssp"

## Summary of PDB Search
:289
    1e-41  35%  3ckyC  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    1e-41  35%  3ckyB  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    1e-41  35%  3ckyA  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    4e-41  40%  1yb4A  [x.x.x] TARTRONIC SEMIALDEHYDE REDUCTASE
    4e-39  41%  1vpdA  [c.2.1 - a.100.1] TARTRONATE SEMIALDEHYDE REDUCTASE
    3e-35  34%  2gf2D  [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    3e-35  34%  2gf2C  [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    3e-35  34%  2gf2B  [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    3e-35  34%  2gf2A  [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    5e-32  37%  3ckyD  [x.x.x] 2-HYDROXYMETHYL GLUTARATE DEHYDROGENASE
    3e-26  27%  2uyyD  [x.x.x] N-PAC PROTEIN
    3e-26  27%  2uyyA  [x.x.x] N-PAC PROTEIN
    3e-24  39%  3cumA  [x.x.x] PROBABLE 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    2e-20  30%  1wp4C  [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    4e-20  30%  1wp4A  [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    2e-17  22%  3dojA  [x.x.x] DEHYDROGENASE-LIKE PROTEIN
    1e-13  30%  2cvzA  [c.2.1 - a.100.1 (1j3vA)] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    9e-11  29%  3g0oA  [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    2e-10  32%  2w90B  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    2e-10  32%  2w90A  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    2e-10  32%  2w8zB  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    2e-10  32%  2w8zA  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    4e-10  30%  2zygB  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    4e-10  30%  2zygA  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    1e-09  30%  2zydA  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    1e-09  30%  2zyaB  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    1e-09  30%  2zyaA  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    1e-09  30%  3fwnA  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    3e-07  29%  1pgjA  [c.2.1 - a.100.1] 6-PHOSPHOGLUCONATE DEHYDROGENASE
    6e-07  30%  2iz1B  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    6e-07  30%  2iz0B  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    6e-07  30%  2iypC  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    6e-07  30%  2iypB  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    6e-07  30%  2iypA  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
    6e-07  30%  2iyoA  [x.x.x] 6-PHOSPHOGLUCONATE DEHYDROGENASE,
:289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTTVAFIGLGAMGAPMVGHLIRAGHTVRAFVRRPEAADAARQLGAEPFFTPAEAAQGAAVVFTNVTSSED
3ckyC           ---IGFIGLGAMGKPMAINLLKEGVTVYAFDLMEXXXXXXXXXXXXXCENNQKVAAASDIIFTSLPNAGI
3ckyB           ---IGFIGLGAMGKPMAINLLKEGVTVYAFDLMEXXXXXXXXXXXXXCENNQKVAAASDIIFTSLPNAGI
3ckyA           ---IGFIGLGAMGKPMAINLLKEGVTVYAFDLMEXXXXXXXXXXXXXCENNQKVAAASDIIFTSLPNAGI
1yb4A           ---LGFIGLG-IGSPAI-NLARAGHQLHVTTIGP-VADELLSLGAVNVETARQVTEFADIIFI-VPDTPQ
1vpdA           ---VGFIGLG-IGKPSK-NLLKAGYSLVVSDRNPEAIADVXXXXXXXXXXXXXXXXQCDVIIT-LPNSPH
2gf2D           ---VGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSIN
2gf2C           ---VGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSIN
2gf2B           ---VGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSIN
2gf2A           ---VGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSIN
3ckyD           ----------------------------------------------------------------VAAASD
2uyyD           ---IGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKA
2uyyA           ---IGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKA
3cumA           ---IAFIGLGH-GAPAT-NLLKAGYLLNVFDLVQSXXXXXXXXXXXXXXXXXXXVQGADVVIS-LPASQH
1wp4C           MEKVAFIGLGAMGYPMAGHLARRFPTLVWNRTFEKALRHQEEFGSEA--VPLERVAEARVIFTCLPTTRE
1wp4A           ---VAFIGLGAMGYPMAGHLARRFPTLVWNRTFEKALRHQEEFGSEA--VPLERVAEARVIFTCLPTTRE
3dojA           MMEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYTIAMLSDPCA
2cvzA           ---VAFIGLGA-GYP-AGHLARRFPTLVWNRTFEKALRHQEEFGSEA--VPLERVAEARVIFTCLPTTRE
3g0oA           ----------------------------------------------------------------VVNAAQ
2w90B           ---IGVIGLAVMGKNLALNIESKGYSVAVYNRLREKTDEFLQ-----------EAKGKNIVGTYVNALEK
2w90A           ---IGVIGLAVMGKNLALNIESKGYSVAVYNRLREKTDEFLQ-----------EAKGKNIVGTYVNALEK
2w8zB           ---IGVIGLAVMGKNLALNIESKGYSVAVYNRLREKTDEFLQ-----------EAKGKNIVGTYVNALEK
2w8zA           ---IGVIGLAVMGKNLALNIESKGYSVAVYNRLREKTDEFLQ-----------EAKGKNIVGTYVNALEK
2zygB           ---IGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEAENPGKKPYYTVQEF----------VESLET
2zygA           ---IGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEAENPGKKPYYTVQEF----------VESLET
2zydA           ---IGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEAENPGKKPYYTVKEF----------VESLET
2zyaB           ---IGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEAENPGKKPYYTVKEF----------VESLET
2zyaA           ---IGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEAENPGKKPYYTVKEF----------VESLET
3fwnA           ---IGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEAENPGKKPYYTVKEF----------VESLET
1pgjA           ----------------------------------------------------------------------
2iz1B           ----------------------------------------------------------------------
2iz0B           ----------------------------------------------------------------------
2iypC           ----------------------------------------------------------------------
2iypB           ----------------------------------------------------------------------
2iypA           ----------------------------------------------------------------------
2iyoA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VREVLLGRNGVVEGAAPGTICVDHSTISPIVTREIAQALAACGIEALDCPVSGGTVGAQAATLTIMVGGK
3ckyC           VETVMNGPGGVLSACKAGTVIVDMSSVSPSSTLKMAKVAAEKGIDYVDAPVSGGTKGAEAGTLTIMVGAS
3ckyB           VETVMNGPGGVLSACKAGTVIVDMSSVSPSSTLKMAKVAAEKGIDYVDAPVSGGTKGAEAGTLTIMVGAS
3ckyA           VETVMNGPGGVLSACKAGTVIVDMSSVSPSSTLKMAKVAAEKGIDYVDAPVSGGTKGAEAGTLTIMVGAS
1yb4A           VEDVLFGEHGCAKTSLQGKTIVD-SSISPIETKRFAQRVNE-GADYLDAPVSGGEIGAREGTLSI-VGGE
1vpdA           VKEVALGENGIIEGAKPGTVLID-SSIAPLASREISDALKAKGVE-LDAPVSGGEPKAIDGTLSV-VGGD
2gf2D           AIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGV
2gf2C           AIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGV
2gf2B           AIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGV
2gf2A           AIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGV
3ckyD           IIFTSLPNAGIVE-TVMNTVIVDMSSVSPSSTLKMAKVAAEKGIDYVDAPVSGGTKGAEAGTLTIMVGAS
2uyyD           AKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGD
2uyyA           AKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGD
3cumA           VEGLYLDDDGLLAHIAPGTLVLECSTIAPTSARKIHAAARERGL-ALDAPVSXXXXXXXXXXLTF-VGGD
1wp4C           VYEVA---EALYPYLREGTYWVDATSGXXXXXXXXXXXXXXKGVTYLDAPVSGGTSGAEAGTLTVMLGGP
1wp4A           VYEVA---EALYPYLREGTYWVDATSGXXXXXXXXXXXXXXKGVTYLDAPVSGGTSGAEAGTLTVMLGGP
3dojA           ALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAEDGQLIILAAGD
2cvzA           VYEVA---EALYPYLREGTYWVDATSGXXXXXXXXXXXXXXKGVTYLDAPVSGGTSGAEAGTLTVL-GGP
3g0oA           VRQVLF--DGVAH-LKPGSAVVS-STISSADAQEIXXXXXXXXXXX-DAPVSGGAV--KAAQGETVASGS
2w90B           PRKILL----MVKAGAPGDIVIDGGNTYFKDTQRRNKELAELGIHFIGTGVSGGEEGALKGP-SIMPGGQ
2w90A           PRKILL----MVKAGAPGDIVIDGGNTYFKDTQRRNKELAELGIHFIGTGVSGGEEGALKGP-SIMPGGQ
2w8zB           PRKILL----MVKAGAPGDIVIDGGNTYFKDTQRRNKELAELGIHFIGTGVSGGEEGALKGP-SIMPGGQ
2w8zA           PRKILL----MVKAGAPGDIVIDGGNTYFKDTQRRNKELAELGIHFIGTGVSGGEEGALKGP-SIMPGGQ
2zygB           PRRILLGTDSAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGTLKGP-SIMPGGQ
2zygA           PRRILLGTDSAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGTLKGP-SIMPGGQ
2zydA           PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
2zyaB           PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
2zyaA           PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
3fwnA           PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
1pgjA           -----------------------------------AQQLEAAGLRFLGMGISGGEEGARKGP-AFFPGGT
2iz1B           --------------------------------------LADSGINFIGTGVSGGEKGALLGP-SMMPGGQ
2iz0B           --------------------------------------LADSGINFIGTGVSGGEKGALLGP-SMMPGGQ
2iypC           --------------------------------------LADSGINFIGTGVSGGEKGALLGP-SMMPGGQ
2iypB           --------------------------------------LADSGINFIGTGVSGGEKGALLGP-SMMPGGQ
2iypA           --------------------------------------LADSGINFIGTGVSGGEKGALLGP-SMMPGGQ
2iyoA           --------------------------------------LADSGINFIGTGVSGGEKGALLGP-SMMPGGQ


                         +         .         .         .         .         *         .:210
query           AEVLEKVRPLLEQIGKTITHIGDSGAGQVAKLCNQIAQVVNIEGIAEAMRFAGAQGVDTAKVFQAMSTGM
3ckyC           EAVFEKIQPVLSVIGKDIYHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSS
3ckyB           EAVFEKIQPVLSVIGKDIYHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSS
3ckyA           EAVFEKIQPVLSVIGKDIYHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSS
1yb4A           QKVFDRVKPLFDILGKNITLVGGNGDGQTCKVANQIIVALNIEAVSEALVFASKAGADPVRVRQALG-GF
1vpdA           KAIFDKYYDL--KAAGSVVHTGDIGAGNVTKLANQVIVALNI-AASEALTLATKAGVNPDLVYQAIRGGL
2gf2D           EDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDLAKILN-MSSGR
2gf2C           EDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDLAKILN-MSSGR
2gf2B           EDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDLAKILN-MSSGR
2gf2A           EDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDLAKILN-MSSGR
3ckyD           EAVFEKIQPVLSVIGKDIYHVGDTGAGDAVKIVNNLLLGCNMASLAEALVLGVKCGLKPETMQEIIGKSS
2uyyD           RGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQ
2uyyA           RGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQ
3cumA           AEALEKARPLFEA-GRNIFHAGPDGAGQVAKVCNNQLLAVLI-GTAEA-ALGVANGLE-AKVLAEIRRSS
1wp4C           EEAVERVRPFL-AYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEGLLALVKQGVSAEKALEVINASS
1wp4A           EEAVERVRPFL-AYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEGLLALVKQGVSAEKALEVINASS
3dojA           KALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGSMMNAFSEGLVLADKXXXXXXXXXXXXXXGA
2cvzA           EEAVERVRPFL-AYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEGLLALVKQGVSAEKALEVINASS
3g0oA           EAAFTRLKPVLDAVASNVYRISDTGAGSTVKIIHQLLAGVHIXXXXXXXXXXXX-GIPL-DVYDVV-THA
2w90B           KEAHELVRPIFEAIAAKVTYIGPDGAGHYVKMVHNGIEYGDMQLIAEAKHVLGMDAAELHEVFADWNKGE
2w90A           KEAHELVRPIFEAIAAKVTYIGPDGAGHYVKMVHNGIEYGDMQLIAEAKHVLGMDAAELHEVFADWNKGE
2w8zB           KEAHELVRPIFEAIAAKVTYIGPDGAGHYVKMVHNGIEYGDMQLIAEAKHVLGMDAAELHEVFADWNKGE
2w8zA           KEAHELVRPIFEAIAAKVTYIGPDGAGHYVKMVHNGIEYGDMQLIAEAKHVLGMDAAELHEVFADWNKGE
2zygB           KEAYELVAPILKQIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLALSNEELAQTFTEWNEGE
2zygA           KEAYELVAPILKQIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLALSNEELAQTFTEWNEGE
2zydA           KEAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLTNEELAQTFTEWNNGE
2zyaB           KEAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLTNEELAQTFTEWNNGE
2zyaA           KEAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLTNEELAQTFTEWNNGE
3fwnA           KEAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLTNEELAQTFTEWNNGE
1pgjA           LSVWEEIRPIVEAAAPCVTMNGSGGAGSCVKMYHNSGEYAILQIWGEVFDILRAMGLNNDEVAAVLSKNF
2iz1B           KEAYDLVAPIFEQIGKCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESKRILGLSNAEIQAIFEEWNEGE
2iz0B           KEAYDLVAPIFEQIGKCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESKRILGLSNAEIQAIFEEWNEGE
2iypC           KEAYDLVAPIFEQIGKCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESKRILGLSNAEIQAIFEEWNEGE
2iypB           KEAYDLVAPIFEQIGKCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESKRILGLSNAEIQAIFEEWNEGE
2iypA           KEAYDLVAPIFEQIGKCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESKRILGLSNAEIQAIFEEWNEGE
2iyoA           KEAYDLVAPIFEQIGKCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESKRILGLSNAEIQAIFEEWNEGE


                         .         .         .         +         .         .         .:280
query           AGSRMLDMLGPKMVTRDFSAGIESRLHAKDFGLAADIATEIGLELPAMRATSAQLGELMDQGWGKDDTSS
3ckyC           GRSYAMEAKMEKFISGDFAGGFAMDLQHKDLGLALEAGKEGNVPLP-MTAMATQIFEGRAMGLGREDMSA
3ckyB           GRSYAMEAKMEKFISGDFAGGFAMDLQHKDLGLALEAGKEGNVPLP-MTAMATQIFEGRAMGLGREDMSA
3ckyA           GRSYAMEAKMEKFISGDFAGGFAMDLQHKDLGLALEAGKEGNVPLP-MTAMATQIFEGRAMGLGREDMSA
1yb4A           ASSRILEVHGER-INRTFEPGFKIALHQKDLNLALQSAKALALNLP-NTATCQELFNTCAANGGSQLDHS
1vpdA           AGSTVLDAKAP--VDRNFKPGFRIDLHIKDLANALDTSHGVGAQLP---LTAAVEQALRADGHGNDDHSA
2gf2D           CWSS--DTYNPVPGVMDYQGGFGTTLMAKDLGLAQDSATSTKSPI-LLGSLAHQIYRMMAKGYSKKDFSS
2gf2C           CWSS--DTYNPVPGVMDYQGGFGTTLMAKDLGLAQDSATSTKSPI-LLGSLAHQIYRMMAKGYSKKDFSS
2gf2B           CWSS--DTYNPVPGVMDYQGGFGTTLMAKDLGLAQDSATSTKSPI-LLGSLAHQIYRMMAKGYSKKDFSS
2gf2A           CWSS--DTYNPVPGVMDYQGGFGTTLMAKDLGLAQDSATSTKSPI-LLGSLAHQIYRMMAKGYSKKDFSS
3ckyD           GRSYAMEAKMEKFISGDFAGGFAMDLQHKDLGLALEAGKEGNVPLP-MTAMATQIFEGRAMGLGREDMSA
2uyyD           LASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAAN------------------
2uyyA           LASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAAN------------------
3cumA           GGNWALEVYNPAPASRDYSGGFAQL--AKDLGL-------------------------------------
1wp4C           GRSNATENLIPRVLTRAFPKTFALGLLVKDLGIAMGVLDGEKAPSPLLR-LAREVYEMAKRELGPDDHVE
1wp4A           GRSNATENLIPRVLTRAFPKTFALGLLVKDLGIAMGVLDGEKAPSPLLR-LAREVYEMAKRELGPDDHVE
3dojA           MTNPMFKGKGPSMNKSSYPPAFPLKHQQKDMRLALALGDENAVSMPVXXXXXXXXXXXRSLGLGDLDFSA
2cvzA           GRSNATENLIPRVLTRAFPKTFALGLLVKDLGIA------------------------------------
3g0oA           AGNSWFENR-QHVVDGDYTPRSAVDIFVKDLGLVADTAKALRFPLP-LASTALNFTSASNAGYGKEDDSA
2w90B           LNSYLIEI--------------------------------------------------------------
2w90A           LNSYLIEI--------------------------------------------------------------
2w8zB           LNSYLIEI--------------------------------------------------------------
2w8zA           LNSYLIEI--------------------------------------------------------------
2zygB           LSSYLIDI--------------------------------------------------------------
2zygA           LSSYLIDI--------------------------------------------------------------
2zydA           LSSYLIDI--------------------------------------------------------------
2zyaB           LSSYLIDI--------------------------------------------------------------
2zyaA           LSSYLIDI--------------------------------------------------------------
3fwnA           LSSYLIDI--------------------------------------------------------------
1pgjA           LKSYMLDISIAAARAKDLTEHVMDRIGSKGTGLSAQEALEIGVPAPSL----------------------
2iz1B           LDSYLIEITKEVLKRKD-----------------------------------------------------
2iz0B           LDSYLIEITKEVLKRKD-----------------------------------------------------
2iypC           LDSYLIEITKEVLKRKD-----------------------------------------------------
2iypB           LDSYLIEITKEVLKRKD-----------------------------------------------------
2iypA           LDSYLIEITKEVLKRKD-----------------------------------------------------
2iyoA           LDSYLIEITKEVLKRKD-----------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LLKVLELKG
3ckyC           VIKVWE---
3ckyB           VIKVWE---
3ckyA           VIKVWE---
1yb4A           AVQALEL--
1vpdA           L--------
2gf2D           VFQFL----
2gf2C           VFQFL----
2gf2B           VFQFL----
2gf2A           VFQFL----
3ckyD           VIKVWE---
2uyyD           ---------
2uyyA           ---------
3cumA           ---------
1wp4C           ALRLLERWG
1wp4A           ALRLLERWG
3dojA           VIEAVK---
2cvzA           ---------
3g0oA           VIKI-----
2w90B           ---------
2w90A           ---------
2w8zB           ---------
2w8zA           ---------
2zygB           ---------
2zygA           ---------
2zydA           ---------
2zyaB           ---------
2zyaA           ---------
3fwnA           ---------
1pgjA           ---------
2iz1B           ---------
2iz0B           ---------
2iypC           ---------
2iypB           ---------
2iypA           ---------
2iyoA           ---------