[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF06949.1

[Show Plain Result]


## Summary of Sequence Search
    1::339
    1::305     8e-80  53%  310 aa  YBGK_ECOLI RecName: Full=Uncharacterized protein ybgK;
    1::301     7e-63  45%  309 aa  Y1730_HAEIN RecName: Full=Uncharacterized protein HI1730;
    1::325     8e-48  36%  335 aa  KIPA_BACSU RecName: Full=KipI antagonist;         Short=Protein
  464::782     2e-33  31% 1241 aa  LAMA_EMENI RecName: Full=Putative urea carboxylase;       
 1080::1414    1e-31  29% 1835 aa  DUR1_YEAST RecName: Full=Urea amidolyase;Includes:  RecName:
 1074::1399    2e-29  30% 1830 aa  DUR1_SACKL RecName: Full=Urea amidolyase;AltName: Full=Uracil
    1::339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIEIIRPGAQASVQDLXXXXXXXXXXXXSGAADDLALRVGNRLLGNDPGAAAIEFTLGRAAVRFEADMRV
YBGK_ECOLI      MLKIIRAGMYTTVQDGGRHGFRQSGISHCGALDMPALRIANLLVGNDANAPALEITLGQLTVEFETDGWF
Y1730_HAEIN     MIDILDVKSRATIQDLGRFGLRRFGISHCGAMDKLALRAGNILLGNAENVPAIEVPLGGITLQFQQDMNF
KIPA_BACSU      -MKVLKPGLLTTVQDIGRTGYQKYGVLASGAMDTVSLRIANLLIGNGENEAGLEITMPGPSFHFSKQTLI
LAMA_EMENI      -IDVISGGAYTLIQDWPGRPTVGRGFCHSGPMDSVAFRIANALVGNPVGLEGLEITLSGPELRFLGPAVI
DUR1_YEAST      -IEITLPGAHTSIQDYPGRVGYWRIGVPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPSIVFHCETVI
DUR1_SACKL      --EVTSPGAYTTVQDYPGRVGYWRIGVPSGPMDAYSFRLANRIVGNHYKAPAIELTLNGPKILFHTETXX


                         .         .         *         .         .         .         .:140
query           ALTGAECSANLDGVPVWSWHAFDVRRGETLTLPSPRGGTRTYLCVAGGIDVPLVMNSRSTDLKSGFGGFE
YBGK_ECOLI      ALTGAGCEARLDDNAVWTGWRLPMKAGQRLTLKRPQHGMRSYLAVAGGIDVPPVMGSCSTDLKVGIGGLE
Y1730_HAEIN     CVTGAFYEMMLDDKPVFAYWRYQVRAGQILKMARAKIGMYGYLCVQGGFVLPQALNSCSTDLRAQIGGIE
KIPA_BACSU      AVTGADFTLRINDEEAPLWKPVLIKENSTVSFGPCKLGSRAYLAAAGGIEVPAVMESKSTYVRGSIGGLH
LAMA_EMENI      SLCGAPIDAKLDEAPVPMWSRVKVSAGQRLKIKTTGGGCRAYLAVLGGFNIAEWFGSKATAPMVGVGGYQ
DUR1_YEAST      AITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDVPKYLGSYSTFTLGNVGGYN
DUR1_SACKL      XXXXXXXXCSLNDKPIEQNKPIQVNRGDHLAIGKLSVGCRAYLAIRGGIDVPEYLGSRSTFALGNMGGYN


                         +         .         .         .         .         *         .:210
query           GRVLREGDRLPVGRPGIEQGQDWVGVAAPGWALPGQDGGNAIAIRLLPGPEYADFEPASQAALWQSEWTI
YBGK_ECOLI      GRLLKDGDRLPIGK-SKRDSMEAQGVKQLLW-------GN--RIRALPGPEYHEFDRASQDAFWRSPWQL
Y1730_HAEIN     GRCLQAGDQLQTANDHILRSE--IGIA----PIPLRD-----VIRALPSSEYQAFKRKSQYYWWRNEWTL
KIPA_BACSU      GRALQKEDELNIGRLSSQLGKQ--GFAAPKWSV---SRGRFLVIRVLEGKQFAFFTEESKTRFYEEAFRV
LAMA_EMENI      GRQLTSGDYLTISAQIPESDNE---LSLPEHLIPQYP--DSWELMSMPGPDEGYLAPESIDMLYNAEWTI
DUR1_YEAST      GRVLKLGDVLFLPSNEENKSVECLPQNIPQSLIPQISETKEWRIGVTCGPHGSPFKPESIEEFFSEKWKV
DUR1_SACKL      GRVLKLGDVLFLNQPELASGPAYEPQAPPANLLPKISDDKEWTIGVTCGPHGSPFKPESVEEFFSEKWKV


                         .         .         .         +         .         .         .:280
query           TPQSNRMGLRLQGPALARRAERSADLLSHGVVPGVMQVPPSGQPIALMSDAQTTGGYPKIGTVIGADLWR
YBGK_ECOLI      SSQSNRMGYRLQGQILKRTTDR--ELLSHGLLPGVVQVPHNGQPIVLMNDAQTTGGYPRIACIIEADMYH
Y1730_HAEIN     QSNSDRMGYRFQGQTL--ELKQPLEMLSHAIQFGSVQVPPSGQPIILMADAQTTGGYPKIANVIDADLGA
KIPA_BACSU      TPQSDRMGYRLKGEPLELKAP--LEMVSEAVSFGTVQVPPDGNPIILLADRQTTGGYPRIAHIISADLPI
LAMA_EMENI      SHNAARGGIRLLGPKPGEGGAHPSNLIECGYAIGSINW-TGDDPVIFPQDAPDLGGFVSSHTIVKADLWK
DUR1_YEAST      HYNSNRFGVRLIGPKPKWARSNGGESNTHDYVYSLGAINFTGEPVIITCDGPSLGGFVCQAVVPEAELWK
DUR1_SACKL      HYNSNRFGVRLIGPKWARKDGGEGGLNAHDYVYSLGAINFTGEPVIITSDGPSLGGFVCQAVVPEAELWK


                         .         *         .         .         .         .         +:350
query           LAQVPLGATVRFRQVTLEEAAAAQAEVDRYLRQIDQALAWQRDGMQIxxxxxxxxxxxx
YBGK_ECOLI      LAQIPLGQPIHFVQCSLEEALKARQDQQRYFEQ----LAWR------------------
Y1730_HAEIN     LAQVRLGSTIKFEAVSLQEAAKLRRKNEIYLDQI-------------------------
KIPA_BACSU      VSQIMPGEHVQFEPVSLQEAEALAVEREQHIKEL-------------------------
LAMA_EMENI      LGQVKAGDKLKFRATSLKDTLLARNELERFISDIVQ-----------------------
DUR1_YEAST      VGQVKPGDSIQFVPLSYESSRSLKESQDVAIKSLDGTKLRRLDSVSI------------
DUR1_SACKL      VGQVKPGDSIQFVPISYQVARQLKESQDAAIETLE------------------------