[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07116.1

[Show Plain Result]


## Summary of Sequence Search
    1::444
    7::440     e-109  48%  460 aa  DCTD_RHIME RecName: Full=C4-dicarboxylate transport transcriptional
    7::439     e-104  46%  448 aa  DCTD_RHILE RecName: Full=C4-dicarboxylate transport transcriptional
   10::449     5e-78  40%  449 aa  ALGB_PSEAE RecName: Full=Alginate biosynthesis transcriptional
    1::468     4e-75  41%  469 aa  NTRC_KLEPN RecName: Full=Nitrogen assimilation regulatory protein;
    1::362     9e-74  43%  469 aa  NTRC_ECOLI RecName: Full=Nitrogen regulation protein NR(I);
    1::362     9e-74  43%  469 aa  NTRC_ECO57 RecName: Full=Nitrogen regulation protein NR(I);
    1::362     1e-73  43%  469 aa  NTRC_SALTY RecName: Full=Nitrogen regulation protein NR(I);
   10::448     2e-73  39%  448 aa  ALGB_PSEPK RecName: Full=Alginate biosynthesis transcriptional
   10::448     3e-73  38%  448 aa  ALGB_PSESM RecName: Full=Alginate biosynthesis transcriptional
    6::456     7e-73  38%  461 aa  ATOC_ECOLI RecName: Full=Acetoacetate metabolism regulatory protein
    1::470     8e-72  38%  473 aa  NTRC_PROVU RecName: Full=Nitrogen regulation protein NR(I);
    6::470     8e-72  39%  481 aa  NTRC_AZOBR RecName: Full=Nitrogen assimilation regulatory protein;
   29::437     1e-71  40%  444 aa  YFHA_ECOLI RecName: Full=Uncharacterized protein yfhA;AltName:
   29::437     1e-71  40%  444 aa  YFHA_ECO57 RecName: Full=Uncharacterized protein yfhA;
   29::441     4e-71  39%  441 aa  ZRAR_SALTY RecName: Full=Transcriptional regulatory protein zraR;
   29::441     3e-70  38%  441 aa  ZRAR_SALTI RecName: Full=Transcriptional regulatory protein zraR;
   29::441     8e-70  38%  441 aa  ZRAR_ECOLI RecName: Full=Transcriptional regulatory protein zraR;
    6::356     8e-70  40%  480 aa  NTRC_BRASR RecName: Full=Nitrogen assimilation regulatory protein;
   29::441     4e-69  38%  441 aa  ZRAR_ECO57 RecName: Full=Transcriptional regulatory protein zraR;
    3::475     5e-69  37%  484 aa  NTRC_RHIME RecName: Full=Nitrogen assimilation regulatory protein;
    6::469     2e-68  41%  480 aa  NTRC_AZOC5 RecName: Full=Nitrogen assimilation regulatory protein
   52::443     2e-66  38%  443 aa  ZRAR_KLEOX RecName: Full=Transcriptional regulatory protein zraR;
    5::444     2e-65  35%  445 aa  PILR_PSEAE RecName: Full=Type 4 fimbriae expression regulatory
    5::453     3e-65  40%  454 aa  NTRX_AZOC5 RecName: Full=Nitrogen assimilation regulatory protein
  324::629     2e-64  44%  632 aa  STC_CLOBE RecName: Full=Signal-transduction and
    8::479     6e-64  37%  482 aa  HOXA_RALEH RecName: Full=Hydrogenase transcriptional regulatory
   17::304     1e-62  44%  314 aa  HRPR_PSESY RecName: Full=Pathogenicity locus probable regulatory
  183::502     3e-62  46%  504 aa  NORR_ENT38 RecName: Full=Anaerobic nitric oxide reductase
   37::312     6e-62  45%  323 aa  WTSA_ERWST RecName: Full=Pathogenicity locus probable regulatory
   54::444     7e-61  38%  453 aa  LUXO_VIBPA RecName: Full=Regulatory protein luxO;
   25::302     7e-61  44%  302 aa  HRPS_PSESY RecName: Full=Pathogenicity locus probable regulatory
  381::686     1e-60  47%  692 aa  FHLA_SALTY RecName: Full=Formate hydrogenlyase transcriptional
  211::501     2e-60  46%  522 aa  NIFA_AZOVI RecName: Full=Nif-specific regulatory protein;
   54::444     2e-60  38%  453 aa  LUXO_VIBHB RecName: Full=Luminescence regulatory protein luxO;
   54::444     2e-60  38%  453 aa  LUXO_VIBHA RecName: Full=Luminescence regulatory protein luxO;
  271::589     2e-60  44%  592 aa  YGEV_ECOLI RecName: Full=Uncharacterized sigma-54-dependent
  181::504     3e-60  46%  506 aa  NORR_SALPC RecName: Full=Anaerobic nitric oxide reductase
  187::505     6e-60  45%  516 aa  NORR_KLEP7 RecName: Full=Anaerobic nitric oxide reductase
  381::686     7e-60  47%  692 aa  FHLA_ECOLI RecName: Full=Formate hydrogenlyase transcriptional
  181::504     2e-59  45%  506 aa  NORR_SALTY RecName: Full=Anaerobic nitric oxide reductase
  181::504     2e-59  45%  506 aa  NORR_SALSV RecName: Full=Anaerobic nitric oxide reductase
  181::504     2e-59  45%  506 aa  NORR_SALNS RecName: Full=Anaerobic nitric oxide reductase
  181::504     2e-59  45%  506 aa  NORR_SALA4 RecName: Full=Anaerobic nitric oxide reductase
  185::502     2e-59  45%  504 aa  NORR_ECOLI RecName: Full=Anaerobic nitric oxide reductase
  185::502     2e-59  45%  504 aa  NORR_ECODH RecName: Full=Anaerobic nitric oxide reductase
  185::502     2e-59  45%  504 aa  NORR_ECOBW RecName: Full=Anaerobic nitric oxide reductase
  185::504     2e-59  45%  506 aa  NORR_CITK8 RecName: Full=Anaerobic nitric oxide reductase
  210::516     2e-59  46%  522 aa  VNFA_AZOVI RecName: Full=Nitrogen fixation protein vnfA;
  185::502     2e-59  44%  504 aa  NORR_SHIFL RecName: Full=Anaerobic nitric oxide reductase
  185::502     2e-59  44%  504 aa  NORR_SHIF8 RecName: Full=Anaerobic nitric oxide reductase
  185::502     2e-59  44%  504 aa  NORR_SHIDS RecName: Full=Anaerobic nitric oxide reductase
  181::504     2e-59  45%  506 aa  NORR_SALTI RecName: Full=Anaerobic nitric oxide reductase
  181::504     2e-59  45%  506 aa  NORR_SALPB RecName: Full=Anaerobic nitric oxide reductase
  181::504     2e-59  45%  506 aa  NORR_SALPA RecName: Full=Anaerobic nitric oxide reductase
  181::504     2e-59  45%  506 aa  NORR_SALG2 RecName: Full=Anaerobic nitric oxide reductase
  181::504     2e-59  45%  506 aa  NORR_SALEP RecName: Full=Anaerobic nitric oxide reductase
  181::504     2e-59  45%  506 aa  NORR_SALDC RecName: Full=Anaerobic nitric oxide reductase
  181::504     2e-59  45%  506 aa  NORR_SALCH RecName: Full=Anaerobic nitric oxide reductase
  185::502     2e-59  44%  504 aa  NORR_ECO5E RecName: Full=Anaerobic nitric oxide reductase
  185::502     2e-59  44%  504 aa  NORR_ECO57 RecName: Full=Anaerobic nitric oxide reductase
  203::497     2e-59  45%  518 aa  NIFA_ENTAG RecName: Full=Nif-specific regulatory protein;
  181::504     4e-59  45%  506 aa  NORR_SALAR RecName: Full=Anaerobic nitric oxide reductase
  181::504     5e-59  45%  506 aa  NORR_SALHS RecName: Full=Anaerobic nitric oxide reductase
  187::505     6e-59  45%  516 aa  NORR_KLEP3 RecName: Full=Anaerobic nitric oxide reductase
    8::237     1e-58  47%  325 aa  PSPF_ECOLI RecName: Full=Psp operon transcriptional activator;
  185::502     4e-58  44%  504 aa  NORR_ECOSM RecName: Full=Anaerobic nitric oxide reductase
  217::524     1e-57  40%  533 aa  ANFA_AZOVI RecName: Full=Nitrogen fixation protein anfA;
  185::502     2e-57  44%  504 aa  NORR_ESCF3 RecName: Full=Anaerobic nitric oxide reductase
  185::502     3e-57  43%  504 aa  NORR_ECOSE RecName: Full=Anaerobic nitric oxide reductase
  185::502     3e-57  43%  504 aa  NORR_ECO24 RecName: Full=Anaerobic nitric oxide reductase
  185::502     4e-57  43%  504 aa  NORR_ECOUT RecName: Full=Anaerobic nitric oxide reductase
  185::502     4e-57  43%  504 aa  NORR_ECOLU RecName: Full=Anaerobic nitric oxide reductase
  185::502     4e-57  43%  504 aa  NORR_ECOL6 RecName: Full=Anaerobic nitric oxide reductase
  185::502     4e-57  43%  504 aa  NORR_ECOL5 RecName: Full=Anaerobic nitric oxide reductase
  185::502     4e-57  43%  504 aa  NORR_ECOK1 RecName: Full=Anaerobic nitric oxide reductase
  185::502     4e-57  43%  504 aa  NORR_ECO8A RecName: Full=Anaerobic nitric oxide reductase
  185::502     4e-57  43%  504 aa  NORR_ECO81 RecName: Full=Anaerobic nitric oxide reductase
  185::502     4e-57  43%  504 aa  NORR_ECO45 RecName: Full=Anaerobic nitric oxide reductase
  185::502     4e-57  43%  504 aa  NORR_ECO27 RecName: Full=Anaerobic nitric oxide reductase
  190::519     4e-57  44%  521 aa  NORR2_RALEH RecName: Full=Nitric oxide reductase transcription
  185::502     8e-57  43%  504 aa  NORR_SHISS RecName: Full=Anaerobic nitric oxide reductase
  185::502     8e-57  43%  504 aa  NORR_SHIBS RecName: Full=Anaerobic nitric oxide reductase
  185::502     8e-57  43%  504 aa  NORR_ECOLC RecName: Full=Anaerobic nitric oxide reductase
  185::502     8e-57  43%  504 aa  NORR_ECOHS RecName: Full=Anaerobic nitric oxide reductase
  185::502     8e-57  43%  504 aa  NORR_ECO55 RecName: Full=Anaerobic nitric oxide reductase
   25::298     8e-57  43%  302 aa  HRPS_PSESH RecName: Full=Pathogenicity locus probable regulatory
   71::437     1e-56  40%  455 aa  FLBD_CAUCR RecName: Full=Transcriptional regulatory protein flbD;
  236::464     2e-56  47%  566 aa  XYLR_PSEPU RecName: Full=Transcriptional regulatory protein
  203::429     2e-56  49%  542 aa  NIFA_HERSE RecName: Full=Nif-specific regulatory protein;
   54::314     3e-56  45%  453 aa  LUXO_VIBVY RecName: Full=Regulatory protein luxO;
   54::314     3e-56  45%  453 aa  LUXO_VIBVU RecName: Full=Regulatory protein luxO;
  185::502     5e-56  43%  504 aa  NORR_ECO7I RecName: Full=Anaerobic nitric oxide reductase
  179::511     6e-56  42%  512 aa  NORR_ERWCT RecName: Full=Anaerobic nitric oxide reductase
  221::532     1e-55  47%  541 aa  PRPR_SALTY RecName: Full=Propionate catabolism operon regulatory
  186::506     1e-55  45%  508 aa  NORR_AERHH RecName: Full=Anaerobic nitric oxide reductase
  347::664     1e-55  44%  670 aa  HYFR_ECOLI RecName: Full=Hydrogenase-4 transcriptional activator;
  218::527     2e-55  44%  528 aa  PRPR_ECOLI RecName: Full=Propionate catabolism operon regulatory
  207::513     2e-55  40%  521 aa  TYRR_ENTAG RecName: Full=Transcriptional regulatory protein tyrR;
  229::454     2e-55  49%  584 aa  NIFA_RHIEC RecName: Full=Nif-specific regulatory protein;
  212::437     4e-55  47%  524 aa  NIFA_KLEPN RecName: Full=Nif-specific regulatory protein;
  212::437     4e-55  47%  524 aa  NIFA_KLEOX RecName: Full=Nif-specific regulatory protein;
    7::475     4e-55  34%  485 aa  HOXA_BRAJA RecName: Full=Hydrogenase transcriptional regulatory
  252::477     2e-54  48%  594 aa  NIFA_RHISN RecName: Full=Nif-specific regulatory protein;
  205::430     2e-54  49%  625 aa  NIFA_AZOBR RecName: Full=Nif-specific regulatory protein;
  203::428     3e-54  49%  624 aa  NIFA_AZOLI RecName: Full=Nif-specific regulatory protein;
  194::518     3e-54  42%  530 aa  LUXO_VIBC3 RecName: Full=Regulatory protein luxO;
  143::455     3e-54  43%  461 aa  ROCR_BACSU RecName: Full=Arginine utilization regulatory protein
  180::512     3e-54  43%  514 aa  NORR1_RALEH RecName: Full=Nitric oxide reductase transcription
  186::507     5e-54  44%  509 aa  NORR_AERS4 RecName: Full=Anaerobic nitric oxide reductase
  295::601     5e-54  41%  605 aa  ACOR_BACSU RecName: Full=Acetoin dehydrogenase operon
  251::481     1e-53  48%  615 aa  NIFA_AZOC5 RecName: Full=Nif-specific regulatory protein;
    9::237     1e-52  48%  353 aa  NIFA_RHILT RecName: Full=Nif-specific regulatory protein;
  216::451     1e-52  51%  579 aa  NIFA_RHOCA RecName: Full=Nif-specific regulatory protein;
  177::402     3e-52  49%  519 aa  NIFA_RHILE RecName: Full=Nif-specific regulatory protein;
  188::417     9e-52  46%  507 aa  NORR_SERP5 RecName: Full=Anaerobic nitric oxide reductase
  230::455     1e-51  48%  582 aa  NIFA_BRAJA RecName: Full=Nif-specific regulatory protein;
   54::444     5e-51  33%  455 aa  LUXO_VIBCH RecName: Full=Regulatory protein luxO;
  184::416     6e-51  45%  512 aa  NORR_VIBF1 RecName: Full=Anaerobic nitric oxide reductase
    4::456     2e-50  31%  474 aa  NTRXL_RICCN RecName: Full=Putative response regulator ntrX-like;
  188::414     7e-50  45%  510 aa  NORR_VIBVU RecName: Full=Anaerobic nitric oxide reductase
  201::506     1e-49  40%  513 aa  TYRR_ECOLI RecName: Full=Transcriptional regulatory protein tyrR;
  188::414     2e-49  45%  510 aa  NORR_VIBVY RecName: Full=Anaerobic nitric oxide reductase
    4::457     3e-49  31%  475 aa  NTRXL_RICPR RecName: Full=Putative response regulator ntrX-like;
  201::506     1e-48  40%  513 aa  TYRR_SALTY RecName: Full=Transcriptional regulatory protein tyrR;
  201::506     1e-48  40%  513 aa  TYRR_SALTI RecName: Full=Transcriptional regulatory protein tyrR;
    4::457     1e-48  30%  475 aa  NTRXL_RICFE RecName: Full=Putative response regulator ntrX-like;
    8::479     2e-48  32%  492 aa  HUPR_RHOCA RecName: Full=Hydrogenase transcriptional regulatory
    4::457     3e-48  30%  475 aa  NTRXL_RICTY RecName: Full=Putative response regulator ntrX-like;
   20::408     1e-47  32%  415 aa  PGTA_SALTY RecName: Full=Phosphoglycerate transport system
  201::506     2e-47  39%  514 aa  TYRR_CITBR RecName: Full=Transcriptional regulatory protein tyrR;
    4::283     5e-47  42%  295 aa  YHYA_PSESN RecName: Full=Uncharacterized protein in hyuA
  363::653     2e-46  42%  668 aa  ACOR_RALEH RecName: Full=Acetoin catabolism regulatory protein;
  200::425     5e-46  45%  541 aa  NIFA_RHIME RecName: Full=Nif-specific regulatory protein;
  368::686     1e-44  38%  692 aa  YQIR_BACSU RecName: Full=Putative sigma L-dependent transcriptional
   16::460     3e-44  29%  478 aa  NTRXL_RICBR RecName: Full=Putative response regulator ntrX-like;
   16::316     3e-40  38%  318 aa  TYRR_HAEIN RecName: Full=Transcriptional regulatory protein tyrR;
    5::443     2e-39  37%  457 aa  NTRC_RHOCA RecName: Full=Nitrogen regulation protein ntrC;
  333::630     7e-36  35%  639 aa  DHAR_ECOLI RecName: Full=PTS-dependent dihydroxyacetone kinase
  350::630     1e-34  34%  641 aa  DHAR_CITFR RecName: Full=Glycerol metabolism operon regulatory
  186::429     1e-33  37%  532 aa  RTCR_ECOLI RecName: Full=Transcriptional regulatory protein rtcR;
  313::601     2e-31  33%  609 aa  Y4PA_RHISN RecName: Full=Putative transcriptional regulatory
   13::218     7e-29  38%  331 aa  YPLP_BACSU RecName: Full=Putative sigma L-dependent transcriptional
    6::106     6e-19  47%  204 aa  FIXJ_RHIME RecName: Full=Transcriptional regulatory protein fixJ;
    1::107     2e-17  46%  211 aa  FIXJ_AZOC5 RecName: Full=Transcriptional regulatory protein fixJ;
    7::110     1e-16  37%  205 aa  FIXJ_BRAJA RecName: Full=Transcriptional regulatory protein fixJ;
   22::122     6e-16  41%  227 aa  NODW_BRAJA RecName: Full=Nodulation protein W;
    1::106     1e-15  38%  234 aa  CSEB_STRCO RecName: Full=Transcriptional regulatory protein cseB;
  141::293     5e-15  36%  935 aa  LEVR_BACSU RecName: Full=Transcriptional regulatory protein
    1::106     5e-14  35%  235 aa  CSEB_STRAW RecName: Full=Transcriptional regulatory protein cseB;
    1::103     7e-12  29%  228 aa  MPRA_MYCPA RecName: Full=Response regulator mprA;AltName:
    1::103     7e-12  29%  228 aa  MPRA_MYCA1 RecName: Full=Response regulator mprA;AltName:
   33::107     7e-12  49%  197 aa  DCTR_RHOCA RecName: Full=C4-dicarboxylate transport transcriptional
    3::105     1e-11  29%  230 aa  MPRA_MYCBP RecName: Full=Response regulator mprA;AltName:
    3::105     1e-11  29%  230 aa  MPRA_MYCBO RecName: Full=Response regulator mprA;AltName:
    3::105     1e-11  28%  231 aa  MPRA_MYCVP RecName: Full=Response regulator mprA;AltName:
    3::105     1e-11  29%  230 aa  MPRA_MYCTU RecName: Full=Response regulator mprA;AltName:
    3::105     1e-11  29%  230 aa  MPRA_MYCTA RecName: Full=Response regulator mprA;AltName:
    4::107     2e-11  31%  229 aa  PHOB_SHIFL RecName: Full=Phosphate regulon transcriptional
    4::107     2e-11  31%  229 aa  PHOB_SHIDY RecName: Full=Phosphate regulon transcriptional
    4::107     2e-11  31%  229 aa  PHOB_ECOLI RecName: Full=Phosphate regulon transcriptional
    4::107     2e-11  31%  229 aa  PHOB_ECO57 RecName: Full=Phosphate regulon transcriptional
    3::105     2e-11  28%  232 aa  MPRA_MYCUA RecName: Full=Response regulator mprA;AltName:
    1::103     2e-11  29%  228 aa  MPRA_MYCLE RecName: Full=Response regulator mprA;AltName:
   25::124     4e-11  33%  194 aa  ACTR_RHIME RecName: Full=Acid tolerance regulatory protein actR;
    9::109     6e-11  29%  255 aa  YCF27_GALSU RecName: Full=Probable transcriptional regulator
    3::108     6e-11  31%  229 aa  PHOB_PSEAE RecName: Full=Phosphate regulon transcriptional
    4::107     8e-11  32%  229 aa  PHOB_KLEPN RecName: Full=Phosphate regulon transcriptional
   25::124     1e-10  32%  194 aa  ACTR_SINMW RecName: Full=Acid tolerance regulatory protein actR;
   16::118     1e-10  32%  184 aa  REGA_RHOS4 RecName: Full=Photosynthetic apparatus regulatory
    3::105     1e-10  27%  230 aa  MPRA_MYCS2 RecName: Full=Response regulator mprA;AltName:
    3::105     2e-10  27%  230 aa  MPRA_MYCSS RecName: Full=Response regulator mprA;AltName:
    3::105     2e-10  27%  230 aa  MPRA_MYCSK RecName: Full=Response regulator mprA;AltName:
    3::105     2e-10  27%  230 aa  MPRA_MYCSJ RecName: Full=Response regulator mprA;AltName:
   16::116     4e-10  29%  254 aa  YCF27_GUITH RecName: Full=Probable transcriptional regulator
   15::118     4e-10  29%  184 aa  REGA_RHOCA RecName: Full=Photosynthetic apparatus regulatory
    1::107     4e-10  30%  239 aa  OMPR_SHIFL RecName: Full=Transcriptional regulatory protein ompR;
    1::107     4e-10  30%  239 aa  OMPR_SALTY RecName: Full=Transcriptional regulatory protein ompR;
    1::107     4e-10  30%  239 aa  OMPR_SALTI RecName: Full=Transcriptional regulatory protein ompR;
    1::107     4e-10  30%  239 aa  OMPR_ECOLI RecName: Full=Transcriptional regulatory protein ompR;
    1::107     4e-10  30%  239 aa  OMPR_ECOL6 RecName: Full=Transcriptional regulatory protein ompR;
    1::107     4e-10  30%  239 aa  OMPR_ECO57 RecName: Full=Transcriptional regulatory protein ompR;
    2::104     5e-10  31%  224 aa  PHOP_SALCH RecName: Full=Virulence transcriptional regulatory
    7::107     7e-10  28%  239 aa  YCF27_CYAPA RecName: Full=Probable transcriptional regulator
    2::106     7e-10  30%  235 aa  MALR_BACSU RecName: Full=Transcriptional regulatory protein
   25::136     1e-09  32%  257 aa  SPHR_SYNE7 RecName: Full=Alkaline phosphatase synthesis
    6::106     2e-09  32%  228 aa  YKOG_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    5::105     2e-09  27%  240 aa  YCF27_PORAE RecName: Full=Probable transcriptional regulator
    4::107     3e-09  30%  227 aa  PHOB_RHIME RecName: Full=Phosphate regulon transcriptional
    1::103     4e-09  29%  227 aa  COPR_PSESM RecName: Full=Transcriptional activator protein copR;
    4::111     4e-09  30%  355 aa  CHEB_NATPD RecName: Full=Chemotaxis response regulator
    1::103     8e-09  29%  221 aa  QSEB_HAEIN RecName: Full=Transcriptional regulatory protein qseB;
    7::109     8e-09  27%  337 aa  HNR_SHIFL RecName: Full=Protein hnr;
    7::109     8e-09  27%  337 aa  HNR_ECOLI RecName: Full=Protein hnr;
    7::109     8e-09  27%  337 aa  HNR_ECO57 RecName: Full=Protein hnr;
    2::104     1e-08  28%  224 aa  PHOP_SALTY RecName: Full=Virulence transcriptional regulatory
    2::104     1e-08  28%  224 aa  PHOP_SALTI RecName: Full=Virulence transcriptional regulatory
    2::104     1e-08  28%  224 aa  PHOP_SALPA RecName: Full=Virulence transcriptional regulatory
    1::106     1e-08  30%  224 aa  DLTR_STRA5 RecName: Full=Transcriptional regulatory protein dltR;
    1::106     1e-08  30%  224 aa  DLTR_STRA3 RecName: Full=Transcriptional regulatory protein dltR;
    1::112     1e-08  35%  352 aa  CHEB2_MAGSA RecName: Full=Chemotaxis response regulator
    1::103     1e-08  27%  222 aa  BASR_SALTY RecName: Full=Transcriptional regulatory protein basR;
    4::108     1e-08  24%  122 aa  SP0F_BACTK RecName: Full=Sporulation initiation phosphotransferase
    4::105     1e-08  38%  228 aa  REGX3_MYCS2 RecName: Full=Sensory transduction protein regX3;
    1::103     1e-08  29%  219 aa  QSEB_SALTY RecName: Full=Transcriptional regulatory protein qseB;
    1::103     1e-08  29%  219 aa  QSEB_SALTI RecName: Full=Transcriptional regulatory protein qseB;
    4::102     1e-08  31%  225 aa  AFSQ1_STRCO RecName: Full=Transcriptional regulatory protein afsQ1;
    8::110     2e-08  33%  228 aa  DCTR_BACME RecName: Full=Probable C4-dicarboxylate response
    1::103     2e-08  31%  227 aa  CUSR_ECOLI RecName: Full=Transcriptional regulatory protein cusR;
    1::103     2e-08  31%  227 aa  CUSR_ECOL6 RecName: Full=Transcriptional regulatory protein cusR;
    1::103     2e-08  31%  227 aa  CUSR_ECO57 RecName: Full=Transcriptional regulatory protein cusR;
    1::103     2e-08  28%  224 aa  TCTD_SALTY RecName: Full=Transcriptional regulatory protein tctD;
    4::105     2e-08  32%  227 aa  REGX3_MYCTU RecName: Full=Sensory transduction protein regX3;
    4::105     2e-08  32%  227 aa  REGX3_MYCBO RecName: Full=Sensory transduction protein regX3;
    1::103     2e-08  28%  219 aa  QSEB_ECOLI RecName: Full=Transcriptional regulatory protein qseB;
    1::103     2e-08  27%  223 aa  PHOP_SHIFL RecName: Full=Virulence transcriptional regulatory
    1::103     2e-08  27%  223 aa  PHOP_ECOLI RecName: Full=Transcriptional regulatory protein phoP;
    1::103     2e-08  27%  223 aa  PHOP_ECOL6 RecName: Full=Transcriptional regulatory protein phoP;
   20::128     3e-08  30%  251 aa  Y851_SYNP2 RecName: Full=Probable transcriptional regulatory
    1::103     3e-08  28%  219 aa  QSEB_ECO57 RecName: Full=Transcriptional regulatory protein qseB;
    2::109     3e-08  29%  352 aa  CYAB_STIAU RecName: Full=Adenylate cyclase 2;       
    1::165     3e-08  27%  231 aa  CTRA_CAUCR RecName: Full=Cell cycle transcriptional regulator
    1::165     3e-08  27%  231 aa  CTRA_CAUCN RecName: Full=Cell cycle transcriptional regulator
    2::106     3e-08  27%  120 aa  CHEY_THEMA RecName: Full=Chemotaxis protein cheY;
    1::103     3e-08  27%  222 aa  BASR_ECOLI RecName: Full=Transcriptional regulatory protein basR;
    1::103     4e-08  32%  228 aa  SILR_SALTY RecName: Full=Probable transcriptional regulatory
    1::113     5e-08  28%  236 aa  RPRY_BACFR RecName: Full=Transcriptional regulatory protein rprY;
    1::103     5e-08  34%  256 aa  LYTR_STAHJ RecName: Full=Sensory transduction protein lytR;
    2::103     5e-08  27%  224 aa  HSSR_STAHJ RecName: Full=Heme response regulator hssR;
    1::111     5e-08  28%  230 aa  DCTR_BACHD RecName: Full=Probable C4-dicarboxylate response
    1::103     6e-08  27%  223 aa  PHOP_ECO57 RecName: Full=Transcriptional regulatory protein phoP;
    4::105     6e-08  25%  240 aa  PHOP_BACSU RecName: Full=Alkaline phosphatase synthesis
    1::102     6e-08  29%  229 aa  IRLR_BURPS RecName: Full=Transcriptional activator protein irlR;
  572::676     6e-08  28% 1546 aa  DHKD_DICDI RecName: Full=Hybrid signal transduction histidine
    4::109     6e-08  30%  364 aa  CHEB_DESPS RecName: Full=Chemotaxis response regulator
    3::106     8e-08  26%  368 aa  YESN_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    1::102     8e-08  27%  223 aa  YEDW_ECOLI RecName: Full=Probable transcriptional regulatory
    1::103     8e-08  25%  651 aa  RCAC_FREDI RecName: Full=Protein rcaC;
    2::103     8e-08  27%  224 aa  HSSR_STAAE RecName: Full=Heme response regulator hssR;
    2::103     8e-08  27%  224 aa  HSSR_STAAC RecName: Full=Heme response regulator hssR;
    7::107     1e-07  26%  243 aa  YCF27_PORYE RecName: Full=Probable transcriptional regulator
    7::107     1e-07  26%  243 aa  YCF27_PORPU RecName: Full=Probable transcriptional regulator
    4::105     1e-07  34%  349 aa  CHEB1_ANADE RecName: Full=Chemotaxis response regulator
    2::103     1e-07  27%  224 aa  HSSR_STAAR RecName: Full=Heme response regulator hssR;
    2::103     2e-07  27%  224 aa  HSSR_STAAW RecName: Full=Heme response regulator hssR;
    2::103     2e-07  27%  224 aa  HSSR_STAAT RecName: Full=Heme response regulator hssR;
    2::103     2e-07  27%  224 aa  HSSR_STAAS RecName: Full=Heme response regulator hssR;
    2::103     2e-07  27%  224 aa  HSSR_STAAN RecName: Full=Heme response regulator hssR;
    2::103     2e-07  27%  224 aa  HSSR_STAAM RecName: Full=Heme response regulator hssR;
    2::103     2e-07  27%  224 aa  HSSR_STAA9 RecName: Full=Heme response regulator hssR;
    2::103     2e-07  27%  224 aa  HSSR_STAA8 RecName: Full=Heme response regulator hssR;
    2::103     2e-07  27%  224 aa  HSSR_STAA3 RecName: Full=Heme response regulator hssR;
    2::103     2e-07  27%  224 aa  HSSR_STAA2 RecName: Full=Heme response regulator hssR;
    2::103     2e-07  27%  224 aa  HSSR_STAA1 RecName: Full=Heme response regulator hssR;
    2::108     2e-07  29%  119 aa  CHEY_LISMO RecName: Full=Chemotaxis protein cheY;
    2::108     2e-07  29%  119 aa  CHEY_LISIN RecName: Full=Chemotaxis protein cheY;
    4::109     2e-07  28%  120 aa  CHEY_BACSU RecName: Full=Chemotaxis protein cheY homolog;
    5::103     2e-07  27%  224 aa  HSSR_STAS1 RecName: Full=Heme response regulator hssR;
   12::121     2e-07  36%  365 aa  CHEB2_RHOS4 RecName: Full=Chemotaxis response regulator
    6::109     2e-07  35%  350 aa  CHEB1_DECAR RecName: Full=Chemotaxis response regulator
   24::138     2e-07  30%  206 aa  ARR7_ARATH RecName: Full=Two-component response regulator ARR7;
    1::103     2e-07  37%  248 aa  ALGR_PSEAE RecName: Full=Positive alginate biosynthesis regulatory
   79::179     3e-07  29%  305 aa  PFER_PSEAE RecName: Full=Transcriptional activator protein pfeR;
   19::122     3e-07  37%  366 aa  CHEB2_RHOSH RecName: Full=Chemotaxis response regulator
   23::139     3e-07  31%  186 aa  ARR6_ARATH RecName: Full=Two-component response regulator ARR6;
    6::106     4e-07  27%  229 aa  CREB_ECOLI RecName: Full=Transcriptional regulatory protein creB;
   14::113     5e-07  28%  249 aa  YCF27_CYACA RecName: Full=Probable transcriptional regulator
    1::103     5e-07  33%  208 aa  NARP_HAEIN RecName: Full=Nitrate/nitrite response regulator protein
    4::106     7e-07  27%  231 aa  PHOB_HAEIN RecName: Full=Phosphate regulon transcriptional
    7::110     7e-07  29%  226 aa  DCTR_BACSU RecName: Full=Probable C4-dicarboxylate response
    1::102     7e-07  29%  225 aa  CZCR_RALME RecName: Full=Transcriptional activator protein czcR;
    6::106     9e-07  30%  237 aa  YVRH_BACSU RecName: Full=Transcriptional regulatory protein yvrH;
  569::676     9e-07  27%  686 aa  CQSS_VIBCH RecName: Full=CAI-1 autoinducer sensor
    2::107     9e-07  26%  234 aa  CITB_KLEPN RecName: Full=Transcriptional regulatory protein citB;
    4::103     9e-07  27%  241 aa  CHVI_RHISN RecName: Full=Transcriptional regulatory protein chvI;
    4::103     9e-07  27%  240 aa  CHVI_RHIME RecName: Full=Transcriptional regulatory protein chvI;
    1::107     9e-07  30%  124 aa  CHEY_HELPJ RecName: Full=Chemotaxis protein cheY homolog;
   36::139     9e-07  28%  690 aa  ARR1_ARATH RecName: Full=Two-component response regulator ARR1;
   16::117     1e-06  30%  253 aa  VIRG_AGRT5 RecName: Full=Regulatory protein virG;
    4::105     1e-06  30%  241 aa  VIRG_AGRRH RecName: Full=Regulatory protein virG;
    1::103     1e-06  27%  217 aa  CUTR_STRLI RecName: Full=Transcriptional regulatory protein
    1::103     1e-06  27%  217 aa  CUTR_STRCO RecName: Full=Transcriptional regulatory protein
    4::103     1e-06  27%  241 aa  CHVI_RHIRD RecName: Full=Transcriptional regulatory protein chvI;
    1::108     1e-06  30%  124 aa  CHEY_PSEAE RecName: Full=Chemotaxis protein cheY;
    1::110     1e-06  29%  369 aa  CHEB_HALMA RecName: Full=Chemotaxis response regulator
    3::107     1e-06  31%  370 aa  CHEB3_RHORT RecName: Full=Chemotaxis response regulator
    2::103     2e-06  25%  224 aa  HSSR_STAES RecName: Full=Heme response regulator hssR;
    2::103     2e-06  25%  224 aa  HSSR_STAEQ RecName: Full=Heme response regulator hssR;
    8::108     2e-06  27%  240 aa  RESD_BACSU RecName: Full=Transcriptional regulatory protein resD;
    2::104     2e-06  30%  241 aa  LYTT_BACSU RecName: Full=Sensory transduction protein lytT;
    2::103     2e-06  26%  224 aa  HSSR_STAAB RecName: Full=Heme response regulator hssR;
    1::107     2e-06  29%  124 aa  CHEY_HELPY RecName: Full=Chemotaxis protein cheY homolog;
    7::116     2e-06  28%  403 aa  CHEB_TREPA RecName: Full=Chemotaxis response regulator
    3::105     3e-06  29%  121 aa  PILH_PSEAE RecName: Full=Protein pilH;
  160::270     3e-06  28%  793 aa  PDE2_DICDI RecName: Full=3',5'-cyclic-nucleotide phosphodiesterase
   25::140     3e-06  29%  184 aa  ARR5_ARATH RecName: Full=Two-component response regulator
   32::148     3e-06  30%  259 aa  ARR4_ARATH RecName: Full=Two-component response regulator
    2::109     4e-06  24%  220 aa  YFIK_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    4::104     4e-06  27%  231 aa  VANR_ENTFC RecName: Full=Regulatory protein vanR;
    3::107     4e-06  37%  356 aa  CHEB2_CHRVO RecName: Full=Chemotaxis response regulator
   50::155     4e-06  36%  558 aa  APRR5_ARATH RecName: Full=Two-component response regulator-like
  680::763     5e-06  30%  914 aa  TORS_ECO57 RecName: Full=Sensor protein torS;         EC=2.7.13.3;
    1::103     5e-06  27%  219 aa  RSSB_SERMA RecName: Full=Swarming motility regulation protein rssB;
    1::102     5e-06  27%  224 aa  GRAR_STAHJ RecName: Full=Response regulator protein graR;AltName:
    1::107     5e-06  34%  349 aa  CHEB_ARCFU RecName: Full=Chemotaxis response regulator
   18::125     5e-06  30%  394 aa  CHEB2_RHOCS RecName: Full=Chemotaxis response regulator
   11::118     5e-06  33%  381 aa  CHEB1_MAGSA RecName: Full=Chemotaxis response regulator
   31::147     5e-06  30%  231 aa  ARR3_ARATH RecName: Full=Two-component response regulator ARR3;
    4::103     6e-06  25%  228 aa  SAER_STAAW RecName: Full=Response regulator saeR;AltName:
    4::103     6e-06  25%  228 aa  SAER_STAAS RecName: Full=Response regulator saeR;AltName:
    4::103     6e-06  25%  228 aa  SAER_STAAR RecName: Full=Response regulator saeR;AltName:
    4::103     6e-06  25%  228 aa  SAER_STAAN RecName: Full=Response regulator saeR;AltName:
    4::103     6e-06  25%  228 aa  SAER_STAAM RecName: Full=Response regulator saeR;AltName:
    4::103     6e-06  25%  228 aa  SAER_STAAE RecName: Full=Response regulator saeR;AltName:
    4::103     6e-06  25%  228 aa  SAER_STAAC RecName: Full=Response regulator saeR;AltName:
    4::103     6e-06  25%  228 aa  SAER_STAAB RecName: Full=Response regulator saeR;AltName:
    4::103     6e-06  25%  228 aa  SAER_STAA8 RecName: Full=Response regulator saeR;AltName:
    4::103     6e-06  25%  228 aa  SAER_STAA3 RecName: Full=Response regulator saeR;AltName:
   62::167     6e-06  25%  742 aa  PRR37_ORYSJ RecName: Full=Two-component response regulator-like
   62::167     6e-06  25%  742 aa  PRR37_ORYSI RecName: Full=Two-component response regulator-like
    6::113     6e-06  31%  344 aa  CHEB_THEMA RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  349 aa  CHEB_SHISS RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  349 aa  CHEB_SHIFL RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  312 aa  CHEB_SHIBS RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  349 aa  CHEB_SALTY RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  349 aa  CHEB_SALTI RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  349 aa  CHEB_SALPA RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  349 aa  CHEB_SALCH RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  349 aa  CHEB_ECOUT RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  349 aa  CHEB_ECOLI RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  349 aa  CHEB_ECOL6 RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  349 aa  CHEB_ECOL5 RecName: Full=Chemotaxis response regulator
    4::108     6e-06  34%  349 aa  CHEB_ECO57 RecName: Full=Chemotaxis response regulator
    2::106     6e-06  34%  347 aa  CHEB3_LEPIN RecName: Full=Chemotaxis response regulator
    2::106     6e-06  34%  347 aa  CHEB3_LEPIC RecName: Full=Chemotaxis response regulator
    3::107     6e-06  30%  349 aa  CHEB3_HAHCH RecName: Full=Chemotaxis response regulator
   28::130     6e-06  28%  664 aa  ARR2_ARATH RecName: Full=Two-component response regulator
   37::142     6e-06  31%  468 aa  APRR9_ARATH RecName: Full=Two-component response regulator-like
    3::103     8e-06  31%  223 aa  YBDJ_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  413::518     8e-06  32%  677 aa  RPFC_XANCP RecName: Full=Sensory/regulatory protein rpfC;       
  413::518     8e-06  32%  677 aa  RPFC_XANC8 RecName: Full=Sensory/regulatory protein rpfC;       
    1::103     8e-06  31%  242 aa  LYTT_ENTFA RecName: Full=Sensory transduction protein lytT;
  174::356     8e-06  27%  754 aa  CHLD_PEA RecName: Full=Magnesium-chelatase subunit chlD,
    4::108     8e-06  32%  354 aa  CHEB2_GEOSL RecName: Full=Chemotaxis response regulator
    6::105     8e-06  28%  238 aa  ARCA_SHIFL RecName: Full=Aerobic respiration control protein arcA;
    6::105     8e-06  28%  238 aa  ARCA_ECOLI RecName: Full=Aerobic respiration control protein
    6::105     8e-06  28%  238 aa  ARCA_ECOL6 RecName: Full=Aerobic respiration control protein arcA;
    6::105     8e-06  28%  238 aa  ARCA_ECO57 RecName: Full=Aerobic respiration control protein arcA;
    1::104     1e-05  26%  226 aa  Y4XI_RHISN RecName: Full=Probable transcriptional regulatory
    4::104     1e-05  24%  233 aa  WALR_STAS1 RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAHJ RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAES RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAEQ RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAAW RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAAU RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAAT RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAAS RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAAR RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAAN RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAAM RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAAE RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAAC RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAAB RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAA9 RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAA8 RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAA3 RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAA2 RecName: Full=Transcriptional regulatory protein walR;
    4::104     1e-05  24%  233 aa  WALR_STAA1 RecName: Full=Transcriptional regulatory protein walR;
    1::102     1e-05  25%  224 aa  GRAR_STAES RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAEQ RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAAW RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAAT RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAAS RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAAR RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAAN RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAAM RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAAE RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAAC RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAAB RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAA9 RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAA8 RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAA3 RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAA2 RecName: Full=Response regulator protein graR;AltName:
    1::102     1e-05  25%  224 aa  GRAR_STAA1 RecName: Full=Response regulator protein graR;AltName:
    3::107     1e-05  35%  355 aa  CHEB_METFK RecName: Full=Chemotaxis response regulator
    2::108     1e-05  34%  351 aa  CHEB_METBU RecName: Full=Chemotaxis response regulator
    4::108     1e-05  35%  350 aa  CHEB_ERWCT RecName: Full=Chemotaxis response regulator
    4::108     1e-05  33%  350 aa  CHEB_ENTCL RecName: Full=Chemotaxis response regulator
    4::108     1e-05  32%  355 aa  CHEB3_GEOMG RecName: Full=Chemotaxis response regulator
    3::106     1e-05  24%  231 aa  BCER_BACHD RecName: Full=Sensory transduction protein bceR;
   10::114     1e-05  28%  382 aa  ARR14_ARATH RecName: Full=Two-component response regulator ARR14;
    3::106     1e-05  25%  229 aa  YXDJ_BACSU RecName: Full=Transcriptional regulatory protein yxdJ;
   25::106     1e-05  27%  231 aa  YRKP_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  680::763     1e-05  29%  914 aa  TORS_ECOLI RecName: Full=Sensor protein torS;         EC=2.7.13.3;
    5::104     1e-05  26%  241 aa  SRRA_STAAW RecName: Full=Transcriptional regulatory protein
    5::104     1e-05  26%  241 aa  SRRA_STAAU RecName: Full=Transcriptional regulatory protein
    5::104     1e-05  26%  241 aa  SRRA_STAAS RecName: Full=Transcriptional regulatory protein
    5::104     1e-05  26%  241 aa  SRRA_STAAR RecName: Full=Transcriptional regulatory protein
    5::104     1e-05  26%  241 aa  SRRA_STAAN RecName: Full=Transcriptional regulatory protein
    5::104     1e-05  26%  241 aa  SRRA_STAAM RecName: Full=Transcriptional regulatory protein
    5::104     1e-05  26%  241 aa  SRRA_STAAC RecName: Full=Transcriptional regulatory protein
    5::104     1e-05  26%  241 aa  SRRA_STAA8 RecName: Full=Transcriptional regulatory protein
  411::513     1e-05  29%  534 aa  LOVHK_PSESM RecName: Full=Blue-light-activated protein;Includes:
    4::108     1e-05  35%  351 aa  CHEB2_BORA1 RecName: Full=Chemotaxis response regulator
   16::135     1e-05  26%  153 aa  ARR17_ARATH RecName: Full=Two-component response regulator ARR17;
    3::105     2e-05  23%  224 aa  GRAR_STAS1 RecName: Full=Response regulator protein graR;AltName:
   10::113     2e-05  27%  341 aa  EHD1_ORYSJ RecName: Full=Two-component response regulator
   10::113     2e-05  27%  341 aa  EHD1_ORYSI RecName: Full=Two-component response regulator
    1::109     2e-05  36%  353 aa  CHEB_PELCD RecName: Full=Chemotaxis response regulator
    1::111     2e-05  36%  358 aa  CHEB2_XANOR RecName: Full=Chemotaxis response regulator
    1::111     2e-05  36%  358 aa  CHEB2_XANOM RecName: Full=Chemotaxis response regulator
    1::111     2e-05  36%  358 aa  CHEB1_XANC5 RecName: Full=Chemotaxis response regulator
    1::111     2e-05  36%  358 aa  CHEB1_XANAC RecName: Full=Chemotaxis response regulator
    1::112     2e-05  32%  367 aa  CHEB1_BURPS RecName: Full=Chemotaxis response regulator
   64::169     2e-05  27%  495 aa  APRR3_ARATH RecName: Full=Two-component response regulator-like
    3::104     2e-05  26%  220 aa  VANR_ENTFA RecName: Full=Regulatory protein vanRB;
    5::103     2e-05  26%  230 aa  TORR_ECOLI RecName: Full=TorCAD operon transcriptional regulatory
    6::76      2e-05  37%  198 aa  REGX3_MYCLE RecName: Full=Sensory transduction protein regX3;
    3::110     2e-05  26%  246 aa  LYTT_OCEIH RecName: Full=Sensory transduction protein lytT;
    1::104     2e-05  29%  246 aa  LYTR_STAAW RecName: Full=Sensory transduction protein lytR;
    1::104     2e-05  29%  246 aa  LYTR_STAAS RecName: Full=Sensory transduction protein lytR;
    1::104     2e-05  29%  246 aa  LYTR_STAAR RecName: Full=Sensory transduction protein lytR;
    1::104     2e-05  29%  246 aa  LYTR_STAAN RecName: Full=Sensory transduction protein lytR;
    1::104     2e-05  29%  246 aa  LYTR_STAAM RecName: Full=Sensory transduction protein lytR;
    1::104     2e-05  29%  246 aa  LYTR_STAAC RecName: Full=Sensory transduction protein lytR;
    1::104     2e-05  29%  246 aa  LYTR_STAAB RecName: Full=Sensory transduction protein lytR;
    1::104     2e-05  29%  246 aa  LYTR_STAA8 RecName: Full=Sensory transduction protein lytR;
    1::104     2e-05  29%  246 aa  LYTR_STAA3 RecName: Full=Sensory transduction protein lytR;
    5::108     2e-05  30%  226 aa  DPIA_SHIFL RecName: Full=Transcriptional regulatory protein dpiA;
    5::108     2e-05  30%  226 aa  DPIA_ECOLI RecName: Full=Transcriptional regulatory protein
    5::108     2e-05  30%  226 aa  DPIA_ECOL6 RecName: Full=Transcriptional regulatory protein
    5::108     2e-05  30%  226 aa  DPIA_ECO57 RecName: Full=Transcriptional regulatory protein
    4::108     2e-05  36%  349 aa  CHEB_YERPN RecName: Full=Chemotaxis response regulator
    4::108     2e-05  36%  349 aa  CHEB_YERPE RecName: Full=Chemotaxis response regulator
    4::108     2e-05  36%  349 aa  CHEB_YERPA RecName: Full=Chemotaxis response regulator
   10::113     2e-05  25%  521 aa  ARR11_ARATH RecName: Full=Two-component response regulator
    3::105     2e-05  28%  221 aa  AGMR_PSEAE RecName: Full=Glycerol metabolism activator;AltName:
    1::107     3e-05  29%  263 aa  Y4021_VIBPA RecName: Full=Uncharacterized response regulatory
    4::106     3e-05  32%  454 aa  PLED_CAUCR RecName: Full=Response regulator pleD;AltName:
    1::165     3e-05  25%  232 aa  CTRA_OCHA4 RecName: Full=Cell cycle response regulator ctrA;
    1::165     3e-05  25%  232 aa  CTRA_BRUSU RecName: Full=Cell cycle response regulator ctrA;
    1::165     3e-05  25%  232 aa  CTRA_BRUSI RecName: Full=Cell cycle response regulator ctrA;
    1::165     3e-05  25%  232 aa  CTRA_BRUO2 RecName: Full=Cell cycle response regulator ctrA;
    1::165     3e-05  25%  232 aa  CTRA_BRUME RecName: Full=Cell cycle response regulator ctrA;
    1::165     3e-05  25%  232 aa  CTRA_BRUC2 RecName: Full=Cell cycle response regulator ctrA;
    1::165     3e-05  25%  232 aa  CTRA_BRUAB RecName: Full=Cell cycle response regulator ctrA;
    1::165     3e-05  25%  232 aa  CTRA_BRUA2 RecName: Full=Cell cycle response regulator ctrA;
    1::165     3e-05  25%  232 aa  CTRA_BRUA1 RecName: Full=Cell cycle response regulator ctrA;
    4::108     3e-05  36%  349 aa  CHEB_YERPS RecName: Full=Chemotaxis response regulator
    1::109     3e-05  32%  364 aa  CHEB1_BURTA RecName: Full=Chemotaxis response regulator
    1::109     3e-05  32%  364 aa  CHEB1_BURP1 RecName: Full=Chemotaxis response regulator
    1::109     3e-05  32%  364 aa  CHEB1_BURMA RecName: Full=Chemotaxis response regulator
    9::110     4e-05  28%  131 aa  YSO1_PLEBO RecName: Full=Uncharacterized 14.6 kDa protein in sodA1
    5::103     4e-05  26%  230 aa  TORR_ECO57 RecName: Full=TorCAD operon transcriptional regulatory
  819::930     4e-05  23%  949 aa  RCSC_ECOLI RecName: Full=Sensor kinase protein rcsC;       
   43::148     4e-05  29%  623 aa  PRR95_ORYSJ RecName: Full=Two-component response regulator-like
   15::116     4e-05  25%  205 aa  PDTAR_MYCTU RecName: Full=Probable transcriptional regulatory
    2::109     4e-05  25%  214 aa  GACA_PSEAE RecName: Full=Response regulator gacA;AltName:
    3::107     4e-05  35%  356 aa  CHEB_THIDA RecName: Full=Chemotaxis response regulator
    4::108     4e-05  34%  350 aa  CHEB_BORPE RecName: Full=Chemotaxis response regulator
    4::108     4e-05  34%  350 aa  CHEB_BORPA RecName: Full=Chemotaxis response regulator
    4::108     4e-05  34%  350 aa  CHEB_BORBR RecName: Full=Chemotaxis response regulator
    5::109     4e-05  32%  363 aa  CHEB2_RHORT RecName: Full=Chemotaxis response regulator
  107::359     5e-05  28%  758 aa  CHLD_TOBAC RecName: Full=Magnesium-chelatase subunit chlD,
    2::105     5e-05  30%  366 aa  CHEB_SALRD RecName: Full=Chemotaxis response regulator
    1::111     5e-05  36%  358 aa  CHEB2_XANC8 RecName: Full=Chemotaxis response regulator
    1::111     5e-05  36%  358 aa  CHEB1_XANCP RecName: Full=Chemotaxis response regulator
   17::121     5e-05  25%  635 aa  ARR18_ARATH RecName: Full=Two-component response regulator ARR18;
    4::107     7e-05  32%  233 aa  YCCH_BACSU RecName: Full=Uncharacterized transcriptional regulatory
   10::117     7e-05  23%  183 aa  REGA_RHOSU RecName: Full=Photosynthetic apparatus regulatory
    1::115     7e-05  22%  135 aa  PILG_PSEAE RecName: Full=Protein pilG;
    2::113     7e-05  24%  372 aa  CHEB_TREDE RecName: Full=Chemotaxis response regulator
    6::110     7e-05  29%  363 aa  CHEB2_ACIBL RecName: Full=Chemotaxis response regulator
    6::110     7e-05  35%  357 aa  CHEB1_RALME RecName: Full=Chemotaxis response regulator
   30::130     9e-05  28%  267 aa  VIRG_AGRT9 RecName: Full=Regulatory protein virG;
  823::930     9e-05  23%  948 aa  RCSC_SALTY RecName: Full=Sensor protein rcsC;       
  823::930     9e-05  23%  948 aa  RCSC_SALTI RecName: Full=Sensor protein rcsC;       
   25::110     9e-05  24%  233 aa  PRRA_MYCTU RecName: Full=Transcriptional regulatory protein prrA;
   25::110     9e-05  24%  233 aa  PRRA_MYCBO RecName: Full=Transcriptional regulatory protein prrA;
    1::103     9e-05  29%  254 aa  LYTR_STAS1 RecName: Full=Sensory transduction protein lytR;
    6::110     9e-05  31%  354 aa  CHEB_CHRSD RecName: Full=Chemotaxis response regulator
    4::108     9e-05  32%  362 aa  CHEB_BURXL RecName: Full=Chemotaxis response regulator
    1::111     9e-05  31%  346 aa  CHEB_BACHD RecName: Full=Chemotaxis response regulator
    3::107     9e-05  33%  351 aa  CHEB2_SHESM RecName: Full=Chemotaxis response regulator
    6::110     9e-05  35%  356 aa  CHEB2_RALEJ RecName: Full=Chemotaxis response regulator
    4::103     9e-05  26%  219 aa  ARLR_STAHJ RecName: Full=Response regulator arlR;
    3::103     1e-04  22%  207 aa  TRPO_PSEAE RecName: Full=Putative transcriptional regulator;
  267::351     1e-04  34%  702 aa  LONH_HALSA RecName: Full=Putative protease La homolog type;        
    2::107     1e-04  26%  214 aa  GACA_PSEU2 RecName: Full=Response regulator gacA;AltName:
    2::110     1e-04  26%  239 aa  DCUR_SHIFL RecName: Full=Transcriptional regulatory protein dcuR;
    2::110     1e-04  26%  239 aa  DCUR_ECOLI RecName: Full=Transcriptional regulatory protein dcuR;
    2::110     1e-04  26%  239 aa  DCUR_ECOL6 RecName: Full=Transcriptional regulatory protein dcuR;
    2::110     1e-04  26%  239 aa  DCUR_ECO57 RecName: Full=Transcriptional regulatory protein dcuR;
  565::667     1e-04  27%  681 aa  CQSS_VIBHB RecName: Full=CAI-1 autoinducer sensor
    6::109     1e-04  35%  357 aa  CHEB1_DESVH RecName: Full=Chemotaxis response regulator
    5::107     1e-04  32%  359 aa  CHEB1_CHRVO RecName: Full=Chemotaxis response regulator
    4::108     1e-04  30%  360 aa  CHEB1_BURCA RecName: Full=Chemotaxis response regulator
   78::183     1e-04  26%  727 aa  APRR7_ARATH RecName: Full=Two-component response regulator-like
    2::102     1e-04  30%  238 aa  Y3287_YERPE RecName: Full=Uncharacterized response regulatory
   25::110     1e-04  24%  233 aa  PRRA_MYCLE RecName: Full=Transcriptional regulatory protein prrA;
  132::220     1e-04  28%  267 aa  PHYR_METEA RecName: Full=Phyllosphere-induced regulator phyR;
    3::104     1e-04  24%  226 aa  PCOR_ECOLX RecName: Full=Transcriptional regulatory protein pcoR;
    3::102     1e-04  27%  232 aa  CPXR_SHIFL RecName: Full=Transcriptional regulatory protein cpxR;
    3::102     1e-04  27%  232 aa  CPXR_ECOLI RecName: Full=Transcriptional regulatory protein cpxR;
    3::102     1e-04  27%  232 aa  CPXR_ECO57 RecName: Full=Transcriptional regulatory protein cpxR;
    3::109     1e-04  28%  366 aa  CHEB_NOCSJ RecName: Full=Chemotaxis response regulator
    1::111     1e-04  31%  363 aa  CHEB3_BURS3 RecName: Full=Chemotaxis response regulator
    4::104     1e-04  23%  209 aa  BVGA_BORPE RecName: Full=Virulence factors putative positive
    4::104     1e-04  23%  209 aa  BVGA_BORPA RecName: Full=Virulence factors putative positive
    4::104     1e-04  23%  209 aa  BVGA_BORBR RecName: Full=Virulence factors putative positive
   16::119     1e-04  25%  552 aa  ARR10_ARATH RecName: Full=Two-component response regulator
    4::101     2e-04  27%  239 aa  RSTA_ECOLI RecName: Full=Transcriptional regulatory protein rstA;
    4::104     2e-04  25%  225 aa  MTRA_MYCTU RecName: Full=DNA-binding response regulator mtrA;
    4::104     2e-04  25%  225 aa  MTRA_MYCPA RecName: Full=DNA-binding response regulator mtrA;
    4::104     2e-04  25%  225 aa  MTRA_MYCLE RecName: Full=DNA-binding response regulator mtrA;
    4::104     2e-04  25%  225 aa  MTRA_MYCBO RecName: Full=DNA-binding response regulator mtrA;
  411::513     2e-04  28%  534 aa  LOVHK_PSEU2 RecName: Full=Blue-light-activated protein;Includes:
  411::513     2e-04  27%  534 aa  LOVHK_PSE14 RecName: Full=Blue-light-activated protein;Includes:
    5::104     2e-04  23%  242 aa  GTCR_ANEMI RecName: Full=Response regulator gtcR;
  568::699     2e-04  32%  857 aa  CLPB_STRAL RecName: Full=Chaperone protein clpB;
    7::111     2e-04  28%  355 aa  CHEB_PYRKO RecName: Full=Chemotaxis response regulator
    4::108     2e-04  32%  350 aa  CHEB_PHOLL RecName: Full=Chemotaxis response regulator
   50::111     2e-04  37%  352 aa  CHEB_OCEIH RecName: Full=Chemotaxis response regulator
    3::106     2e-04  24%  231 aa  BCER_BACSU RecName: Full=Sensory transduction protein bceR;
    3::103     2e-04  24%  219 aa  ARLR_STAAW RecName: Full=Response regulator arlR;
    3::103     2e-04  24%  219 aa  ARLR_STAAS RecName: Full=Response regulator arlR;
    3::103     2e-04  24%  219 aa  ARLR_STAAR RecName: Full=Response regulator arlR;
    3::103     2e-04  24%  214 aa  ARLR_STAAN RecName: Full=Response regulator arlR;
    3::103     2e-04  24%  219 aa  ARLR_STAAM RecName: Full=Response regulator arlR;
    3::103     2e-04  24%  219 aa  ARLR_STAAC RecName: Full=Response regulator arlR;
    3::103     2e-04  24%  219 aa  ARLR_STAAB RecName: Full=Response regulator arlR;
    3::103     2e-04  24%  219 aa  ARLR_STAA8 RecName: Full=Response regulator arlR;
    3::103     2e-04  24%  219 aa  ARLR_STAA3 RecName: Full=Response regulator arlR;
   19::124     2e-04  23%  618 aa  APRR1_ARATH RecName: Full=Two-component response regulator-like
  423::606     3e-04  28%  705 aa  CLPB_MYCPE RecName: Full=Chaperone protein clpB;
   53::109     3e-04  32%  355 aa  CHEB3_MAGSA RecName: Full=Chemotaxis response regulator
    3::107     3e-04  32%  351 aa  CHEB2_SHESR RecName: Full=Chemotaxis response regulator
    1::108     3e-04  31%  365 aa  CHEB2_RHIL3 RecName: Full=Chemotaxis response regulator
    6::110     3e-04  31%  363 aa  CHEB1_GEOMG RecName: Full=Chemotaxis response regulator
   12::112     3e-04  24%  240 aa  BAER_ECOLI RecName: Full=Transcriptional regulatory protein baeR;
   12::112     3e-04  24%  240 aa  BAER_ECOL6 RecName: Full=Transcriptional regulatory protein baeR;
    3::103     3e-04  25%  220 aa  ARLR_STAS1 RecName: Full=Response regulator arlR;
    4::104     3e-04  23%  235 aa  YYCF_BACSU RecName: Full=Transcriptional regulatory protein yycF;
   27::133     3e-04  27%  378 aa  RPFG_XANC8 RecName: Full=Response regulator rpfG;
    8::105     3e-04  31%  215 aa  NARP_ECOLI RecName: Full=Nitrate/nitrite response regulator protein
 1078::1187    3e-04  25% 1225 aa  DHKC_DICDI RecName: Full=Hybrid signal transduction histidine kinase
   22::104     3e-04  27%  225 aa  CSSR_BACSU RecName: Full=Transcriptional regulatory protein cssR;
    3::102     3e-04  27%  227 aa  CPXR_HAEIN RecName: Full=Transcriptional regulatory protein cpxR
    6::113     3e-04  29%  129 aa  CHEY_SALTY RecName: Full=Chemotaxis protein cheY;
    6::113     3e-04  29%  129 aa  CHEY_SALTI RecName: Full=Chemotaxis protein cheY;
   36::109     3e-04  32%  352 aa  CHEB_TRIEI RecName: Full=Chemotaxis response regulator
   18::132     3e-04  27%  206 aa  ARR15_ARATH RecName: Full=Two-component response regulator ARR15;
    3::103     4e-04  24%  237 aa  YVCP_BACSU RecName: Full=Uncharacterized transcriptional regulatory
   81::186     4e-04  26%  767 aa  PRR73_ORYSJ RecName: Full=Two-component response regulator-like
   81::186     4e-04  26%  767 aa  PRR73_ORYSI RecName: Full=Two-component response regulator-like
    6::113     4e-04  29%  129 aa  CHEY_SHIFL RecName: Full=Chemotaxis protein cheY;
    6::113     4e-04  29%  129 aa  CHEY_ECOLI RecName: Full=Chemotaxis protein cheY;
    6::113     4e-04  29%  129 aa  CHEY_ECO57 RecName: Full=Chemotaxis protein cheY;
    1::111     4e-04  32%  367 aa  CHEB_THETN RecName: Full=Chemotaxis response regulator
    1::106     4e-04  29%  358 aa  CHEB3_VIBCH RecName: Full=Chemotaxis response regulator
 2209::2320    6e-04  25% 2344 aa  MAK3_SCHPO RecName: Full=Peroxide stress-activated histidine kinase
    2::104     6e-04  28%  246 aa  LYTT_BACAN RecName: Full=Sensory transduction protein lytT;
  571::703     6e-04  31%  870 aa  CLPB1_STRAW RecName: Full=Chaperone protein clpB 1;
    6::113     6e-04  29%  129 aa  CHEY_ECOL6 RecName: Full=Chemotaxis protein cheY;
   49::107     6e-04  33%  130 aa  CHEY_CAMJJ RecName: Full=Chemotaxis protein cheY homolog;
   49::107     6e-04  33%  130 aa  CHEY_CAMJE RecName: Full=Chemotaxis protein cheY homolog;
   49::107     6e-04  33%  130 aa  CHEY_CAMJ8 RecName: Full=Chemotaxis protein cheY homolog;
   13::117     6e-04  27%  360 aa  CHEB3_BURTA RecName: Full=Chemotaxis response regulator
    3::108     7e-04  25%  218 aa  YXJL_BACSU RecName: Full=Uncharacterized transcriptional regulatory
    1::99      7e-04  26%  226 aa  YCBL_BACSU RecName: Full=Uncharacterized transcriptional regulatory
  371::482     7e-04  22%  622 aa  SKN7_YEAST RecName: Full=Transcription factor SKN7;AltName:
    2::104     7e-04  28%  246 aa  LYTT_BACCR RecName: Full=Sensory transduction protein lytT;
   93::205     7e-04  38%  552 aa  LON2_BACSU RecName: Full=ATP-dependent protease La homolog;        
  659::739     7e-04  28%  777 aa  FRZE_MYXXA RecName: Full=Gliding motility regulatory protein;      
    6::113     7e-04  30%  129 aa  CHEY_YERPE RecName: Full=Chemotaxis protein cheY;
    5::109     7e-04  33%  356 aa  CHEB2_DESDG RecName: Full=Chemotaxis response regulator
    1::105     7e-04  30%  347 aa  CHEB2_CAUCR RecName: Full=Chemotaxis response regulator
   16::119     7e-04  25%  596 aa  ARR12_ARATH RecName: Full=Two-component response regulator ARR12;
    3::104     0.001  22%  251 aa  Y165_STAES RecName: Full=Uncharacterized response regulatory
   30::130     0.001  27%  267 aa  VIRG_RHIRD RecName: Full=Regulatory protein virG;
  369::470     0.001  25%  539 aa  PRR1_SCHPO RecName: Full=Transcription factor prr1;AltName:
    1::103     0.001  29%  252 aa  LYTR_STAES RecName: Full=Sensory transduction protein lytR;
    1::103     0.001  29%  252 aa  LYTR_STAEQ RecName: Full=Sensory transduction protein lytR;
  723::800     0.001  24%  849 aa  LUXN_VIBHB RecName: Full=Autoinducer 1 sensor kinase/phosphatase
  723::800     0.001  24%  849 aa  LUXN_VIBHA RecName: Full=Autoinducer 1 sensor kinase/phosphatase
  517::647     0.001  27%  848 aa  CLPC_MYCTU RecName: Full=Probable ATP-dependent Clp protease
  517::647     0.001  27%  848 aa  CLPC_MYCLE RecName: Full=Probable ATP-dependent Clp protease
  517::647     0.001  27%  848 aa  CLPC_MYCBO RecName: Full=Probable ATP-dependent Clp protease
    8::112     0.001  32%  368 aa  CHEB_PYRAB RecName: Full=Chemotaxis response regulator
   12::116     0.001  30%  362 aa  CHEB5_ANADE RecName: Full=Chemotaxis response regulator
    6::106     0.001  27%  341 aa  CHEB2_SYNWW RecName: Full=Chemotaxis response regulator
   14::120     0.001  29%  367 aa  CHEB2_METMA RecName: Full=Chemotaxis response regulator
    4::106     0.001  27%  360 aa  CHEB2_GEOMG RecName: Full=Chemotaxis response regulator
    4::110     0.001  30%  354 aa  CHEB2_CARHZ RecName: Full=Chemotaxis response regulator
   15::119     0.001  37%  373 aa  CHEB1_RHOFD RecName: Full=Chemotaxis response regulator
   10::113     0.001  29%  361 aa  CHEB1_HAHCH RecName: Full=Chemotaxis response regulator
    3::105     0.001  26%  120 aa  CCDB_BACSU RecName: Full=Protein ccdB;
   16::117     0.001  24%  592 aa  ARR21_ARATH RecName: Full=Putative two-component response regulator
    1::444

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIAMQDGLRVLFVEDEPLVRQATAQSLELAGFSVLALPSAEAAMPHLGADFPGVLVTDVRLSGASGLDLL
DCTD_RHIME      ---------VFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALF
DCTD_RHILE      ---------VALIDDDKDLRRATAQTLELAGFSVSAYDGAKAALADLPADFAGPVVTDIRMPEIDGLQLF
ALGB_PSEAE      --------RILLVDDESAILRTFRYCLEDEGYSVATASSAPQAEALLQRQVFDLCFLDLRLGEDNGLDVL
NTRC_KLEPN      ---MQRGIAWI-VDDDSSIRWVLERALTGAGLSCTTFESGNEVLDALTTKTPDVLLSDIRMPGMDGLALL
NTRC_ECOLI      ---MQRGI-VWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRMPGMDGLALL
NTRC_ECO57      ---MQRGI-VWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRMPGMDGLALL
NTRC_SALTY      ---MQRGI-VWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALL
ALGB_PSEPK      --------RILLVDDESAILRTFRYCLEDEGYSVATANSAAQAETLLQRQVFDLCFLDLRLGEDNGLDVL
ALGB_PSESM      --------RILLVDDESAILRTFRYCLEDEGYSVATANSAAQADTLMQRQVFDLCFLDLRLGEDNGLDVL
ATOC_ECOLI      --------RILIVDDEDNVRRMLSTAFALQGFETHCANNGRTAL-HLFADIPDVVLMDIRMPEMDGIKAL
NTRC_PROVU      ---MQKG-NVWVVDDDSSIRWVLERAITREGMLCRAFEHANDVLKALNSEQPDVLLSDIRMPDMDGLSLL
NTRC_AZOBR      ---------ILVADDDRAIRTVLTQALARLGHEVRTTGNASTLWRWVADGQGDLIITDVVMPDENGLDLI
YFHA_ECOLI      ------------------------------GYSVVTAESGAEGLRVLNREKVDLVISDLRMDEMDGMQLF
YFHA_ECO57      ------------------------------GYSVVTAESGAEGLRVLNREKVDLVISDLRMDEMDGMQLF
ZRAR_SALTY      ------------------------------GYNVALAYSGHDALAQVREKVFDLVLCDVRMAEMDGIATL
ZRAR_SALTI      ------------------------------GYNVALAYSGHDALAQVREKVFDLVLCDVRMAEMDGIATL
ZRAR_ECOLI      ------------------------------GYNVALANSGRQALEQVREQVFDLVLCDVRMAEMDGIATL
NTRC_BRASR      ---------ILVADDDTAIRTVLNQALSRAGYEVRLTGNAATLWRWVSQGEGDLVITDVVMPDENAFDLL
ZRAR_ECO57      ------------------------------GYNVALANSGRQALEQVRERVFDLVLCDVRMAEMDGIATL
NTRC_RHIME      ------GATILVADDDAAIRTVLNQALSRAGYDVRITSNAATLWRWIAAGDGDLVVTDVVMPDENAFDLL
NTRC_AZOC5      ---------ILVADDDAAIRTVLNQALSRAGYEVRSCGNAATLWRWVSQGDGDLVITDVVMPDENAFDLL
ZRAR_KLEOX      -----------------------------------------------------LVLCDIRMAEMDGIETL
PILR_PSEAE      --------KALIVDDEPDIRELLEITLGRMKLDTRSARNVKEARELLAREPFDLCLTDMRLPDGSGLDLV
NTRX_AZOC5      ---------ILIVDDEPDISGLVAGILEDEGYSARTARDADGALAEIAARRPNLIFLDIWLQGSDGLELL
STC_CLOBE       ----------------------------------------------------------------------
HOXA_RALEH      ---------VLVVDDETRSQDALRRTLD-EEFRVLTVSSADEARALLLRQPVSVILCDQRMPGLTGVEFL
HRPR_PSESY      ----------------------------------------------------------------------
NORR_ENT38      ----------------------------------------------------------------------
WTSA_ERWST      ----------------------------------------------------------------------
LUXO_VIBPA      ----------------------------------------------------------------TGMDVL
HRPS_PSESY      ----------------------------------------------------------------------
FHLA_SALTY      ----------------------------------------------------------------------
NIFA_AZOVI      ----------------------------------------------------------------------
LUXO_VIBHB      ----------------------------------------------------------------TGMDVL
LUXO_VIBHA      ----------------------------------------------------------------TGMDVL
YGEV_ECOLI      ----------------------------------------------------------------------
NORR_SALPC      ----------------------------------------------------------------------
NORR_KLEP7      ----------------------------------------------------------------------
FHLA_ECOLI      ----------------------------------------------------------------------
NORR_SALTY      ----------------------------------------------------------------------
NORR_SALSV      ----------------------------------------------------------------------
NORR_SALNS      ----------------------------------------------------------------------
NORR_SALA4      ----------------------------------------------------------------------
NORR_ECOLI      ----------------------------------------------------------------------
NORR_ECODH      ----------------------------------------------------------------------
NORR_ECOBW      ----------------------------------------------------------------------
NORR_CITK8      ----------------------------------------------------------------------
VNFA_AZOVI      ----------------------------------------------------------------------
NORR_SHIFL      ----------------------------------------------------------------------
NORR_SHIF8      ----------------------------------------------------------------------
NORR_SHIDS      ----------------------------------------------------------------------
NORR_SALTI      ----------------------------------------------------------------------
NORR_SALPB      ----------------------------------------------------------------------
NORR_SALPA      ----------------------------------------------------------------------
NORR_SALG2      ----------------------------------------------------------------------
NORR_SALEP      ----------------------------------------------------------------------
NORR_SALDC      ----------------------------------------------------------------------
NORR_SALCH      ----------------------------------------------------------------------
NORR_ECO5E      ----------------------------------------------------------------------
NORR_ECO57      ----------------------------------------------------------------------
NIFA_ENTAG      ----------------------------------------------------------------------
NORR_SALAR      ----------------------------------------------------------------------
NORR_SALHS      ----------------------------------------------------------------------
NORR_KLEP3      ----------------------------------------------------------------------
PSPF_ECOLI      ----------------------------------------------------------------------
NORR_ECOSM      ----------------------------------------------------------------------
ANFA_AZOVI      ----------------------------------------------------------------------
NORR_ESCF3      ----------------------------------------------------------------------
NORR_ECOSE      ----------------------------------------------------------------------
NORR_ECO24      ----------------------------------------------------------------------
NORR_ECOUT      ----------------------------------------------------------------------
NORR_ECOLU      ----------------------------------------------------------------------
NORR_ECOL6      ----------------------------------------------------------------------
NORR_ECOL5      ----------------------------------------------------------------------
NORR_ECOK1      ----------------------------------------------------------------------
NORR_ECO8A      ----------------------------------------------------------------------
NORR_ECO81      ----------------------------------------------------------------------
NORR_ECO45      ----------------------------------------------------------------------
NORR_ECO27      ----------------------------------------------------------------------
NORR2_RALEH     ----------------------------------------------------------------------
NORR_SHISS      ----------------------------------------------------------------------
NORR_SHIBS      ----------------------------------------------------------------------
NORR_ECOLC      ----------------------------------------------------------------------
NORR_ECOHS      ----------------------------------------------------------------------
NORR_ECO55      ----------------------------------------------------------------------
HRPS_PSESH      ----------------------------------------------------------------------
FLBD_CAUCR      ----------------------------------------------------------------------
XYLR_PSEPU      ----------------------------------------------------------------------
NIFA_HERSE      ----------------------------------------------------------------------
LUXO_VIBVY      ----------------------------------------------------------------TGMDVL
LUXO_VIBVU      ----------------------------------------------------------------TGMDVL
NORR_ECO7I      ----------------------------------------------------------------------
NORR_ERWCT      ----------------------------------------------------------------------
PRPR_SALTY      ----------------------------------------------------------------------
NORR_AERHH      ----------------------------------------------------------------------
HYFR_ECOLI      ----------------------------------------------------------------------
PRPR_ECOLI      ----------------------------------------------------------------------
TYRR_ENTAG      ----------------------------------------------------------------------
NIFA_RHIEC      ----------------------------------------------------------------------
NIFA_KLEPN      ----------------------------------------------------------------------
NIFA_KLEOX      ----------------------------------------------------------------------
HOXA_BRAJA      ---------ILVVDDEVRSQEALRRVLR-EDFEVLCVGNATDAEKLLEGEIVHAILCDQRMPHESGVSFL
NIFA_RHISN      ----------------------------------------------------------------------
NIFA_AZOBR      ----------------------------------------------------------------------
NIFA_AZOLI      ----------------------------------------------------------------------
LUXO_VIBC3      ----------------------------------------------------------------------
ROCR_BACSU      ----------------------------------------------------------------------
NORR1_RALEH     ----------------------------------------------------------------------
NORR_AERS4      ----------------------------------------------------------------------
ACOR_BACSU      ----------------------------------------------------------------------
NIFA_AZOC5      ----------------------------------------------------------------------
NIFA_RHILT      ----------------------------------------------------------------------
NIFA_RHOCA      ----------------------------------------------------------------------
NIFA_RHILE      ----------------------------------------------------------------------
NORR_SERP5      ----------------------------------------------------------------------
NIFA_BRAJA      ----------------------------------------------------------------------
LUXO_VIBCH      ----------------------------------------------------------------TGMDVL
NORR_VIBF1      ----------------------------------------------------------------------
NTRXL_RICCN     -------LDVLIVDDEESIRNLIAANLKDEGFNPKVAANSTQALKILSEKPVSAVVLDIWLQGSEGLGIL
NORR_VIBVU      ----------------------------------------------------------------------
TYRR_ECOLI      ----------------------------------------------------------------------
NORR_VIBVY      ----------------------------------------------------------------------
NTRXL_RICPR     -------LDVLIVDDEESIRNLIAANLKDEGFNPKIAANSTQALKIISEKPVSAVILDIWLQGSEGLGVL
TYRR_SALTY      ----------------------------------------------------------------------
TYRR_SALTI      ----------------------------------------------------------------------
NTRXL_RICFE     -------LDVLIVDDEESIRNLIAANLKDEGFNPKVAANSTQALKILSEKPVSAVILDIWLQGSEGLGIL
HUPR_RHOCA      ---------ILLVDDEPHSLAAMKLALE-DDFDVLTAQGXXXXXXXXXXXWVQVIICDQRMPGRTGVDFL
NTRXL_RICTY     -------LDVLILDDEESIRNLIAANLKDEGFNPKVAANSTQALKIISEKPVSAVILDIWLQGSEGLGVL
PGTA_SALTY      ---------------------AYTQMLEQAGYRVRGFTHPFEAKEWVKADWEGIVLSDVCMPGCSGIDLM
TYRR_CITBR      ----------------------------------------------------------------------
YHYA_PSESN      ----------------------------------------------------------------------
ACOR_RALEH      ----------------------------------------------------------------------
NIFA_RHIME      ----------------------------------------------------------------------
YQIR_BACSU      ----------------------------------------------------------------------
NTRXL_RICBR     -------------------RNIIAAILKDEGFNPKVAANSTQALKILAEKPVSAVILDIWLQGSEGLGIL
TYRR_HAEIN      ----------------------------------------------------------------------
NTRC_RHOCA      ---------VLVADDDRTIRTVLTQALTRAGCKVHATASLMTLMRWVEEGKGDLVISDVVMPDGNGLEAL
DHAR_ECOLI      ----------------------------------------------------------------------
DHAR_CITFR      ----------------------------------------------------------------------
RTCR_ECOLI      ----------------------------------------------------------------------
Y4PA_RHISN      ----------------------------------------------------------------------
YPLP_BACSU      ----------------------------------------------------------------------
FIXJ_RHIME      ---------VHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELL
FIXJ_AZOC5      ---MPESLPVHVIDDDDAVRESLAFLLESSGLAVTQHTSAAA---FLDAGVPGCIVTDVRMPGISGLELL
FIXJ_BRAJA      ---------IYVIDDDAAMRDSLNFLLDSAGFGVTLFDDAQAFLDALPGLSFGCVVSDVRMPGLDGIELL
NODW_BRAJA      ---------VFVVEDDISMRRSLTNLFRSVGLEVVAFGSAREMLQSTMPDVTSCLVLDVRLPGLSGLDYQ
CSEB_STRCO      ---MADQTHVLFVEDDDVIREATQLALERDGFAVTAMPDGLSGLESFRADRPDIALLDVMLPGLDGVSLC
LEVR_BACSU      ----------------------------------------------------------------------
CSEB_STRAW      ---MAEQTHVLFVEDDDVIREATQLALERDGFAVTAMPDGLSGLEAFRANRPDIALLDVMVPGLDGVSLC
MPRA_MYCPA      -------MRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVC
MPRA_MYCA1      -------MRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVC
DCTR_RHOCA      -----------------------------------------AAGADLLAEWPGCLILDVRMEGMSGPQLL
MPRA_MYCBP      -------VRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVC
MPRA_MYCBO      -------VRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVC
MPRA_MYCVP      -------VRILVVDDDRAVRESLRRSLSFNGYSVELAQDGREALDLIASDRPDAVVLDVMMPRLDGLEVC
MPRA_MYCTU      -------VRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVC
MPRA_MYCTA      -------VRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDALVLDVMMPRLDGLEVC
PHOB_SHIFL      --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
PHOB_SHIDY      --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
PHOB_ECOLI      --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
PHOB_ECO57      --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
MPRA_MYCUA      -------VRILVVDDDRAVRESLRRSLSFNGYTVELAHDGVEALEMIASDRPDALVLDVMMPRLDGLEVC
MPRA_MYCLE      -------MRILAVDDDRAVRESLRRSLSFNGYSVELANDGVEALEMVARDRPDALVLDVMMPRLDGLEVC
ACTR_RHIME      ---------LLIVDDDTAFLRRLARAMEARGFAVEIAESVAEGIAKAKTRPPKHAVIDLRLSDGSGLDVI
YCF27_GALSU     --------KILIADDESSIRRILETRLSIIGYEVLTAPDGRSALFLFHKEHPNLVVLDVMMPKIDGYGVC
PHOB_PSEAE      ------GKTILIVDDEAPIREMIAVALEMAGYECLEAENTQQAHAVIVDRKPDLILLDWMLPGTSGIELA
PHOB_KLEPN      --------RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGLQFI
ACTR_SINMW      ---------LLIVDDDTAFLRRLARAMEARGFAVEIAESVAEGIAKAKTRPPKHAVIDLRLGDGSGLDVI
REGA_RHOS4      ---------LLVDDDEPFLKRL-AKAMEKRGFVLETAQSVAEGKAIAQARPPAYAVVDLRLEDGNGLDVV
MPRA_MYCS2      -------VRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDAITNNRPDALILDVMMPRLDGLEVC
MPRA_MYCSS      -------VRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDLIANNRPDAVVLDVMMPRLDGLEVC
MPRA_MYCSK      -------VRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDLIANNRPDAVVLDVMMPRLDGLEVC
MPRA_MYCSJ      -------VRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDLIANNRPDAVVLDVMMPRLDGLEVC
YCF27_GUITH     --------KVLIVDDEASIRKILETRLSMIGYFVVTASDGEEALNLFHQEMPDVVILDIMMPKLDGYGVC
REGA_RHOCA      ---------LLLVDDDNAFLTRLARAMEKRGFQTEIAETVSAGKAIVQNRAPAYAVIDLRLEDGNGLEVV
OMPR_SHIFL      ---MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSIC
OMPR_SALTY      ---MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSIC
OMPR_SALTI      ---MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSIC
OMPR_ECOLI      ---MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSIC
OMPR_ECOL6      ---MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSIC
OMPR_ECO57      ---MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSIC
PHOP_SALCH      -------MRVLVVEDNALLRHHLKVQLQDSGHQVDATEDAREADYYLNEHLPDIAIVDLGLPDEDGLSLI
YCF27_CYAPA     --------KILVVDDEISIRRILETRLSMIGYEVVTAADGEEALTIFQLEHPNLVVLDVMMPKLDGYGVC
MALR_BACSU      -------INVLIVEDDPMVGELNKRYLQIDGFQLKGIASSQSALHILGEHHIDLILLDIYMPGKNGLELL
SPHR_SYNE7      --------RILVVEDEAVIRDMVALVLQQEGFTVDVAADGRTALNYFRSDSPDLVVLDLMLPAVNGLDFC
YKOG_BACSU      ---------ILIVEDEEKIARVLQLELEYEGYSVTIKHNGTEGLDAAAEGGYSLVLLDVMLPGLSGLEVL
YCF27_PORAE     --------KILVIDDEASIRRILETRLSIIGYDVISAADGEEALSIFKREHPNLVVLDLMMPKLDGYGVC
PHOB_RHIME      --------KIAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQERLPDLLILDWMLPGVSGIELC
COPR_PSESM      -------MKLLVAEDEPKTGIYLQQGLREAGFNVDRVVTGTDAVDQALNEAYDLLILDVMMPGLDGWEVI
CHEB_NATPD      -----NGIAAVVVDDSQFMRTVISDMLDDAGITVVATASGESGVEAVRTHEPDVVTMDLKMPGMDGIEAT
QSEB_HAEIN      -------MRILLIEDDNLIGNGLQIGLTKLGFAVDWFTDGKTGMAALTSAPYDAVVLDLTLPKLDGLEVL
HNR_SHIFL       ------GKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAMPRMNGLKLL
HNR_ECOLI       ------GKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAMPRMNGLKLL
HNR_ECO57       ------GKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAMPRMNGLKLL
PHOP_SALTY      -------MRVLVVEDNALLRHHLKVQLQDSGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLI
PHOP_SALTI      -------MRVLVVEDNALLRHHLKVQLQDSGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLI
PHOP_SALPA      -------MRVLVVEDNALLRHHLKVQLQDSGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLI
DLTR_STRA5      -------MRLLVVEDEKSIAEAIQALLADKGYSVDLAFDGDDGLEYILTGLYDLVLLDIMLPKRSGLSVL
DLTR_STRA3      -------MRLLVVEDEKSIAEAIQALLADKGYSVDLAFDGDDGLEYILTGLYDLVLLDIMLPKRSGLSVL
CHEB2_MAGSA     ---MRKKIKVLIVEDSLVVRELLKHIIGSERFEVMAVTSAEDCLEMLETQQPDVISLDIRLPGMNGLDAT
BASR_SALTY      -------MKILIVEDDTLLLQGLILAAQTEGYACDGVSTARAAEHSLESGHYSLMVLDLGLPDEDGLHFL
SP0F_BACTK      --------KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKDNPDLVVLDMKIPGMDGIEIF
REGX3_MYCS2     ---------VLIVEDEESLADPLAFLLRKEGFEATVVPSALAEFERSGAD---IVLLDLMLPGMSGTDVC
QSEB_SALTY      -------MRILLVEDDTLIGDGIKAGLSKMGFSVDWFTEGRPGKEALYSAPYDAVILDLTLPGMDGRDIL
QSEB_SALTI      -------MRILLVEDDTLIGDGIKAGLSKMGFSVDWFTEGRPGKEALYSAPYDAVILDLTLPGMDGRDIL
AFSQ1_STRCO     ---------LLLIEDDDAIRTALELSLTRQGHRVATAASGEDGLKLLREQRPDLIVLDVMLPGIDGFEVC
DCTR_BACME      ---------VLLIEDDPMVQEVNRQFIEVEGFTVIAAASGLEGVQLIKQHQPDLTIIDMYMPSQDGLTTL
CUSR_ECOLI      -------MKLLIVEDEKKTGEYLTKGLTEAGFVVLADNGLNGYHLAMTGDYD-LIILDIMLPDVNGWDIV
CUSR_ECOL6      -------MKLLIVEDEKKTGEYLTKGLTEAGFVVLADNGLNGYHLAMTGDYD-LIILDIMLPDVNGWDIV
CUSR_ECO57      -------MKLLIVEDEKKTGEYLTKGLTEAGFVVLADNGLNGYHLAMTGDYD-LIILDIMLPDVNGWDIV
TCTD_SALTY      -------MRLLLAEDNRELAHWLEKALVQNGFAVDCVFDGLAADHLLHSEMYALAVLDINMPGMDGLEVV
REGX3_MYCTU     ---------VLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTDVC
REGX3_MYCBO     ---------VLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTDVC
QSEB_ECOLI      -------MRILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDIL
PHOP_SHIFL      -------MRVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLI
PHOP_ECOLI      -------MRVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHIPDIAIVDLGLPDEDGLSLI
PHOP_ECOL6      -------MRVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLI
Y851_SYNP2      --------RILVVEDEAVIRDMIVMGLEEEGYEVFFADNGRTGLPEFNADMPDLVILDIMLPEVNGLDLC
QSEB_ECO57      -------MRILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDIL
CYAB_STIAU      ---LQGHHRVMVVDDSPLACDFVKEGLEALGYEVMCFQDPYEALEQVGKVQPAIVLSDLDMPGIDGLELC
CTRA_CAUCR      -------MRVLLIEDDSATAQTIELMLKSEGFNVYTTDLGEEGVXXXXXXXXXXXXXXXXXXXMSGIDVL
CTRA_CAUCN      -------MRVLLIEDDSATAQTIELMLKSEGFNVYTTDLGEEGVXXXXXXXXXXXXXXXXXXXMSGIDVL
CHEY_THEMA      ------GKRVLIVDDAAFMRMMLKDIITKAGYEVAGATNGREAVEKYKELKPDIVTMDITMPEMNGIDAI
BASR_ECOLI      -------MKILIVEDDTLLLQGLILAAQTEGYACDSVTTARMAEQSLEAGHYSLVVLDLGLPDEDGLHFL
SILR_SALTY      -------MKILIVEDDIKTGEYLSKGLTEAGFVVDHADNGLTGY-HLAAEYD-LVILDIMLPDVNGWDII
RPRY_BACFR      MIDMDEKLRILLCEDDENLGMLLREYLQAKGYSAELYPDGEAGFKAFLKNKYDLCVFDVMMPKKDGFTLA
LYTR_STAHJ      -------MKTLIVDDEPLARNELHYLLEISGFNVIEAENIEETLEKLLSETYDLVFLDINLMDESGIDLA
HSSR_STAHJ      -------VKCLIVDDDYKILHYVSQHLEAAQIQTVTQASGESAIAYLANNKVDIAVVDIMMTGMDGFELC
DCTR_BACHD      -MAKEPLIRVLLIEDDPMVQEVNRMFVELSGFTIVGTTATEEGMVKTRELQPDLILLDIFMPKQDGLSFI
PHOP_ECO57      -------MRVLVVEDNALLRHHLKVQIQDAGHQVXXXXXXXXXXYYLNEHLPDIAIVDLGLPDEDGLSLI
PHOP_BACSU      --------KILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLDGIEVC
IRLR_BURPS      -------MRILIVEDEPKTGMYLRKGLTEAGFIADWVEDGVTGLHQAETEEYDLIILDVMLPGHDGWTVL
DHKD_DICDI      ---------VLVVEDNPEMNRFIAELLSKYYFVVTAFDGVEG-IEKTRAITPDLIVTDCMMPRMSGDEMV
CHEB_DESPS      -------LRVLVVDDTILYRKIVSDLLEIPGIEVIGVANGKIALDKIRLSKPDLITLDIEMPVMNGIELL
YESN_BACSU      --------KILLADDERIILDGMAGIIEWESLGASLIGKAQEAYEKIVHKQPHIVITDVKMPGMDGLELI
YEDW_ECOLI      -------MKILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQIL
RCAC_FREDI      -------MKILLVEDDDVLIKVLTKNLTTHHYIVDVVKDGEMGWTYGSTFEYDLIILDIMLPNLDGISLC
HSSR_STAAE      -------VQCLVVDDDPRILNYIASHLQIEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
HSSR_STAAC      -------VQCLVVDDDPRILNYIASHLQIEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
YCF27_PORYE     --------KILVVDDEASXXXXXXXXXXXXGYEVITASNGEEALLVFRKEYPSLVVLDVMMPKLDGYGVC
YCF27_PORPU     --------KILVVDDEASXXXXXXXXXXXXGYEVITASNGEEALIIFRKEYPSLVVLDVMMPKLDGYGVC
CHEB1_ANADE     --------RILVVDDSAVVRMALSQILGRAGLEVETAIDPLVAMDKMRRARPDAIVLDIEMPRMDGLTFL
HSSR_STAAR      -------VQCLVVDDDPRILNYIASHLQTEHIDAFTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
HSSR_STAAW      -------VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
HSSR_STAAT      -------VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
HSSR_STAAS      -------VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
HSSR_STAAN      -------VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
HSSR_STAAM      -------VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
HSSR_STAA9      -------VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
HSSR_STAA8      -------VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
HSSR_STAA3      -------VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
HSSR_STAA2      -------VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
HSSR_STAA1      -------VQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLC
CHEY_LISMO      -------LKLLIVDDAMFMRTMIKNIVKDSDFEVVAAENGLEAVKKYDEVKPDIVTLDITMPEMDGLEAL
CHEY_LISIN      -------LKLLIVDDAMFMRTMIKNIVKDSDFEVVAAENGLEAVKKYDEVKPDIVTLDITMPEMDGLEAL
CHEY_BACSU      --------RILIVDDAAFMRMMIKDILVKNGFEVVAAENGAQAVEKYKEHSPDLVTMDITMPEMDGITAL
HSSR_STAS1      ----------LIVDDDPKILEYVSKYIEREHFETIVQSSAENALSYLETHQVDIAIVDVMMGKMSGFELC
CHEB2_RHOS4     --AREGRTRVLIVDDSAMVRQALALGLSTPRLEVVGTASAEAARAQMAALKPDVVTLDLEMPQMDGLTFL
CHEB1_DECAR     --------RVLVVDDSALMRGLLSQMINLAPDMVGAAPDAQSAREMIKVLNPDVLTLDVQMPKMDGLEFL
ARR7_ARATH      -------LHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGLDGGNLIVTDYSMPGLSGYDLL
ALGR_PSEAE      -------MNVLIVDDEPLARERLARLVQLDGYRVLE-PSAEEALTLIDSLKPDIVLLDIRMPGLDGLQVA
PFER_PSEAE      --------RLLLVEDDPRLREDLDAHFRRRGFRVTVCGDGSHGLEAAGREAFDLVLLDIMLPGLDGLALL
CHEB2_RHOSH     --------RVLIVDDSAMVRQALALGLSTPRLEVVGTASAEAARAQMAALKPDVVTLDLEMPQMDGLTFL
ARR6_ARATH      -----DPLHVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGLDVENLIMTDYSMPGMTGYELL
CREB_ECOLI      ---------VWLVEDEQGIADTLVYMLQQEGFAVEVFERGLPVLDKARKQVPDVMILDVGLPDISGFELC
YCF27_CYACA     ---------LLIVDDENNIRKILQTRLTLLGYSVSTACNGEEALKIFTTHSIDLIILDVMMPKLDGYGVC
NARP_HAEIN      ---MQDKLKVLLIDDHPLMRRGIKQLVELDNFEVVAVSSGTEGISVALQTSPDVIILDLNMKGLSGLDTL
PHOB_HAEIN      --------KILIVEDECAIREMIALFLSQKYYDVIEASDFKTAINKIKEN-PKLILLDWMLPGRSGIQFI
DCTR_BACSU      --------KVLLIEDDPMVQEVNKDFITVKGVTVCATANGEEGMKLIKEEQPDLVILDVYMPKKDGIKTL
CZCR_RALME      -------MRVLVVEDEPRTAEYLQKGLSESGFVVDIANNGGDGLHMAEETDYDVIILDVMLPGMDGWTVI
YVRH_BACSU      ---------ILIVDDEKAIVDMIKRVLEKEGYNILDAASAEEAIPVVKANKVDLIVLDVMMGGMSGFEAC
CQSS_VIBCH      --------RILVVDDNQSIRTFTAILLEQQGYEVVQANDGSEVLKHMESQNIDLVLMDIEMPNVGGLEAT
CITB_KLEPN      -----DSITTLIVEDEPMLAEILVDNIQFPQFDVIGIADKESARKQLRLYQPQLILLDNFLPDGKGIDLI
CHVI_RHISN      ---------IALVDDDRNILTSVSIALEAEGYKVETYTDGASALEGLLARPPHLAIFDIKMPRMDGMELL
CHVI_RHIME      ---------IALVDDDRNILTSVSIALEAEGYKVETYTDGASALEGLLARPPQLAIFDIKMPRMDGMELL
CHEY_HELPJ      -------MKLLVVDDSSTMRRIIKNTLSRLGYEVLEAEHGVEAWEKLDANADTVLITDWNMPEMNGLDLV
ARR1_ARATH      ------GLRVLVVDDDPTCLMILERMLRTCLYEVTKCNRAEMALSLLRKNKHGIVISDVHMPDMDGFKLL
VIRG_AGRT5      ---------VLVIDDDVAMRHLIVEYLTIHAFKVTAVADSKQFNRVLCSETVDVVVVDLNLGREDGLEIV
VIRG_AGRRH      ---------VLVIDDDVAMRHLIVEYLTIHAFKVTAVADSKQFNRVLSSETVDVAVVDLNLGREDGLEIV
CUTR_STRLI      -------MRVLVVEDEQLLADAVATGLRREAMAVDVVYDGAAALERIGXXXXXXXXXXXXXXXXHGDDVC
CUTR_STRCO      -------MRVLVVEDEQLLADAVATGLRREAMAVDVVYDGAAALERIGXXXXXXXXXXXXXXXXHGDDVC
CHVI_RHIRD      ---------IALVDDDRNILTSVSIALEREGYRVETYTDGASAVDGLIARPPQLAIFDIKMPRMDGMELL
CHEY_PSEAE      -------MKILIVDDFSTMRRIIKNLLRDLGFTNTAADDGTTALPMLHSGNFDFLVTDWNMPGMTGIDLL
CHEB_HALMA      ---MADGVRAVVADDSHFMRSVISDILSDGGIDVVAQADGEEAVSAVIEHRPDVVTMDVEMPVMNGIEAT
CHEB3_RHORT     --------KVLIVDDSALMRRHLKEILEVGGFEVMVARNGIEALAGLESFDPDVITLDINMPEMDGLTCL
HSSR_STAES      -------INCLIVDDDKKLLQYVSSHLERESIQTHTFTSGEASLDFLENKNVDIAIVDIMMSGMDGFELC
HSSR_STAEQ      -------INCLIVDDDKKLLQYVSSHLERESIQTHTFTSGEASLDFLENKNVDIAIVDIMMSGMDGFELC
RESD_BACSU      --------KILVVDDEARIRRLLRMYLERENYAIDEAENGDEAIAKLEANYDLILL-DLMMPGTDGIEVC
LYTT_BACSU      -------LRVLIVDDEMLARDELAYLLKRTNMEINEAENIESAFDQMMDQKPDLLFLDVDLSGENGFDIA
HSSR_STAAB      -------VQCLVVDDDSRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVIDIMMDGMDGFQLC
CHEY_HELPY      -------MKLLVVDDSSTMRRIIKNTLSRLGYEVLEAEHGVEAWEKLDANADTVLITDWNMPEMNGLDLV
CHEB_TREPA      -------IAVLIVDDSALMRKVIGKVIEGAGLSIAGKANGRFALDMLERVQPDVILLDLEMPHMNGLQFL
PILH_PSEAE      --------RILIVDDSPTEMYKLTAMLEKHGHQVLKAENGGDGVALARQEKPDVVLMDIVMPGLNGFQAT
PDE2_DICDI      -------VRILVADDDDVQRKILNNLLKKFHYNVTLVPNGEIAWEYIGQQKYDLVLTDVMMPHITGFDLL
ARR5_ARATH      -------LHVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGLDGENLIMTDYSMPGMTGYELL
ARR4_ARATH      -----DEVHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGLDNEDLIITDYCMPGMTGYELL
YFIK_BACSU      -------IKIIITDDQDIVREGLASLLQLRELDVIATANGQEAFEKAKELEPDIVLMDIRMPVSNGVEGT
VANR_ENTFC      --------KILIVDDEHEIADLVELYLKNENYTVFKYYTAKEALECIDKSEIDLAILDIMLPGTSGLTIC
CHEB2_CHRVO     -------IKVLIVDDSAVVRQVLSQVFTAAGIEVMDVANPYMAMDKMKARWPDVIVLDVEMPRMDGITFL
APRR5_ARATH     -------LRVLLVEADDSTRQIIAALLRKCSYRVAAVPDGLKAWEMLKGKPESVILTEVDLPSISGYALL
TORS_ECO57      -----DGLRLLLIEDNPLTQRITVEMLNTSGAQVVAIGNAAQALETLQNSEPAAALVDFDLPDVNGITLA
RSSB_SERMA      -------MNILLVEDDLQLGKALCRALELAGFNLCWVRLIADAENKLSSXXXXXXXXXXXXXXXXXXQKL
GRAR_STAHJ      -------MQVLLVEDDQTLFQELKKELEHWDFFVTGIDDFSAVMDIYEETNPEIVIMDVQLPKYDGFYWC
CHEB_ARCFU      -------MRVLVVDDSALVRMAVTDILTKAGIEVVAKNGREAVEKALKLK-PDVITLDINMPEMDGLTAL
CHEB2_RHOCS     -----DPFRVMVVDDSAVIRGLITRALESDPEIVASVANGQMAINTLSRQPIDVIVLDIEMPVLDGLSAL
CHEB1_MAGSA     -----DSIRVMLVDDSAVVRGLVTRILEEAGIQVVAVGNGQMALASLERNEIDVVILDIEMPVMDGLTAL
ARR3_ARATH      -----DQVHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGLDDDDLIITDYCMPGMTGYELL
SAER_STAAW      ---------LLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDID-IMVLDIMMPEVNGYDIV
SAER_STAAS      ---------LLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDID-IMVLDIMMPEVNGYDIV
SAER_STAAR      ---------LLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDID-IMVLDIMMPEVNGYDIV
SAER_STAAN      ---------LLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDID-IMVLDIMMPEVNGYDIV
SAER_STAAM      ---------LLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDID-IMVLDIMMPEVNGYDIV
SAER_STAAE      ---------LLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDID-IMVLDIMMPEVNGYDIV
SAER_STAAC      ---------LLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDID-IMVLDIMMPEVNGYDIV
SAER_STAAB      ---------LLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDID-IMVLDIMMPEVNGYDIV
SAER_STAA8      ---------LLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDID-IMVLDIMMPEVNGYDIV
SAER_STAA3      ---------LLIVDDEQDIVDICQTYFEYEGYKVTTTTSGKEAISLLSNDID-IMVLDIMMPEVNGYDIV
PRR37_ORYSJ     -------IKVLLVDSDDSTRQVVSALLRHCMYEVIPAENGQQAWTYLEQNSIDLVLTEVVMPGVSGISLL
PRR37_ORYSI     -------IKVLLVDSDDSTRQVVSALLRHCMYEVIPAENGQQAWTYLEQNSIDLVLTEVVMPGVSGISLL
CHEB_THEMA      -------IRVLVVDDSAFMRMVSQPDMKVVGFAKDGLEAVEKAIELK----PDVITMDIEMPNLNGIEAL
CHEB_SHISS      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB_SHIFL      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB_SHIBS      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB_SALTY      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB_SALTI      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB_SALPA      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB_SALCH      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB_ECOUT      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB_ECOLI      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB_ECOL6      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB_ECOL5      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB_ECO57      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
CHEB3_LEPIN     -------IQVFIVDDSAVVRQVLTQILEIIGFASDPIFASEK----LSSVWPDVFILDIEMPRMDGISFL
CHEB3_LEPIC     -------IQVFIVDDSAVVRQVLTQILEIIGFASDPIFASEK----LSSVWPDVFILDIEMPRMDGISFL
CHEB3_HAHCH     ---------VLIVDDSPVIRQLLRHIIEEGGMRVIGEASGVEALRCIARRRPDVITMDIHMPVMDGLEAS
ARR2_ARATH      -------LRVLVVDDDPTCLMILERMLMTCLYRVTKCNRAESALSLLRKNKNGIVISDVHMPDMDGFKLL
APRR9_ARATH     -------LRVLLVESDYSTRQIITALLRKCCYKVVAVSDGLAAWEVLKEKSHNIILTELDLPSISGFALL
YBDJ_BACSU      ------GYRILIVEDDVMIGDLLQKILQREGYRVIWKTD--------GADVLSVIIMDVMLPGEDGYQMS
RPFC_XANCP      -------MRMLVADDHEANRMVLQRLLEKAGHKVLCVNGAEQVLDAMAEEDYDAVIVDLHMPGMNGLDML
RPFC_XANC8      -------MRMLVADDHEANRMVLQRLLEKAGHKVLCVNGAEQVLDAMAEEDYDAVIVDLHMPGMNGLDML
LYTT_ENTFA      -------MHVLIVDDEPLAREELSYSQHPQVTSVAEADSVAEAMEEMMDQKPDLLFLDIHLTDESGFDLA
CHLD_PEA        ----------------------------------------------------------------------
CHEB2_GEOSL     -------IKVLIVDDSAVVRQTMADILASDPQIEVMATAADIAAERMKSDVPDVITLDVEMPRMDGITFL
ARCA_SHIFL      ---------ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLA
ARCA_ECOLI      ---------ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLA
ARCA_ECOL6      ---------ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLA
ARCA_ECO57      ---------ILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGKNGLLLA
Y4XI_RHISN      -------MRTLLVDTD--LTRAVRGALGDGGFAVDVVGTLEQASSAFFSASYEILLLELVLPDGDGLDWL
WALR_STAS1      --------KVVVVDDEKPIADILEFNLKKEGYEVFCAYDGNDAVDLIYDEEPDIVLLDIMLPGRDGMEVC
WALR_STAHJ      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAES      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAEQ      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAAW      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAAU      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAAT      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAAS      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAAR      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAAN      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAAM      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAAE      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAAC      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAAB      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAA9      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAA8      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAA3      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAA2      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
WALR_STAA1      --------KVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVC
GRAR_STAES      -------MQILLVEDDNTLFQELKKELEQWDFNVVGVEDFSHVMETFETFNPEIVILDVQLPKYDGFYWC
GRAR_STAEQ      -------MQILLVEDDNTLFQELKKELEQWDFNVVGVEDFSHVMETFETFNPEIVILDVQLPKYDGFYWC
GRAR_STAAW      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAAT      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAAS      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAAR      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAAN      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAAM      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAAE      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAAC      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAAB      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAA9      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAA8      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAA3      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAA2      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
GRAR_STAA1      -------MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNPEIVILDVQLPKYDGFYWC
CHEB_METFK      -------IKVLIIDDSALIRSLLTEDLEVVGTA----PDPLIAREMIKQKNPDVLTLDVEMPKMDGLDFL
CHEB_METBU      -------IKTLVVDDSALMRRAIRDMLESADIEVIGTANGKEAVENTNKLKPEVIVMDVNMPIMDGLAAV
CHEB_ERWCT      -------IRVLCVDDSALMRQIMTEIINSPDMEVVATPDPLVARDLIKKFNPQVLTLDVEMPRMDGLDFL
CHEB_ENTCL      -------IRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKYNPDVLTLDVEMPRMDGIDFL
CHEB3_GEOMG     -------IKVLIVDDSAVVRQTMADILASDPHIEVMAPAADIAAERMREQVPDVITLDVEMPRMDGITFL
BCER_BACHD      --------KIMLIEDDHTLFSEIKERLSQWSYDVFGVSNFEKVIEEFTSLKPDLVIIDIQLPKFDGFHWC
ARR14_ARATH     ------GLRILVVDDDTSCLFILEKMLLRLMYQVTICSQADVALTILREDSFDLVLSDVHMPGMNGYNLL
YXDJ_BACSU      --------KIMIVEDSEDIRGLLQNYLEKYGYQTVVAADFTAVLDVFLREKPDVVLLDINLPAYDGYYWC
YRKP_BACSU      -----------------------------AGYEVLRAKDGKRAL-QLVNDSLDLVILDIMMPGISGIETC
TORS_ECOLI      -----DGLRLLLIEDNPLTQRITIEMLKTSGAQIVAVGNAAQALETLQNSEPAAALVDFDLPDIDGITLA
SRRA_STAAW      ---------ILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVA
SRRA_STAAU      ---------ILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVA
SRRA_STAAS      ---------ILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVA
SRRA_STAAR      ---------ILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVA
SRRA_STAAN      ---------ILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVA
SRRA_STAAM      ---------ILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVA
SRRA_STAAC      ---------ILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVA
SRRA_STAA8      ---------ILIVDDEDRIRRLLKMYLERESFEIHEASNGQEAYELAMENNYACILLDLMLPEMDGIQVA
LOVHK_PSESM     --------RILIVEDRPDVAELAKMVLDDYGYSEIVLNAREALKKFESGNMYDLLFTDLIMPGGNGVMLA
CHEB2_BORA1     -------IRVICVDDSALVRGLMTEIINSPDMEVVATPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFL
ARR17_ARATH     ---MEEELHVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGLGDPNLIITDYCMPGMTGFELL
GRAR_STAS1      ---------ILLVEDDMTLFKELSEELEQWDFNVNGIDDFNDVMTKFESVNPAIVIMDVKLPKYDGFYWT
EHD1_ORYSJ      ------GLRVLVIDDDCSYLSVMEDLLLKCSYKVTTYKNVREAVPFI-LDNPQIVISDAFFPTEDGLLIL
EHD1_ORYSI      ------GLRVLVIDDDCSYLSVMEDLLLKCSYKVTTYKNVREAVPFI-LDNPQIVISDAFFPTEDGLLIL
CHEB_PELCD      ---MPKKIRVLVIDDSALVRQILSKGLALD-------PSIEAGDPYIARDQPDVLTLDVEMPRMDGVDFL
CHEB2_XANOR     -MTLETPVRVLIVDDSAVVRQMLTEILSRAGIEVV----GSAADPLLARENPDVITLDVEMPRMDGLVFL
CHEB2_XANOM     -MTLETPVRVLIVDDSAVVRQMLTEILSRAGIEVV----GSAADPLLARENPDVITLDVEMPRMDGLVFL
CHEB1_XANC5     -MTLETPVRVLIVDDSAVVRQMLTEILSRAGIEVV----GSAADPLLARENPDVITLDVEMPRMDGLVFL
CHEB1_XANAC     -MTLETPVRVLIVDDSAVVRQMLTEILSRAGIEVV----GSAADPLLARENPDVITLDVEMPRMDGLVFL
CHEB1_BURPS     MNAVQKKIKVLCVDDSALIRSLMTEDMEVCATAPDPLVARELIKQH----NPDVLTLDVEMPRMDGLDFL
APRR3_ARATH     -------LKVLLVENDDSTRHIVTALLKNCSYEVTAVPDVLEAWRILEDEKSCIVLTEVDMPVHSGTGLL
VANR_ENTFA      -------IRILLVEDDDHICNTVRAFLAEARYEVDACTDGNEAHTKFYENTYQLVILDIMLPGMNGHELL
TORR_ECOLI      ---------IVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQSVDLILLDINLPDENGLMLT
REGX3_MYCLE     -------------------------------------PAALAEFDRSGAD---IVLLDLMLPGMSGTDVY
LYTT_OCEIH      -------IHIMIAEDERLAREELMYLLQQEN-DIILCPSAENGLLNLYQEYPNVIFLDIHMPGINGIEVA
LYTR_STAAW      -------MKALIIDDEPLARNELTYLLEIGGFEEIEAENVKETLEALLINQYDIIFLDVNLMDENGIELG
LYTR_STAAS      -------MKALIIDDEPLARNELTYLLEIGGFEEIEAENVKETLEALLINQYDIIFLDVNLMDENGIELG
LYTR_STAAR      -------MKALIIDDEPLARNELTYLLEIGGFEEIEAENVKETLEALLINQYDIIFLDVNLMDENGIELG
LYTR_STAAN      -------MKALIIDDEPLARNELTYLLEIGGFEEIEAENVKETLEALLINQYDIIFLDVNLMDENGIELG
LYTR_STAAM      -------MKALIIDDEPLARNELTYLLEIGGFEEIEAENVKETLEALLINQYDIIFLDVNLMDENGIELG
LYTR_STAAC      -------MKALIIDDEPLARNELTYLLEIGGFEEIEAENVKETLEALLINQYDIIFLDVNLMDENGIELG
LYTR_STAAB      -------MKALIIDDEPLARNELTYLLEIGGFEEIEAENVKETLEALLINQYDIIFLDVNLMDENGIELG
LYTR_STAA8      -------MKALIIDDEPLARNELTYLLEIGGFEEIEAENVKETLEALLINQYDIIFLDVNLMDENGIELG
LYTR_STAA3      -------MKALIIDDEPLARNELTYLLEIGGFEEIEAENVKETLEALLINQYDIIFLDVNLMDENGIELG
DPIA_SHIFL      -------LTLLIVEDEPLAEMHAEYIRHIPGFSQILLAGNLAQARMMIERFPGLILLDNYLPDGRGINLL
DPIA_ECOLI      -------LTLLIVEDEPLAEMHAEYIRHIPGFSQILLAGNLAQARMMIERFPGLILLDNYLPDGRGINLL
DPIA_ECOL6      -------LTLLIVEDEPLAEMHAEYIRHIPGFSQILLAGNLAQARMMIERFPGLILLDNYLPDGRGINLL
DPIA_ECO57      -------LTLLIVEDEPLAEMHAEYIRHIPGFSQILLAGNLAQARMMIERFPGLILLDNYLPDGRGINLL
CHEB_YERPN      -------IRVLCVDDSALMRQLMTEIINSHPDMEMV---AAAQDPLVARDLPQVLTLDVEMPRMDGLDFL
CHEB_YERPE      -------IRVLCVDDSALMRQLMTEIINSHPDMEMV---AAAQDPLVARDLPQVLTLDVEMPRMDGLDFL
CHEB_YERPA      -------IRVLCVDDSALMRQLMTEIINSHPDMEMV---AAAQDPLVARDLPQVLTLDVEMPRMDGLDFL
ARR11_ARATH     ------GLRVLVVDDDPTWLKILEKMLKKCSYEVTTCGXXXXXXXXXXXXKDGIVISDVNMPDMDGFKLL
AGMR_PSEAE      --------KILIADDHPLFREAIHNVIAFPGSEVMETADLDSALGLTQEHXXXXXXXXXNMPGMHGLNGL
Y4021_VIBPA     ---MNTGFTAIIADDEPLLRHHLDKSLELD--IVAKVADGEQALLAIEQSQPDIAFLDIRMPVLDGMSLA
PLED_CAUCR      --------RILVVDDEANVRLLEAK-LTAEYYEVSTAMDGPTALAMAARDLPDIILLDVMMPGMDGFTVC
CTRA_OCHA4      -------MRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVL
CTRA_BRUSU      -------MRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVL
CTRA_BRUSI      -------MRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVL
CTRA_BRUO2      -------MRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVL
CTRA_BRUME      -------MRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVL
CTRA_BRUC2      -------MRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVL
CTRA_BRUAB      -------MRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVL
CTRA_BRUA2      -------MRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVL
CTRA_BRUA1      -------MRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGXXXXXXXXXXXXXXXXXXXXMSGYEVL
CHEB_YERPS      -------VRVLCVDDSALMRQLMTEIINSHPDMEMV---AAAQDPLVARDLPQVLTLDVEMPRMDGLDFL
CHEB1_BURTA     ---MQKKIKVLCVDDSALIRSLMTEDMEVCATAPDPLVARELIKQHN----PDVLTLDVEMPRMDGLDFL
CHEB1_BURP1     ---MQKKIKVLCVDDSALIRSLMTEDMEVCATAPDPLVARELIKQHN----PDVLTLDVEMPRMDGLDFL
CHEB1_BURMA     ---MQKKIKVLCVDDSALIRSLMTEDMEVCATAPDPLVARELIKQHN----PDVLTLDVEMPRMDGLDFL
YSO1_PLEBO      ---------ILVVDDDPDTRDLLRFMLEDEGAIVTVAPNAKEAXXXXXXXXXXXXVSDVAMPEMDGFELI
TORR_ECO57      ---------IVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQPVDLILLDINLPDENGLMLT
RCSC_ECOLI      -VSDNDDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLT
PRR95_ORYSJ     -------VRVLLAEGDDSTRHIICALLRKCGYRVAAASDGVKAWDILKEKSFNIVLTEVELPLMSGFLLL
PDTAR_MYCTU     --------RVLIAEDEALIRMDLAEMLREEGYEIVGAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAA
GACA_PSEAE      -------IKVLVVDDHDLVRTGITRMLDIEGLQVVGQADCGEDCLKLARELPDVVLMDVKMPGIGGLEAT
CHEB_THIDA      -------IKVLIVDDSALIRGVMREDMEVVGVA----PDPIAARELIKQTNPDVLTLDVEMPKMDGLEFL
CHEB_BORPE      -------IKVLCVDDSALVRGLMTEIINSPDMEVVATPDPLVARELIKKHNPDVLTLDVEMPRMDGLDFL
CHEB_BORPA      -------IKVLCVDDSALVRGLMTEIINSPDMEVVATPDPLVARELIKKHNPDVLTLDVEMPRMDGLDFL
CHEB_BORBR      -------IKVLCVDDSALVRGLMTEIINSPDMEVVATPDPLVARELIKKHNPDVLTLDVEMPRMDGLDFL
CHEB2_RHORT     -------IRVLIVDDSASVRQTMTEILESPGIEVITAPDPYVAARRIQQEVPDVITLDVEMPRMDGITFL
CHLD_TOBAC      ----------------------------------------------------------------------
CHEB_SALRD      -------IRVLVVDDSLVMRKAISRIFEXXXXXXXXXXNGEAGVEKARRLEPDVVTMDVEMPKMNGIEAV
CHEB2_XANC8     -MTLETPVRVLIVDDSAVVRQMLTEILSRPGIEVVG----SAADPLLAREKPDVITLDVEMPRMDGLVFL
CHEB1_XANCP     -MTLETPVRVLIVDDSAVVRQMLTEILSRPGIEVVG----SAADPLLAREKPDVITLDVEMPRMDGLVFL
ARR18_ARATH     ------GMRVLAVDDNPTXXXXXXXXXXXXXYHVTKTMESRKALEMLNSNMFDLVISDVEMPDTDGFKLL
YCCH_BACSU      -VGLVDDYRVDLEKLEAIVSRM--QDVEI----VFSTDSAKEAYRRVKNGDIDLLLADIEMPHMSGYELA
REGA_RHOSU      ----EDPSLLIVDDDEPFLRRL-ARAMEKRGFQPEMAETVAAGKAIASARPPAYAVVDLRLEDGTGLDVV
PILG_PSEAE      MEQQSDGLKVMVIDDSKTIRRTAETLLKKVGCDVITAIDGFDALAKIADTHPNIIFVDIRLDGYQTCALI
CHEB_TREDE      -----EDIRVLIVDDSALMRNLIGKIVDATPGLKIAAMNGRFALQKLERVAPDVIVLDLEMPEMNGIEFL
CHEB2_ACIBL     -------IRVLVVDDSALMRKMITQMLQKPAIEVIGTAMDGAGLKKIEELRPDVVTLDLEMPNMDGMEML
CHEB1_RALME     -------IKVLCVDDSALIRSLMSEDMEVVGTA----PDPLVARDLIKRVNPDVLTLDVEMPRMDGLDFL
VIRG_AGRT9      ---------VLLVDDDVAMRHLIIEYLTIHAFKVTAVADSTQFTRVLSSATXXXXXXXLNLGREDGLEIV
RCSC_SALTY      -----DDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNAIDIVLSDVNMPNMDGYRLT
RCSC_SALTI      -----DDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNAIDIVLSDVNMPNMDGYRLT
PRRA_MYCTU      ------------------------RGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVV
PRRA_MYCBO      ------------------------RGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVV
LYTR_STAS1      -------MRAIIVDDEPLARNELHYLLNQINHKIDKAENVSETLEXXXXXXXXVIFLDINLMDESGLDLA
CHEB_CHRSD      -------IKVLCVDDSALIRDLMSKIIDSQPDMVATAPDPLVARDLIKRTNPDVLTLDVEMPRMDGLDFL
CHEB_BURXL      -------IKVLCVDDSALIRSLMTEIINQPDMTVVATPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFL
CHEB_BACHD      ---MESRIKVLVVDDSAFMRKVITSMLESPRLEVVGTANGEDALKKRKTLAPDVMTLDVEMPVMDGIETL
CHEB2_SHESM     -------IKVLVVDDSALIRNLLGQMIEADSELSLVGMAADAYMAKVNQHRPDVITLDIEMPKVDGLTFL
CHEB2_RALEJ     -------IKVLCVDDSALIRSLMTEDMEVVGTA----PDPLVAREMIKQLNPDVLTLDVEMPRMDGLDFL
ARLR_STAHJ      ---------ILIVEDEQNLARFLELELTHDNYSVDIEYEGQAGLDKALSNNYDLIILDLMLPNINGLEIC
TRPO_PSEAE      --------KVLIVDDHPAIRLAVRLLFERDGFTIVGADNGAEALQVARKKSPDLAILDIGIPKIDGLEVI
LONH_HALSA      ----------------------------------------------------------------------
GACA_PSEU2      -------IKVLVVDDHDLVRTGITRMLDIDGLQVVGADSGEESLKKARELKPDVVLMDVKMPGIGGLEAT
DCUR_SHIFL      -------INVLIIDDDAMVAELNRRYVQIPGFQCCGTASTKAKEIIFNSDAPDLILLDIYMQKENGLDLL
DCUR_ECOLI      -------INVLIIDDDAMVAELNRRYVQIPGFQCCGTASTKAKEIIFNSDTPDLILLDIYMQKENGLDLL
DCUR_ECOL6      -------INVLIIDDDAMVAELNRRYVQIPGFQCCGTASTKAKEIIFNSDTPDLILLDIYMQKENGLDLL
DCUR_ECO57      -------INVLIIDDDAMVAELNRRYVQIPGFQCCGTASTKAKEIIFNSDTPDLILLDIYMQKENGLDLL
CQSS_VIBHB      ---------IMVVDDNESLRKFTAMLLEKQGFEVIQTEDGLQAINALNENNVDLILMDIEMPVMDGVEAS
CHEB1_DESVH     --------RVLIVDDSALVRQTLADLLSAPGIEVVGTASDPVAAKRMEAVVPDVILLDIEMPRMDGLTFL
CHEB1_CHRVO     ---------VLIVDDSAVVREVLSQMLSSADIEVLAAPDPIFAMTRMKQRWPDVIVLDIEMPRMDGLTFL
CHEB1_BURCA     -------IKVLCVDDSALIRSLMTEIINSQDMTVVATPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFL
APRR7_ARATH     -------IRVLLVENDDCTRYIVTALLRNCSYEVVEASNGIQAWKVLEDNHIDIVLTEVIMPYLSGIGLL
Y3287_YERPE     -------LRVIIVDDEQPAREDLRERLEEHGIEIVACSNALEAIPAIQRLQPDVVFLDIQMPRINGLELA
PRRA_MYCLE      ------------------------RGLRLSGFEVSTAIDGAEALRNATETRPDAIVLDINMPVLDGVSVV
PHYR_METEA      -LAADMATEILIIEDEPLIAMDLEALVEGLGHNVIGVARTRTEAVKIASESPGLILADIQLAGSSGLDAV
PCOR_ECOLX      --------RILIVEDEQKTGRYLQQGLVEEGYQADLFNNGRDGLGAASKGQYDLIILDVMLPFLDGWQII
CPXR_SHIFL      --------KILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQAXXXXXXXXXXXXXX-VMMPKKNGIDTL
CPXR_ECOLI      --------KILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQAXXXXXXXXXXXXXX-VMMPKKNGIDTL
CPXR_ECO57      --------KILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQAXXXXXXXXXXXXXX-VMMPKKNGIDTL
CHEB_NOCSJ      ------GIRVLVVDDSVVIRKLVSDDIEVVGTAV----NGRAALQKVAQLRPDLVTMDIEMPEMDGIESV
CHEB3_BURS3     MTAVQK-IKVLCVDDSALIRSLMTEIINSQDMTVCATPDPLVARELIKQHNPDVLTLDVEMPRMDGLDFL
BVGA_BORPE      --------KVLIIDDHPVLRFAVRVLMEKEGFEVIGTDNGIDGLKIAREKIPNLVVLDIGIPKLDGLEVI
BVGA_BORPA      --------KVLIIDDHPVLRFAVRVLMEKEGFEVIGTDNGIDGLKIAREKIPNLVVLDIGIPKLDGLEVI
BVGA_BORBR      --------KVLIIDDHPVLRFAVRVLMEKEGFEVIGTDNGIDGLKIAREKIPNLVVLDIGIPKLDGLEVI
ARR10_ARATH     ------GMRVLAVDDDQTCLRILQTLLQRCQYHVTTTNQAQTALELLRENKNDLVISDVDMPDMDGFKLL
RSTA_ECOLI      ---------IVFVEDDAEVGSLIAAYLAKHDMQVTVEPRGDQAEETILRENPDLVLLDIMLPGKDGMTIC
MTRA_MYCTU      --------RILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAXXXXXXXXXXXXXXXXXXNGIDVC
MTRA_MYCPA      --------RILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAXXXXXXXXXXXXXXXXXXNGIDVC
MTRA_MYCLE      --------RILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAXXXXXXXXXXXXXXXXXXNGIDVC
MTRA_MYCBO      --------RILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAXXXXXXXXXXXXXXXXXXNGIDVC
LOVHK_PSEU2     --------RILIVEDRPDVAELAKMVLDDYGYSEIVLNAREALKRFEAGATYDLLFTDLIMPGGNGVMLA
LOVHK_PSE14     --------RILIVEDRPDVAELAKMVLDDYGYICIVLNAREALKKFESGSRYDLLFTDLIMPGGNGVMLA
GTCR_ANEMI      ---------ILIADDEPEIIELLKLFLERESYRIIEAYDGEQAWNYIRQHPVDLAIIDIMMPALDGFQLI
CLPB_STRAL      ----------------------------------------------------------------------
CHEB_PYRKO      -------IRVMVVDDSAFMRRILRDILESDPDIEVCCEARDGAIEKVKTEKPDVITLDIEMPRMNGLDAL
CHEB_PHOLL      -------ITVLCVDDSALMRQIMREIINSSDMEVVACPDPLVARDLIKKHNPQVLTLDVEMPRMDGIDFL
CHEB_OCEIH      ---------------------------------------------------PDVVTLDVHMPKMDGMQAL
BCER_BACSU      --------KLLLIEDDESLFHEIKDRLTGWSYDVYGIQDFSQVLQEFAAVNPDCVIIDVQLPKFDGFHWC
ARLR_STAAW      --------QILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEIC
ARLR_STAAS      --------QILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEIC
ARLR_STAAR      --------QILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEIC
ARLR_STAAN      --------QILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEIC
ARLR_STAAM      --------QILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEIC
ARLR_STAAC      --------QILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEIC
ARLR_STAAB      --------QILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEIC
ARLR_STAA8      --------QILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEIC
ARLR_STAA3      --------QILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDLIILDLMLPSINGLEIC
APRR1_ARATH     -------VRILLCDNDSTSLGEVFTLLSECSYQVTAVKSARQVIDALNAEGPDIILAEIDLPMAKGMKML
CLPB_MYCPE      ----------------------------------------------------------------------
CHEB3_MAGSA     ---------------------------------------------------PGLVTMDLEMPEMGGLEAI
CHEB2_SHESR     -------IKVLVVDDSALIRNLLGKMIEADSELSLVGMAADAYMAKVNQHRPDVITLDIEMPKVDGLTFL
CHEB2_RHIL3     ---MAKKIRVLIIDDSASIRQTLTHVLEQPDIEIMAVASDPMAARKLQEEIPDVITLDVEMPRMDGITFL
CHEB1_GEOMG     -------IKVLIVDDSALIRSLLTDDMEVVGVA----PDPLVAREKIKALNPDVLTLDVEMPRMDGLVFL
BAER_ECOLI      --------RILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTXXXXXXXXXXXXXXXGLTLC
BAER_ECOL6      --------RILIVEDEPKLGQLLIDYLRAASYAPTLISHGDQVLPYVRQTXXXXXXXXXXXXXXXGLTLC
ARLR_STAS1      --------KILIVEDEQNLARFIELELEHENYDVDIEYDGKPGLEKALSNTYDLILLDLMLPNINGLEIC
YYCF_BACSU      --------KILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVC
RPFG_XANC8      ------GLNIVIVDDQMSARTMLRHVIEAPELKVYDFGDPLDALSWCEAGRVDLLLLDYRMPGMDGLEFA
NARP_ECOLI      --------QVMIVDDHPLMRRGVRQLLELPGSEVVAEAGDGASAIDLANRLDDVILLDLNMKGMSGLDTL
DHKC_DICDI      --------KIMILDDNPVSLKLMQRILESRGFECYPFDCSEKAVAQLDQVNPAIIFMDCEMPKMNGFECT
CSSR_BACSU      --------------------------LENEGWNITSFTKGEDARKKMTPS-PHLWILDIMLPDTDGYTLI
CPXR_HAEIN      --------KLLLVDDDIXXXXXXXXXXXXXGFDVETANNGLEALQKLNESYKLVLL-DVMMPKLNGIETL
CHEY_SALTY      -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELL
CHEY_SALTI      -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELL
CHEB_TRIEI      -------------------------------------PSGQIALAKIPQVNPDLIILDVEMPEIDGLETL
ARR15_ARATH     -------LHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYXXXXXXNLIVTDYSMPGLTGYELL
YVCP_BACSU      --------RILLVEDDERIASLLGGHLQKYGYEVKIAEQLNDIKLEFAEMKPDLVLLDINLPFFDGFYWC
PRR73_ORYSJ     -------LRVLLVENDDSTRQVVSALLRKCCYEVIPAENGLHAWQCLEQNHIDLVLTEVVMPRLSGIGLL
PRR73_ORYSI     -------LRVLLVENDDSTRQVVSALLRKCCYEVIPAENGLHAWQCLEQNHIDLVLTEVVMPRLSGIGLL
CHEY_SHIFL      -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
CHEY_ECOLI      -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
CHEY_ECO57      -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
CHEB_THETN      ---MKKKIRVLVVDDSAFMRRCLKDILENEDMEVIARDGNEAVKKAVELR-PDVITLDINMPVMDGLTAL
CHEB3_VIBCH     -------MKILVVDDSALMRTTISDILQ-------NIPNAEIKTARDGMDAPDVMTLDINMPNMDGLTCL
MAK3_SCHPO      ------GSKILIAEDNPIVRMTLKKQLEHLGMDVDAAEDGKETLQIFESNYYQVCFVDYHMPVYDGLEVT
LYTT_BACAN      -------LKVLVVDDEMLARDELKYLLERTKEVEIIADCVEDALEELMKNKPDIVFLDIQLSDDNGFEIA
CLPB1_STRAW     ----------------------------------------------------------------------
CHEY_ECOL6      -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGLDALNKLQAGGYGFVISDWNMPNMDGLELL
CHEY_CAMJJ      -----------------------------------------------------VLITDWNMPEMNGLELV
CHEY_CAMJE      -----------------------------------------------------VLITDWNMPEMNGLELV
CHEY_CAMJ8      -----------------------------------------------------VLITDWNMPEMNGLELV
CHEB3_BURTA     -------IRVLVIDDSATMRILLKKLIDKNEHMVGVAPNPVAAQELLRETRPDVITLDIEMPKMNGLDFL
YXJL_BACSU      ----KDKIRVALADDQPLVREGFRYVINAQTDMTV---SGEAGDGHAKQTKPDVILMDVQMPRCSGIEAA
YCBL_BACSU      ----------MLVEDDHSISEMVDHYLTKEGFGIVHAFDGEEGIRLFQQGSYDLVLLDIMLPKLNGMDFL
SKN7_YEAST      -VTLRKGFHVLLVEDDAVSIQLCSKFLRKYGCTVQVVSDGLSAISTLEKYRYDLVLMDIVMPNLDGATAT
LYTT_BACCR      -------LKVLVVDDEMLARDELKYLLERTKEVEIIADCVEDALEELMQSRPDIVFLDIQLSDDNGFEIA
LON2_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      -------LRVLLVDDSPIARATEGALVKALGHSVEEAQDGEEAYVKVQNNTYDLILTDVQMPKLDGFSLA
CHEY_YERPE      -------LRFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLRAGGFDFVVSDWNMPNMDGLDLL
CHEB2_DESDG     -------IKVLIVDDSALVRQTLTDELEVVG----TASDPFVAVKRMETVVPDVILLDVAMPRMDGLTFL
CHEB2_CAUCR     -------MRVMIVDDSAVVRGMVTRWLEEAGFIIAAIADGGQALRKLADTSVDVCLLDIEMPVMSGLEXX
ARR12_ARATH     ------GMRVLAVDDDQTCLKILESLLRHCQYHVTTTNQAQKALELLRENKNDLVISDVDMPDMDGFKLL
Y165_STAES      --------KVVICDDERIIRQGLKQMIPWKEYHFTTIYTATEALSLIRQHQPELVITDIRMPRKNGVDLL
VIRG_RHIRD      ---------VLLVDDDVAMRHLIIEYLTIHAFKVTAVADSTQFTRVLSSATXXXXXXXXXXXREDGLEIV
PRR1_SCHPO      --------RILLVEDDELSRRMTIKFLTSFDCQVDVAVDGIGAVNKANAGGFDLILMDFILPNLDGLSVT
LYTR_STAES      -------MKALIVDDEPLARNELQYLLNLXXXXXXXXXXXXXTLEKLLYNTFDLIFLDINLMDESGIDLA
LYTR_STAEQ      -------MKALIVDDEPLARNELQYLLNLXXXXXXXXXXXXXTLEKLLYNTFDLIFLDINLMDESGIDLA
LUXN_VIBHB      ---------VLIVDDKEVQRALVQMYLNQLGVNSLQANNGENAVEVFKANHVDLILMDVQMPVMNGFDAS
LUXN_VIBHA      ---------VLIVDDKEVQRALVQMYLNQLGVNSLQANNGENAVEVFKANHVDLILMDVQMPVMNGFDAS
CLPC_MYCTU      ----------------------------------------------------------------------
CLPC_MYCLE      ----------------------------------------------------------------------
CLPC_MYCBO      ----------------------------------------------------------------------
CHEB_PYRAB      -------IRVLVVDDSAFMRKVLKDELEVCGEARDGIEAIEMVQKCR----PDVVTLDVEMPRMNGLDAL
CHEB5_ANADE     -------VRVLVVDDSALVRETLAAVLASPGIEVIAAGDPYAAVERMRRQAPDVITLDIEMPRMDGLTFL
CHEB2_SYNWW     -------IKTLIVDDSLLFRETLARAIEVVATAVDAFMARDMIIKYK----PDVMTLDVEMPRMSGIEFL
CHEB2_METMA     -------IRALIVDDSALIRKVLSDILNQPKIAVIGTANGEDGLEKVRKLKPDVVLLDNIMPVLDGLKTL
CHEB2_GEOMG     -------IRVVVIDDSAFNRRAIIKMLESMPEVVVAANDGEEGIRKVIDLKPDLVTLDLEMPKMDGFTLL
CHEB2_CARHZ     -------IRVLIVDDSALMRKYLREILEQPEIEVIAVANGREAVEKALELSPDVITMDINMPEMDGLTAI
CHEB1_RHOFD     -------IRVVVVDDSALVRSLLAEDMECVGTANDPLIAREM----IRELNPDVLTLDIEMPRMDGIDFL
CHEB1_HAHCH     --------KVLVVDDSALMRKILVEILNQSPCLEVVDTAGDPARDKIKALSPDVITLDVEMPRMDGLTFL
CCDB_BACSU      --------RVLVVDDAKFMRVKIREILEEANYXXXXXXXXXXXXXXLYKKLPDLVTMDITMPVKNGIKAL
ARR21_ARATH     -------INVMVVDDDHVFLDIMSRMLQHSKYRVIAVDDPKKALSTLKIDNIDLIITDYYMPGMNGLQLK


                         .         .         *         .         .         .         .:140
query           QHCRNAAPGVPVILVTGHGDITMAVQAMREGAYDFIEKPFGADXXXXXXXXXXXXXXXXXXXXXXXXXXX
DCTD_RHIME      RKILALDPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAEEKRRLVMENXXXXXXXX
DCTD_RHILE      ATLQGMDVDLPVILMTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSVRRASEKRRLVLENRMLRKAAE
ALGB_PSEAE      AQMRVQAPWMRVVIVTAHSAVDTAVDAMQAGAVDYLVKPCSPDQLRLAAAKQLEVRQLTARLEALEDEVR
NTRC_KLEPN      KQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVDRAISHYQEQQQPRNAPIN--
NTRC_ECOLI      KQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQEQQQPRNVQLN--
NTRC_ECO57      KQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQEQQQPRNVQLN--
NTRC_SALTY      KQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQEQQQPRNIEVN--
ALGB_PSEPK      AQMRIQAPWMRVVIVTAHSAIDTAVDAIQAGAADYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEIR
ALGB_PSESM      AQMRIQAPWMRVVIVTAHSAVDTAVDAIQAGAADYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEVR
ATOC_ECOLI      KEMRSHETRTPVILMXXXXXXXXXXXXLRCGAFDYVIKPFDLDELNLIVQRALQLQSMKKEIRHLHQALS
NTRC_PROVU      KIIKEQYPTLPVIIMTAHSDLDAAVNAYQQGAFDYLPKPFDIDETLALIERAITHYREQKQPNNAENILQ
NTRC_AZOBR      PRIKKIRPDLRIIVMSAQNTLITAVKAAERGAFEYLPKPFDLKELVSVVERALNSNTPPAALPADAGEAD
YFHA_ECOLI      AEIQKVQPGMPVIILTAHGSIPDAVAATQQGVFSFLTKPVDKDALYQAIDDALEQS--------------
YFHA_ECO57      AEIQKVQPGMPVIILTAHGSIPDAVAATQQGVFSFLTKPVDKDALYQAIDDALEQS--------------
ZRAR_SALTY      KEIKALNPAIPILIMTAFSSVETAVEALKAGALDYLIKPLDFDRLQETLEKALAHTRETGAELPS-----
ZRAR_SALTI      KEIKALNPAIPILIMTAFSSVETAVEALKAGALDYLIKPLDFDRLQETLEKALAHTRETGAELPS-----
ZRAR_ECOLI      KEIKALNPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKALAHTHSIDAETPAVT---
NTRC_BRASR      PRIKKMRPNLPVIVMSAQNTFMTAIRPSERGAYEYLPKPFDLKELITIVGRALAEPKERVSSPADD----
ZRAR_ECO57      KEIKALNPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKALAHTHIIDAETPAVT---
NTRC_RHIME      PRIKKARPDLPVLVMSAQNTFMTAIKASEKGAYDYLPKPFDLTELIGIIGRALAEPKRRPSKLEDDSQD-
NTRC_AZOC5      PRIKKARPDLPVIVMSAQNTFMTAIRASERGAYEYLPKPFDLKELISIVGRXXXXXXXXXXXXXGSDEQE
ZRAR_KLEOX      KEIKTFNPSIPVLIMTAYSSVDTAVEALKSGALDYLIKPLDFDKLQLTLSEALAHTRLSESPVTET----
PILR_PSEAE      QYIQQRHPQTPVAMITAYGSLDTAIQALKAGAFDFLTKPVDLGRLRELVATALRLRNPEAEEAP------
NTRX_AZOC5      DIIKREHPEVPVVMISGHGNIETAVAAIKRGAYDFIEKPFNADRLVVITXXXXXXXXXXXXXXXXKQLTQ
STC_CLOBE       ----------------------------------------------------------------------
HOXA_RALEH      KEVRERWPEIVRIVISGYTDSEDIIAGVNEGIYQYILKPWVPDHLIDTVRQAVEAQGLQGDMHRLDLELR
HRPR_PSESY      ----------------------------------------------------------------------
NORR_ENT38      ----------------------------------------------------------------------
WTSA_ERWST      ----------------------------------------------------------------------
LUXO_VIBPA      HAVKKSHPDVPIIFMTAHGSIDTAVEAMRHGSQDFLIKPCEADRLRVTVNNAIRKATKLKNEADNP----
HRPS_PSESY      ----------------------------------------------------------------------
FHLA_SALTY      ----------------------------------------------------------------------
NIFA_AZOVI      ----------------------------------------------------------------------
LUXO_VIBHB      HAVKKSHPDVPIIFMTAHGSIDTAVEAMRHGSQDFLIKPCEADRLRVTVNNAIRKATKLKNEADNP----
LUXO_VIBHA      HAVKKSHPDVPIIFMTAHGSIDTAVEAMRHGSQDFLIKPCEADRLRVTVNNAIRKATKLKNEADNP----
YGEV_ECOLI      ----------------------------------------------------------------------
NORR_SALPC      ----------------------------------------------------------------------
NORR_KLEP7      ----------------------------------------------------------------------
FHLA_ECOLI      ----------------------------------------------------------------------
NORR_SALTY      ----------------------------------------------------------------------
NORR_SALSV      ----------------------------------------------------------------------
NORR_SALNS      ----------------------------------------------------------------------
NORR_SALA4      ----------------------------------------------------------------------
NORR_ECOLI      ----------------------------------------------------------------------
NORR_ECODH      ----------------------------------------------------------------------
NORR_ECOBW      ----------------------------------------------------------------------
NORR_CITK8      ----------------------------------------------------------------------
VNFA_AZOVI      ----------------------------------------------------------------------
NORR_SHIFL      ----------------------------------------------------------------------
NORR_SHIF8      ----------------------------------------------------------------------
NORR_SHIDS      ----------------------------------------------------------------------
NORR_SALTI      ----------------------------------------------------------------------
NORR_SALPB      ----------------------------------------------------------------------
NORR_SALPA      ----------------------------------------------------------------------
NORR_SALG2      ----------------------------------------------------------------------
NORR_SALEP      ----------------------------------------------------------------------
NORR_SALDC      ----------------------------------------------------------------------
NORR_SALCH      ----------------------------------------------------------------------
NORR_ECO5E      ----------------------------------------------------------------------
NORR_ECO57      ----------------------------------------------------------------------
NIFA_ENTAG      ----------------------------------------------------------------------
NORR_SALAR      ----------------------------------------------------------------------
NORR_SALHS      ----------------------------------------------------------------------
NORR_KLEP3      ----------------------------------------------------------------------
PSPF_ECOLI      ----------------------------------------------------------------------
NORR_ECOSM      ----------------------------------------------------------------------
ANFA_AZOVI      ----------------------------------------------------------------------
NORR_ESCF3      ----------------------------------------------------------------------
NORR_ECOSE      ----------------------------------------------------------------------
NORR_ECO24      ----------------------------------------------------------------------
NORR_ECOUT      ----------------------------------------------------------------------
NORR_ECOLU      ----------------------------------------------------------------------
NORR_ECOL6      ----------------------------------------------------------------------
NORR_ECOL5      ----------------------------------------------------------------------
NORR_ECOK1      ----------------------------------------------------------------------
NORR_ECO8A      ----------------------------------------------------------------------
NORR_ECO81      ----------------------------------------------------------------------
NORR_ECO45      ----------------------------------------------------------------------
NORR_ECO27      ----------------------------------------------------------------------
NORR2_RALEH     ----------------------------------------------------------------------
NORR_SHISS      ----------------------------------------------------------------------
NORR_SHIBS      ----------------------------------------------------------------------
NORR_ECOLC      ----------------------------------------------------------------------
NORR_ECOHS      ----------------------------------------------------------------------
NORR_ECO55      ----------------------------------------------------------------------
HRPS_PSESH      ----------------------------------------------------------------------
FLBD_CAUCR      ---------VPVVACGVDADPMRAANAIKAGAKEFIPLPPDAELIAAVLAAVTDDEKP------------
XYLR_PSEPU      ----------------------------------------------------------------------
NIFA_HERSE      ----------------------------------------------------------------------
LUXO_VIBVY      HAVKASHPDVPIIFMTAHGSIDTAVEAMRHGSQDFLIKPCEADRLRVTVNNAIRKASKLKND--------
LUXO_VIBVU      HAVKASHPDVPIIFMTAHGSIDTAVEAMRHGSQDFLIKPCEADRLRVTVNNAIRKASKLKND--------
NORR_ECO7I      ----------------------------------------------------------------------
NORR_ERWCT      ----------------------------------------------------------------------
PRPR_SALTY      ----------------------------------------------------------------------
NORR_AERHH      ----------------------------------------------------------------------
HYFR_ECOLI      ----------------------------------------------------------------------
PRPR_ECOLI      ----------------------------------------------------------------------
TYRR_ENTAG      ----------------------------------------------------------------------
NIFA_RHIEC      ----------------------------------------------------------------------
NIFA_KLEPN      ----------------------------------------------------------------------
NIFA_KLEOX      ----------------------------------------------------------------------
HOXA_BRAJA      KRVRELWPDPVRMIISGYSESEDIIAGLNEGIYQYITKPWQPDQLVETVKEAVQLYRLQKETETAGVDVK
NIFA_RHISN      ----------------------------------------------------------------------
NIFA_AZOBR      ----------------------------------------------------------------------
NIFA_AZOLI      ----------------------------------------------------------------------
LUXO_VIBC3      ----------------------------------------------------------------------
ROCR_BACSU      ----------------------------------------------------------------------
NORR1_RALEH     ----------------------------------------------------------------------
NORR_AERS4      ----------------------------------------------------------------------
ACOR_BACSU      ----------------------------------------------------------------------
NIFA_AZOC5      ----------------------------------------------------------------------
NIFA_RHILT      ----------------------------------------------------------------------
NIFA_RHOCA      ----------------------------------------------------------------------
NIFA_RHILE      ----------------------------------------------------------------------
NORR_SERP5      ----------------------------------------------------------------------
NIFA_BRAJA      ----------------------------------------------------------------------
LUXO_VIBCH      YAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGAQDFLIKPCEADRLRVTVNNAIRKASKLKNDVDNKNQNY
NORR_VIBF1      ----------------------------------------------------------------------
NTRXL_RICCN     EIIKKRYPLMPVIIISGHGTIETAVNAIKMGAYDYIEKPFNNDKLVILLTRACEVTKLKRENIDLKSKVI
NORR_VIBVU      ----------------------------------------------------------------------
TYRR_ECOLI      ----------------------------------------------------------------------
NORR_VIBVY      ----------------------------------------------------------------------
NTRXL_RICPR     EIIKKRYPLMPVIIISGHGTIETAVNAIKMGAYDYIEKPFNNDKLIILLKRACEVTKLKRENIDLKSKVI
TYRR_SALTY      ----------------------------------------------------------------------
TYRR_SALTI      ----------------------------------------------------------------------
NTRXL_RICFE     EIIKKRYPLMPVIIISGHGTIETAVNAIKMGAYDYIEKPFNNDKLVILLKRACEVTKLKRENIDLKSKVI
HUPR_RHOCA      TEVRERWPETVRIIITGYTDSASMMAAINDGIHQFLTKPWHARENERLSLEMRLLNSTSESRVEKRRRAL
NTRXL_RICTY     EIIKKRYPLIPVIIISGHGTIETAVNAIKMGAYDYIEKPFNNDKLIILLKRACEVTKLKRENIDLKSKVI
PGTA_SALTY      TLFHQDDDQLPILLITGHGDVPMAVDAVKKGAWDFLQKPVDPGKLLILIEDALRQRRSVIARRQYCQQ--
TYRR_CITBR      ----------------------------------------------------------------------
YHYA_PSESN      ----------------------------------------------------------------------
ACOR_RALEH      ----------------------------------------------------------------------
NIFA_RHIME      ----------------------------------------------------------------------
YQIR_BACSU      ----------------------------------------------------------------------
NTRXL_RICBR     EVIKKRYPLMPVIIISGHGTIETAVNAIKMGAYDYIEKPFNNDKLVILLKRACEVTKLKRENIDLKSKVI
TYRR_HAEIN      ----------------------------------------------------------------------
NTRC_RHOCA      ARIARERPGLPVIVISAQNTIMTAIQAAEADAYDYLPKPFDLPDLMKXXXXXXXXXXXXQVVPKVIETSR
DHAR_ECOLI      ----------------------------------------------------------------------
DHAR_CITFR      ----------------------------------------------------------------------
RTCR_ECOLI      ----------------------------------------------------------------------
Y4PA_RHISN      ----------------------------------------------------------------------
YPLP_BACSU      ----------------------------------------------------------------------
FIXJ_RHIME      RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPF------------------------------
FIXJ_AZOC5      KELNARGAHMAVIVMTGHGDVPLAVEAMKLGAADFLEKPF------------------------------
FIXJ_BRAJA      KRMKAQQSPFPILIMTGHGDVPLAVEAMKLGAVDFLEKPFEDD---------------------------
NODW_BRAJA      TELARLNIHIPIIFITGHGDIPMTVRAMKGGAVDFLSKPF------------------------------
CSEB_STRCO      RRIRDEST-VPVIMLSARADSIDVVLGLEAGADDYVTKPF------------------------------
LEVR_BACSU      ----------------------------------------------------------------------
CSEB_STRAW      RRIRDEST-VPVIMLSARADSIDVVLGLEAGADDYVTKPF------------------------------
MPRA_MYCPA      RQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
MPRA_MYCA1      RQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
DCTR_RHOCA      DALQARPEGLPVIFLTGHADVPLAVQSLKAGAFDFVEKPF------------------------------
MPRA_MYCBP      RQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
MPRA_MYCBO      RQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
MPRA_MYCVP      RQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
MPRA_MYCTU      RQLRGTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
MPRA_MYCTA      RQLRGTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
PHOB_SHIFL      KHLKSMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
PHOB_SHIDY      KHLKSMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
PHOB_ECOLI      KHLKSMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
PHOB_ECO57      KHLKSMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
MPRA_MYCUA      RQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
MPRA_MYCLE      RQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
ACTR_RHIME      EAIRGRRDDTRMIVLTGYGNIATAVNAVKLGALDYLAKP-------------------------------
YCF27_GALSU     QEIRKESD-IPIIMLTALGDVTDRITGLELGADDYVVKPF------------------------------
PHOB_PSEAE      RRLKELTVDIPIIMLTAKGEEDNKIQGLEVGADDYITKPF------------------------------
PHOB_KLEPN      KLLKREARDIPVVMLTARGEEEDRVRGLETGADDYITKPF------------------------------
ACTR_SINMW      EAIRGRRDDTRMIVLTGYGNIATAVNAVKLGALDYLAKP-------------------------------
REGA_RHOS4      EVLRERRPDCRIVVLTGYGAIATAVAAVKIGATDYLSKPADAN---------------------------
MPRA_MYCS2      RQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
MPRA_MYCSS      RQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
MPRA_MYCSK      RQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
MPRA_MYCSJ      RQLRSTGDDLPILVLTARDSVSERVAGLDAGADDYLPKPF------------------------------
YCF27_GUITH     QEIRKDSD-VPIIMLTALGDVADRITGLELGADDYVVKPF------------------------------
REGA_RHOCA      EALRERRPEARIVVLTGYGAIATAVAAVKMGATDYLSKPADAN---------------------------
OMPR_SHIFL      RRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPF------------------------------
OMPR_SALTY      RRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPF------------------------------
OMPR_SALTI      RRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPF------------------------------
OMPR_ECOLI      RRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPF------------------------------
OMPR_ECOL6      RRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPF------------------------------
OMPR_ECO57      RRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPF------------------------------
PHOP_SALCH      RRWRSSDISLPVLVLTAREGWQDKVEVLSSGADDYVTKPF------------------------------
YCF27_CYAPA     QELRKESD-IPIIMLTALGDVADRITGLELGADDYVVKPF------------------------------
MALR_BACSU      TELRAQNEAVDVIVISAASELDVIKKTLRYGAVDYLIKPF------------------------------
SPHR_SYNE7      RLLRRQGVTVPILMLSAKDTETDRVVGLEIGADDYLTKPFG-----------------------------
YKOG_BACSU      RRLRKTDSQTPVILLTARDSIPDKVTGLDIGANDYVTKPF------------------------------
YCF27_PORAE     QELRKESD-VPIIMLTALSDVSDRITGLELGADDYIVKPF------------------------------
PHOB_RHIME      RRLRQETERLPIIMLTARGEESERVRGLATGADDYVVKPF------------------------------
COPR_PSESM      RRLRTAGQPVPVLFLTARDGVDDRVKGLELGADDYLVKPF------------------------------
CHEB_NATPD      GRIMDECP-TPVLVLSAHADAELTFEAMDEGAVDFFKKPSG-----------------------------
QSEB_HAEIN      QQWRSNHQDVPVLILTARDTLDERVKGLQSGADDYLCKPF------------------------------
HNR_SHIFL       EHIRNRGDQTPVLVISATENMADIAKALRLGVEDVLLKP-------------------------------
HNR_ECOLI       EHIRNRGDQTPVLVISATENMADIAKALRLGVEDVLLKP-------------------------------
HNR_ECO57       EHIRNRGDQTPVLVISATENMADIAKALRLGVEDVLLKP-------------------------------
PHOP_SALTY      RRWRSSDVSLPVLVLTAREGWQDKVEVLSSGADDYVTKPF------------------------------
PHOP_SALTI      RRWRSSDVSLPVLVLTAREGWQDKVEVLSSGADDYVTKPF------------------------------
PHOP_SALPA      RRWRSSDVSLPVLVLTAREGWQDKVEVLSSGADDYVTKPF------------------------------
DLTR_STRA5      KRVREAGLETPIIFLTAKSQTYDKVNGLDLGADDYITKPFEAD---------------------------
DLTR_STRA3      KRVREAGLETPIIFLTAKSQTYDKVNGLDLGADDYITKPFEAD---------------------------
CHEB2_MAGSA     LKIMSRRP-TPIVVVAAQVDLNIAMNALRAGALSVVEKPVG-----------------------------
BASR_SALTY      TRIRQKKYTLPVLILTAHDTLNDRITGLDVGADDYLVKPF------------------------------
SP0F_BACTK      KACKEIDESIKVILMSAYGELDMIQEAKDLGALMHFAKPFDID---------------------------
REGX3_MYCS2     KQLR-ARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSA----------------------------
QSEB_SALTY      REWREKGKQEPVLILTARDALAERVEGLRLGADDYLCKPF------------------------------
QSEB_SALTI      REWREKGKQEPVLILTARDALAERVEGLRLGADDYLCKPF------------------------------
AFSQ1_STRCO     RRIRRTDQ-LPIILLTARNDDIDVVVGLESGADDYVVKP-------------------------------
DCTR_BACME      QQIRANGYKTDVIAVTAASDIETVRKVLQYGAVDYIMKPF------------------------------
CUSR_ECOLI      RMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPF------------------------------
CUSR_ECOL6      RMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPF------------------------------
CUSR_ECO57      RMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPF------------------------------
TCTD_SALTY      QRLRKRGQTLPVLLLTARSAVADRVKGLNVGADDYLPKPF------------------------------
REGX3_MYCTU     KQLR-ARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSA----------------------------
REGX3_MYCBO     KQLR-ARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSA----------------------------
QSEB_ECOLI      REWREKGQREPVLILTARDALAERVEGLRLGADDYLCKPF------------------------------
PHOP_SHIFL      RRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPF------------------------------
PHOP_ECOLI      RRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPF------------------------------
PHOP_ECOL6      RRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPF------------------------------
Y851_SYNP2      RFLRYQGNTIPILVLSAKASETDRVLGLEVGADDYLTKPF------------------------------
QSEB_ECO57      REWREKGQREPVLILTARDALEERVEGLRLGADDYLCKPF------------------------------
CYAB_STIAU      WRLKESSRQVPVIILTANDSEAERVKGLRAGADDYVNK--------------------------------
CTRA_CAUCR      RTLRVAKINTPIMILSGSSEIDTKVKTFAGGADDYMTKPFHKDEMIARIH--------------------
CTRA_CAUCN      RTLRVAKINTPIMILSGSSEIDTKVKTFAGGADDYMTKPFHKDEMIARIH--------------------
CHEY_THEMA      KEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPF------------------------------
BASR_ECOLI      ARIRQKKYTLPVLILTARDTLTDKIAGLDVGADDYLVKPF------------------------------
SILR_SALTY      RMLRSAGKGMPVLLLTALGTIEHRVKGLELGADDYLVKPF------------------------------
RPRY_BACFR      QEVRAANAEIPIIFLTAKTLKEDILEGFKIGADDYITKPFSME---------------------------
LYTR_STAHJ      QKIKKMKQPPHIIFATAHD--TFAVKAFELDAIDYILKPF------------------------------
HSSR_STAHJ      QLLKNDYD-LPVIMLTARDALSDKERAFVSGTDDYVTKPF------------------------------
DCTR_BACHD      KQIREQYIDVDIIAVTAANDTKTIKTLLRYGVMDYLVKPF------------------------------
PHOP_ECO57      CRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPF------------------------------
PHOP_BACSU      KQLRQQKLMFPILMLTAKDEEFDKVLGLELGADDYMTKPF------------------------------
IRLR_BURPS      ERLRRAH-STPVLFLTARDDVGDRVKGLELGADDYVVKPF------------------------------
DHKD_DICDI      EQLRSDEQNIPILLLTAKADENLRIKLLQNGVSDYVNKPFSSE---------------------------
CHEB_DESPS      EHLKDIAPGAVMLSTLTSDGSRMTMKALELGAFDFILKP-------------------------------
YESN_BACSU      KKVSAVSPSVQFIVLSGFGEFEYAKEAMKYGVKHYLLKP-------------------------------
YEDW_ECOLI      QTLRTAKQ-TPVICLTARDSVDDRVRGLDSGANDYLVKPF------------------------------
RCAC_FREDI      KRFRAQGYTVPILLLTAQDNITAKVQGLDAGADDYVVKPF------------------------------
HSSR_STAAE      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
HSSR_STAAC      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
YCF27_PORYE     QELRKESD-VPIIMLTALGEVCDRITGLEIGADDYVVKPF------------------------------
YCF27_PORPU     QELRKESD-VPIIMLTALGEVCDRITGLEIGADDYVVKPF------------------------------
CHEB1_ANADE     DRVMAQDP-VPVVVCSGLAGSEVALHALEHGAVDVIEKP-------------------------------
HSSR_STAAR      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
HSSR_STAAW      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
HSSR_STAAT      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
HSSR_STAAS      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
HSSR_STAAN      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
HSSR_STAAM      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
HSSR_STAA9      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
HSSR_STAA8      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
HSSR_STAA3      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
HSSR_STAA2      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
HSSR_STAA1      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
CHEY_LISMO      AQIMAKDPSAKVIMCSAMGQQGMVVDAIKKGAKDFIVKPFQAD---------------------------
CHEY_LISIN      AQIMAKDPSAKVIMCSAMGQQGMVVDAIKKGAKDFIVKPFQAD---------------------------
CHEY_BACSU      KEIKQIDAQARIIMCSAMGQQSMVIDAIQAGAKDFIVKPFQAD---------------------------
HSSR_STAS1      KILKEDF-DIPVIMLTARDALSDKEQAYLTGTDDYVTKPF------------------------------
CHEB2_RHOS4     RSYMESAP-VPTVVISSRTSGETAMRAMEAGAVDIISKP-------------------------------
CHEB1_DECAR     ERLMRLRP-MPVVMVSSFTEADTTLKALELGAIDFIGKP-------------------------------
ARR7_ARATH      KKIKESSAEVPVVIMSSENILPRIQECLKEGAEEFLLKP-------------------------------
ALGR_PSEAE      ARCEREAPPA-VIFCTAHDE--FALEAFQVSAVGYLVKP-------------------------------
PFER_PSEAE      ESLRR-EQATPVMLMSALGAEQDRISGFTRGADDYLPKPF------------------------------
CHEB2_RHOSH     RSYMESAP-VPTVVISSRTSGETAMRAMEAGAVDIISKP-------------------------------
ARR6_ARATH      KKIKSAFREVPVVIMSSENILPRIDRCLEEGAEDFLLKP-------------------------------
CREB_ECOLI      RQLLALHPALPVLFLTARSEEVDRLLGLEIGADDYVAKPF------------------------------
YCF27_CYACA     QEIRKES-DIPIIMLTALEDVLDKVTGLELGADDYVIKPF------------------------------
NARP_HAEIN      KGLRAEGVDARILILTAKNDIYTLIDAGADG---------------------------------------
PHOB_HAEIN      QYIKKSYAAIPIIMLTAKSTEEDCIACLNAGADDYITKPF------------------------------
DCTR_BACSU      QEIRKQKLEVDVIVVSAAKDKETISLMLQNGAVDYILKPF------------------------------
CZCR_RALME      KSIRSKSE-TPVLFLTALDDVADRVRGFELGADDYLVKPF------------------------------
YVRH_BACSU      TLIREYS-DAPIFFLTARSSDADKLSGFAVGADDYITKPF------------------------------
CQSS_VIBCH      RLIRNSEKNIPIIGYTGDNSPKTLALVQTSGMNDFIVKPADRD---------------------------
CITB_KLEPN      RHAVSTHYKGRIIFITADNHMETISEALRLGVFDYLIKP-------------------------------
CHVI_RHISN      RRLRQKSD-LPVIFLTSKDEEIDELFGLKMGADDFITKPF------------------------------
CHVI_RHIME      RRLRQKSD-LPVIFLTSKDEEIDELFGLKMGADDFITKPF------------------------------
CHEY_HELPJ      KKVRNRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPF------------------------------
ARR1_ARATH      EHV-GLEMDLPVIMMSADDSKSVVLKGVTHGAVDYLIKP-------------------------------
VIRG_AGRT5      RSLATKSD-VPIIIISGAREEADKVIALELGATDFIAKPFG-----------------------------
VIRG_AGRRH      RTLATKSD-VPMIIISGDREEADKVVALELGATDFIAKPFG-----------------------------
CUTR_STRLI      RKIVELGMPTRVLMLTASGDVSDRVEGLEIGADDYLPKPF------------------------------
CUTR_STRCO      RKIVELGMPTRVLMLTASGDVSDRVEGLEIGADDYLPKPF------------------------------
CHVI_RHIRD      RRLRQKSD-IPVIFLTSKDEEIDELFGLKMGADDFITKPF------------------------------
CHEY_PSEAE      RAVRERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTA----------------------------
CHEB_HALMA      ERIMAESP-TPVLMLSAHTDENADVEALDKGAVDFFTKPGG-----------------------------
CHEB3_RHORT     SRIMATKPK-PVVMVSSLTETEVTLEALALGAVDFIHKPDG-----------------------------
HSSR_STAES      QTLKDDYH-IPVIMLTARDALSDKERAFLSGTDDYVTKPF------------------------------
HSSR_STAEQ      QTLKDDYH-IPVIMLTARDALSDKERAFLSGTDDYVTKPF------------------------------
RESD_BACSU      RQIREKK-ATPIIMLTAKGEEANRVQGFEAGTDDYIVKPF------------------------------
LYTT_BACSU      KRLKKMKHPPAIVFATAYDQ--YALKAFEVDALDYLTKPF------------------------------
HSSR_STAAB      NTLKNDY-DIPVIMLTARDALSDKERAFISGTDDYVTKPF------------------------------
CHEY_HELPY      KKVRSDSKEIPIIMITTEGGKAEVITALKAGVNNYIVKPF------------------------------
CHEB_TREPA      EQRKRLRIDIPVIILSSIAKARVTMQCLELGASDFVTKPFGSE---------------------------
PILH_PSEAE      RQLTKDAEAIPVIIVTTKDQETDKVWGKRQGARDYLTKP-------------------------------
PDE2_DICDI      QRINDVHRHIPVILMSGTADYKYANDTIKIGGQDFLTKPIAKE---------------------------
ARR5_ARATH      KKIKSAFREIPVVIMSSENILPRIDRCLEEGAEDFLLKP-------------------------------
ARR4_ARATH      KKIKESSNEVPVVIMSSENVLTRIDRCLEEGAQDFLLKP-------------------------------
YFIK_BACSU      KLITSSLPSVKVLMLTTFKDSALIAEALEEGASGYLLKDMSAD---------------------------
VANR_ENTFC      QKIRDKHT-YPIIMLTGKDTEVDKITGLTIGADDYITKPF------------------------------
CHEB2_CHRVO     KQLMASRP-TPVVILTQKGDISM--QAMAAGAVEVIAKP-------------------------------
APRR5_ARATH     EHCKN----IPVIMMSTQDSVNTVYKCMLKGAADYLVKP-------------------------------
TORS_ECO57      RQLARQYPSLVLIGFSAH----------------------------------------------------
RSSB_SERMA      IAWRAAGQNIPIIILTARDRIESLVNSLDSGANDFLAKPF------------------------------
GRAR_STAHJ      RKIRQVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
CHEB_ARCFU      KLIMEKQP-TPVVMLSSKEGARETLEALKIGAVDFVTKPDGA----------------------------
CHEB2_RHOCS     PHLLQADPNVKIVMLTAKG-ADISLRALRAGAADYIPKP-------------------------------
CHEB1_MAGSA     PKLLQIDPGLKVIMLTLKG-ADVSLRAMQMGAADYIPKP-------------------------------
ARR3_ARATH      KKIKESTSEVPVVIMSSENVMTRIDRCLEEGAEDFLLKP-------------------------------
SAER_STAAW      KEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPF------------------------------
SAER_STAAS      KEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPF------------------------------
SAER_STAAR      KEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPF------------------------------
SAER_STAAN      KEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPF------------------------------
SAER_STAAM      KEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPF------------------------------
SAER_STAAE      KEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPF------------------------------
SAER_STAAC      KEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPF------------------------------
SAER_STAAB      KEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPF------------------------------
SAER_STAA8      KEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPF------------------------------
SAER_STAA3      KEMKRQKLDIPFIYLTAKTQEHDTIYALTLGADDYVKKPF------------------------------
PRR37_ORYSJ     SRIHNICKNIPVIMMSSNDAMGTVFKCLSKGAVDFLVKP-------------------------------
PRR37_ORYSI     SRIHNICKNIPVIMMSSNDAMGTVFKCLSKGAVDFLVKP-------------------------------
CHEB_THEMA      KLIMKKAP-TRVIMVSSLTEAAITIEALRNGAVDFITKPHGS----------------------------
CHEB_SHISS      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB_SHIFL      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB_SHIBS      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB_SALTY      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB_SALTI      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB_SALPA      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB_SALCH      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB_ECOUT      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB_ECOLI      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB_ECOL6      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB_ECOL5      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB_ECO57      EKLMRLRP-MPVVMVTGKGS-EVTLRALELGAIDFVTKP-------------------------------
CHEB3_LEPIN     KKIMSEKP-TPVIICSSEKESETAVLAMKLGAVDIIEKP-------------------------------
CHEB3_LEPIC     KKIMSEKP-TPVIICSSEKESETAVLAMKLGAVDIIEKP-------------------------------
CHEB3_HAHCH     RRIMEEYP-TPIVVVTASGDAVTAMQVLEAGAITVTPKPQG-----------------------------
ARR2_ARATH      EHV-GLEMDLPVIMMSADDSKSVVLKGVTHGAVDYLIKP-------------------------------
APRR9_ARATH     ALVHEACKNIPVIMMSSQDSIKMVLKCMLRGAADYLIKP-------------------------------
YBDJ_BACSU      AKIKKLGLGIPVIFLSARNDMDSKLQGLQIGE-DYMVKPF------------------------------
RPFC_XANCP      KQLRMQASGMPVVVLS--ADVTEAIRACEQGARAFLAKP-------------------------------
RPFC_XANC8      KQLRMQASGMPVVVLS--ADVTEAIRACEQGARAFLAKP-------------------------------
LYTT_ENTFA      EKLTHLKKAPYLVFATAYDQ--YALKAFQVNAKDYILKPF------------------------------
CHLD_PEA        ----------------------------------------------------------------------
CHEB2_GEOSL     QKIMSQHP-IPVVMLTENGSET-AMKALEYGAVEIIQKP-------------------------------
ARCA_SHIFL      RELREQA-NVALMFLTGRDNEVDKILGLEIGADDYITKPF------------------------------
ARCA_ECOLI      RELREQA-NVALMFLTGRDNEVDKILGLEIGADDYITKPF------------------------------
ARCA_ECOL6      RELREQA-NVALMFLTGRDNEVDKILGLEIGADDYITKPF------------------------------
ARCA_ECO57      RELREQA-NVALMFLTGRDNEVDKILGLEIGADDYITKPF------------------------------
Y4XI_RHISN      RQLRSDGYSVPAVIMSRLDDLEKRISVFNSGADDFLRKPVSTD---------------------------
WALR_STAS1      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAHJ      REVRKKFE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAES      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAEQ      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAAW      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAAU      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAAT      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAAS      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAAR      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAAN      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAAM      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAAE      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAAC      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAAB      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAA9      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAA8      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAA3      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAA2      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
WALR_STAA1      REVRKKYE-MPIIMLTAKDSEIDKVLGLELGADDYVTKPF------------------------------
GRAR_STAES      RKMRQQS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAEQ      RKMRQQS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAAW      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAAT      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAAS      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAAR      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAAN      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAAM      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAAE      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAAC      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAAB      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAA9      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAA8      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAA3      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAA2      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
GRAR_STAA1      RKMREVS-NVPILFLSSRDNPMDQVMSMELGADDYMQKPF------------------------------
CHEB_METFK      ERLMRLRP-MPVVMISSGSEITM--RAMELGAVDFVTKP-------------------------------
CHEB_METBU      KAIMKTTP-IPIIMLTKKGSIE-ALEALRLGAIDFITKPSG-----------------------------
CHEB_ERWCT      EKLMRLRP-MPVVMVTGKGS-EITLRALELGAIDFVTKP-------------------------------
CHEB_ENTCL      EKLMRLRP-MPVVMVTGKGS-EITLRALELGAVDFVTKP-------------------------------
CHEB3_GEOMG     KKIMSQHP-IPVVMLTESGSET-AVKALEYGAVEIIQKP-------------------------------
BCER_BACHD      RMIRQHS-NVPIIFLSSRDHPTDMVMSMQLGADDFIQKPFHFD---------------------------
ARR14_ARATH     QQVGLLEMDLPVIMMSVDGRTTTVMTGINHGACDYLIKP-------------------------------
YXDJ_BACSU      RQIRQHSTS-PIIFISARSGEMDQVMAIENGGDDYIEKPFSYD---------------------------
YRKP_BACSU      QHIRKSS-NVPILFLTARSSTLDKTEGLLAGGDDYMTKPFSEE---------------------------
TORS_ECOLI      RQLAQQYPSLVLIGFSAH----------------------------------------------------
SRRA_STAAW      TKLREHKQ-TPIIMLTAKGEETNRVEGFESGADDYIVKPF------------------------------
SRRA_STAAU      TKLREHKQ-TPIIMLTAKGEETNRVEGFESGADDYIVKPF------------------------------
SRRA_STAAS      TKLREHKQ-TPIIMLTAKGEETNRVEGFESGADDYIVKPF------------------------------
SRRA_STAAR      TKLREHKQ-TPIIMLTAKGEETNRVEGFESGADDYIVKPF------------------------------
SRRA_STAAN      TKLREHKQ-TPIIMLTAKGEETNRVEGFESGADDYIVKPF------------------------------
SRRA_STAAM      TKLREHKQ-TPIIMLTAKGEETNRVEGFESGADDYIVKPF------------------------------
SRRA_STAAC      TKLREHKQ-TPIIMLTAKGEETNRVEGFESGADDYIVKPF------------------------------
SRRA_STAA8      TKLREHKQ-TPIIMLTAKGEETNRVEGFESGADDYIVKPF------------------------------
LOVHK_PSESM     REVRRRYPKVKVLLTTGYAESSIERTDIGGSEFDVVSKP-------------------------------
CHEB2_BORA1     EKLMRLRP-MPVVMVSSGGEITM--RALELGAIDFVTKP-------------------------------
ARR17_ARATH     KKVKESSKEVPVVILSSENIPTRINKCLASGAQMFMQKP-------------------------------
GRAR_STAS1      RKIREVS-NTPILFLSSRDNPMDQVMSMELGADDYVQKPFNTN---------------------------
EHD1_ORYSJ      QEVTSKF-GIPTVIMASSGDTNTVMKYVANGAFDFLLKP-------------------------------
EHD1_ORYSI      QEVTSKF-GIPTVIMASSGDTNTVMKYVANGAFDFLLKP-------------------------------
CHEB_PELCD      RRLMPQYP-LPVVMVSSQKGKQITLDSLDAGAVDFVSKP-------------------------------
CHEB2_XANOR     ENLMRLRP-TPVVMITERGADT-TLQALSLGAVDFVSKP-------------------------------
CHEB2_XANOM     ENLMRLRP-TPVVMITERGADT-TLQALSLGAVDFVSKP-------------------------------
CHEB1_XANC5     ENLMRLRP-TPVVMITERGADT-TLQALSLGAVDFVSKP-------------------------------
CHEB1_XANAC     ENLMRLRP-TPVVMITERGADT-TLQALSLGAVDFVSKP-------------------------------
CHEB1_BURPS     EKLMRLRP-MPVVMVSSERGSEITLRALELGAVDFVTKP-------------------------------
APRR3_ARATH     SKIMSTLKNIPVIMMSSHDSMVLVFKCLSNGAVDFLVKP-------------------------------
VANR_ENTFA      REFR-AQNDTPILMMTALSDDENQIRAFDAEADDYVTKPF------------------------------
TORR_ECOLI      RALRERST-VGIILVTGRSDRIDRIVGLEMGADDYVTKP-------------------------------
REGX3_MYCLE     KQLR-VRSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSA----------------------------
LYTT_OCEIH      KKIRNEFEDKDIIIIFTTAYESYGVQAFEIQATDYLLKPFSEE---------------------------
LYTR_STAAW      AKIQKMKEPPAIIFATAHDQY--AVQAFELNATDYILKPFG-----------------------------
LYTR_STAAS      AKIQKMKEPPAIIFATAHDQY--AVQAFELNATDYILKPFG-----------------------------
LYTR_STAAR      AKIQKMKEPPAIIFATAHDQY--AVQAFELNATDYILKPFG-----------------------------
LYTR_STAAN      AKIQKMKEPPAIIFATAHDQY--AVQAFELNATDYILKPFG-----------------------------
LYTR_STAAM      AKIQKMKEPPAIIFATAHDQY--AVQAFELNATDYILKPFG-----------------------------
LYTR_STAAC      AKIQKMKEPPAIIFATAHDQY--AVQAFELNATDYILKPFG-----------------------------
LYTR_STAAB      AKIQKMKEPPAIIFATAHDQY--AVQAFELNATDYILKPFG-----------------------------
LYTR_STAA8      AKIQKMKEPPAIIFATAHDQY--AVQAFELNATDYILKPFG-----------------------------
LYTR_STAA3      AKIQKMKEPPAIIFATAHDQY--AVQAFELNATDYILKPFG-----------------------------
DPIA_SHIFL      HELVQAHYPGDVVFTTAASDMETVSEAVRCGVFDYLIKP-------------------------------
DPIA_ECOLI      HELVQAHYPGDVVFTTAASDMETVSEAVRCGVFDYLIKP-------------------------------
DPIA_ECOL6      HELVQAHYPGDVVFTTAASDMETVSEAVRCGVFDYLIKP-------------------------------
DPIA_ECO57      HELVQAHYPGDVVFTTAASDMETVSEAVRCGVFDYLIKP-------------------------------
CHEB_YERPN      EKLMRLRP-MPVVMVSSNSEITM--RALELGAIDFVTKP-------------------------------
CHEB_YERPE      EKLMRLRP-MPVVMVSSNSEITM--RALELGAIDFVTKP-------------------------------
CHEB_YERPA      EKLMRLRP-MPVVMVSSNSEITM--RALELGAIDFVTKP-------------------------------
ARR11_ARATH     EHV-GLELDLPVIMMSVDGETSRVMKGVQHGACDYLLKP-------------------------------
AGMR_PSEAE      MNLRNEAPTIPVVIVSAEQDKQVVLQAITYGAVGFITK--------------------------------
Y4021_VIBPA     QKLNRLANPPLIVFVTAYDD--YAIKAFEQNAADYLLKP-------------------------------
PLED_CAUCR      RKLKDTTRHIPVVLITGRGD---RIQGLESGASDFLTKP-------------------------------
CTRA_OCHA4      RTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIH--------------------
CTRA_BRUSU      RTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIH--------------------
CTRA_BRUSI      RTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIH--------------------
CTRA_BRUO2      RTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIH--------------------
CTRA_BRUME      RTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIH--------------------
CTRA_BRUC2      RTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIH--------------------
CTRA_BRUAB      RTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIH--------------------
CTRA_BRUA2      RTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIH--------------------
CTRA_BRUA1      RTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIH--------------------
CHEB_YERPS      EKLMRLRP-MPVVMVSSNSEITM--RALELGAIDFVTKP-------------------------------
CHEB1_BURTA     EKLMRLRP-MPVVMVSSLTESEITLRALELGAVDFVTKP-------------------------------
CHEB1_BURP1     EKLMRLRP-MPVVMVSSLTESEITLRALELGAVDFVTKP-------------------------------
CHEB1_BURMA     EKLMRLRP-MPVVMVSSLTESEITLRALELGAVDFVTKP-------------------------------
YSO1_PLEBO      GRVRELPKGLPAIALTAYAREEDRQAALRSGFNDYLTKP-------------------------------
TORR_ECO57      RALRERST-VGIILVTGRSDRIDRIVGLEMGADDYVTKP-------------------------------
RCSC_ECOLI      QRIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLD---------------------------
PRR95_ORYSJ     STIHDACKNIPVIMMSSNDSVSMVFKCMLKGAADFLVKP-------------------------------
PDTAR_MYCTU     SEIASKRI-APIVVLTAFSQRDLVERARDAGAMAYLVKPF------------------------------
GACA_PSEAE      RKLLRSQPDIKVVVVTVCEEDPFPTRLMQAGAAGYMTKGAGLE---------------------------
CHEB_THIDA      EKLMRLRP-MPVVMVSSGSEITM--RALELGAVDFVTKP-------------------------------
CHEB_BORPE      EKLMRLRP-MPVVMVSSGGEITL--RALELGAIDFVTKP-------------------------------
CHEB_BORPA      EKLMRLRP-MPVVMVSSGGEITL--RALELGAIDFVTKP-------------------------------
CHEB_BORBR      EKLMRLRP-MPVVMVSSGGEITL--RALELGAIDFVTKP-------------------------------
CHEB2_RHORT     RKIMAQRP-IPVVVCSSETDSETASQAWEAGAVEIILKP-------------------------------
CHLD_TOBAC      ----------------------------------------------------------------------
CHEB_SALRD      RHIMEASPR-PILMLSSGAEVTM--EAMRAGAADFLSK--------------------------------
CHEB2_XANC8     ENLMRLRP-TPVVMITERGADT-TLQALSLGAVDFISKP-------------------------------
CHEB1_XANCP     ENLMRLRP-TPVVMITERGADT-TLQALSLGAVDFISKP-------------------------------
ARR18_ARATH     EI--GLEMDLPVIMLSAHSDYDSVMKGIIHGACDYLVKPVG-----------------------------
YCCH_BACSU      DLIKSHSLDVDVIFVTGHGG--YAVHAFDLNVHDYIMKPYYAD---------------------------
REGA_RHOSU      ETLREKRPDAKIVVLXXXXXXXXXXXXXXXXXXDYLSKPADAN---------------------------
PILG_PSEAE      KN-NSAFKSTPVIMLSSKDGLFDKAKGRIVGSDQYLTKPFSKE---------------------------
CHEB_TREDE      RELKKQNIKIPVVILSSIAKAKVTMDCLELGACDFITKPSGSE---------------------------
CHEB2_ACIBL     RHITKRGQ-TPVIVVSAHQGARETFKALQLGAFDFVAKP-------------------------------
CHEB1_RALME     ERLMRLRP-MPVLMVSSGSEITM--RALELGAVDFVTKP-------------------------------
VIRG_AGRT9      RNLA-AKSDIPIIIISGDREETDKVVALELGASDFIAKPF------------------------------
RCSC_SALTY      QRIRQLGLTLPVVGVTANALAEEKQRCLESGMDSCLSKPVTLD---------------------------
RCSC_SALTI      QRIRQLGLTLPVVGVTANALAEEKQRCLESGMDSCLSKPVTLD---------------------------
PRRA_MYCTU      TALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPF------------------------------
PRRA_MYCBO      TALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPF------------------------------
LYTR_STAS1      NKIKKMKHAPFIIFATAHD--TFAVKAFELDAIDYILKPF------------------------------
CHEB_CHRSD      ERLMRLRP-MPVLMVSSGSEITL--RALELGAVDFVAKP-------------------------------
CHEB_BURXL      EKLMRLRP-MPVVMVTERGN-EITLRALELGAVDFVTKP-------------------------------
CHEB_BACHD      KRLMSENP-LPIIIVTTKEGAENALTAMELGAVDFITKPSG-----------------------------
CHEB2_SHESM     DRLMKARPTAVVMILTEEGDATF--NALALGAVDFIPKP-------------------------------
CHEB2_RALEJ     ERLMRLRP-MPVLMVSSGSEITM--RALELGAVDFVTKP-------------------------------
ARLR_STAHJ      RRVRQEQ-STPIIIITAKSDTYDKVTGLDYGADDYIVKPF------------------------------
TRPO_PSEAE      ARLKSLKLDTKVLVLTRQNPAQFAPRCLQAGAMGFVSK--------------------------------
LONH_HALSA      ----------------------------------------------------------------------
GACA_PSEU2      RKMLRSHPDIKVVAVTVCEEDPFPTRLLQAGAAGYMTKGAG-----------------------------
DCUR_SHIFL      PVLHNARCKSDVIVISSAADAATIKDSLHYGVVDYLIKPFQA----------------------------
DCUR_ECOLI      PVLHNARCKSDVIVISSAADAATIKDSLHYGVVDYLIKPFQA----------------------------
DCUR_ECOL6      PVLHNARCKSDVIVISSAADAVTIKDSLHYGVVDYLIKPFQA----------------------------
DCUR_ECO57      PVLHNARCKSDVIVISSAADAATIKDSLHYGVVDYLIKPFQA----------------------------
CQSS_VIBHB      RQIRKAYASVPIIAHTGDSSPITLDKIGSSGMSDFIVKP-------------------------------
CHEB1_DESVH     RKIMTQHP-LPVVIVTEQG-AEATFKAMEYGAVEVITKP-------------------------------
CHEB1_CHRVO     RKIMDERP-TPVIICSSEKGARITLDALAAGAVAIITKP-------------------------------
CHEB1_BURCA     EKLMRLRP-MPVVMVSSLTESEITLRALELGAVDFVTKP-------------------------------
APRR7_ARATH     CKILNSRRNIPVIMMSSHDSMGLVFKCLSKGAVDFLVKP-------------------------------
Y3287_YERPE     SML-NPESMPHIVFVTAYDEY--AIRAFEEHAFDYLLKP-------------------------------
PRRA_MYCLE      TALRAMDNDVPVCVLSARSSVDDRVAGLEAGADDYLVKPF------------------------------
PHYR_METEA      NDLLKTFE-VPVIFITAY----------------------------------------------------
PCOR_ECOLX      SALRESGHEEPVLFLTAKDNVRDKVKGLELGADDYLIKPF------------------------------
CPXR_SHIFL      KALRQTHQ-TPVIMLTARGSELDRVLGLELGADDYLPKPF------------------------------
CPXR_ECOLI      KALRQTHQ-TPVIMLTARGSELDRVLGLELGADDYLPKPF------------------------------
CPXR_ECO57      KALRQTHQ-TPVIMLTARGSELDRVLGLELGADDYLPKPF------------------------------
CHEB_NOCSJ      RAIRATGNKVPIIMLTERGAVA-TLDALGAGASDYVPKP-------------------------------
CHEB3_BURS3     EKLMRLRP-MPVVMVSSLTESEITLRALELGAVDFVTKP-------------------------------
BVGA_BORPE      ARLQSLGLPLRVLVLTGQPPSLFARRCLNSGAAGFVCK--------------------------------
BVGA_BORPA      ARLQSLGLPLRVLVLTGQPPSLFARRCLNSGAAGFVCK--------------------------------
BVGA_BORBR      ARLQSLGLPLRVLVLTGQPPSLFARRCLNSGAAGFVCK--------------------------------
ARR10_ARATH     ELV-GLEMDLPVIMLSAHSDPKYVMKGVKHGACDYLLKP-------------------------------
RSTA_ECOLI      RDLRAKWSG-PIVLLTSLDSDMNHILALEMGACDYILK--------------------------------
MTRA_MYCTU      RVLR-ADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPF------------------------------
MTRA_MYCPA      RVLR-ADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPF------------------------------
MTRA_MYCLE      RVLR-ADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPF------------------------------
MTRA_MYCBO      RVLR-ADSGVPIVMLTAKTDTVDVVLGLESGADDYIMKPF------------------------------
LOVHK_PSEU2     REVRRRFPKVKVLLTTGYAESSIERTDIGGSEFEVVSKP-------------------------------
LOVHK_PSE14     REVRRRYPKIKVLLTTGYAESSIERTDIGGSEFDVVSKP-------------------------------
GTCR_ANEMI      KRLTNEYK-LPVIILSAKNRDSDKILGLGLGADDFISKPF------------------------------
CLPB_STRAL      ----------------------------------------------------------------------
CHEB_PYRKO      KFIMSKYP-TPVIMVSAQEGAEATIKALEYGAIDFIPKP-------------------------------
CHEB_PHOLL      EKLMRLRP-MPVVMITAKGS-EITLRALELGAVDFITKP-------------------------------
CHEB_OCEIH      QRIMNEHP-VPVVMLSSKAGAEKTIQAISNGAVDFIMKPSGS----------------------------
BCER_BACSU      RLIRSRS-NVPILFLSSRDHPADMVMSMQLGADDFIQKPFHFD---------------------------
ARLR_STAAW      RKIRQQQ-STPIIIITAKSDTYDKVAGLDYGADDYIVKPF------------------------------
ARLR_STAAS      RKIRQQQ-STPIIIITAKSDTYDKVAGLDYGADDYIVKPF------------------------------
ARLR_STAAR      RKIRQQQ-STPIIIITAKSDTYDKVAGLDYGADDYIVKPF------------------------------
ARLR_STAAN      RKIRQQQ-STPIIIITAKSDTYDKVAGLDYGADDYIVKPF------------------------------
ARLR_STAAM      RKIRQQQ-STPIIIITAKSDTYDKVAGLDYGADDYIVKPF------------------------------
ARLR_STAAC      RKIRQQQ-STPIIIITAKSDTYDKVAGLDYGADDYIVKPF------------------------------
ARLR_STAAB      RKIRQQQ-STPIIIITAKSDTYDKVAGLDYGADDYIVKPF------------------------------
ARLR_STAA8      RKIRQQQ-STPIIIITAKSDTYDKVAGLDYGADDYIVKPF------------------------------
ARLR_STAA3      RKIRQQQ-STPIIIITAKSDTYDKVAGLDYGADDYIVKPF------------------------------
APRR1_ARATH     RYITRDKDRIPVIMMSRQDEVPVVVKCLKLGAADYLVKP-------------------------------
CLPB_MYCPE      ----------------------------------------------------------------------
CHEB3_MAGSA     EEIM-CSKAVPILVVSGVADAQKAFGAMSRGAVDVVAKP-------------------------------
CHEB2_SHESR     DRLMKARPTAVVMILTEEGDATF--NALALGAVDFIPKP-------------------------------
CHEB2_RHIL3     RKLMSQRP-IPVVMLTEAGSETL-LQALEAGAVDVILK--------------------------------
CHEB1_GEOMG     EKLMRLRP-MPVLMVSSLTEKSLTLRALELGAVDFVTKP-------------------------------
BAER_ECOLI      REIRRFS-DIPIVMVTAKIEEIDRLLGLEIGADDYICKPY------------------------------
BAER_ECOL6      REIRRFS-DIPIVMVTAKIEEIDRLLGLEIGADDYICKPY------------------------------
ARLR_STAS1      RQIRQNQT-TPIIIITAKSDTYDKVAGLDYGADDYIVKPF------------------------------
YYCF_BACSU      REVRKKYD-MPIIMLTAKDSEIDKVIGLEIGADDYVTKPF------------------------------
RPFG_XANC8      RRLRRLPSDIPIILITIVGDEPIRQAALEAGVIDFLVKP-------------------------------
NARP_ECOLI      NALRRDGVTAQIIILTASSDVFALIDAGADG---------------------------------------
DHKC_DICDI      QLIRKLKDRKIIIALTAHINPEIQVKCFDAGMNDFISKPF------------------------------
CSSR_BACSU      KEIKAKDPDVPVIFISARDADIDRVLGLELGSNDYISKPF------------------------------
CPXR_HAEIN      KEIRKVS-NVPVMMLTARGEDIDRVLGLELGADDCLPKPF------------------------------
CHEY_SALTY      KTIRSAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
CHEY_SALTI      KTIRSAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
CHEB_TRIEI      KRIRQTYKQLPVIMITQRGAIA-TLDALTLGANDYITKP-------------------------------
ARR15_ARATH     KKIKSALREIPVVIMSSENIQPRIEQCMIEGAEEFLLKP-------------------------------
YVCP_BACSU      RQIRTIS-NAPIIFISARTDELNQVMAIENGGDDYITKPF------------------------------
PRR73_ORYSJ     SKITSICKDIPVIMMSSNDSMGTVFKCLSKGAVDFLVKP-------------------------------
PRR73_ORYSI     SKITSICKDIPVIMMSSNDSMGTVFKCLSKGAVDFLVKP-------------------------------
CHEY_SHIFL      KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
CHEY_ECOLI      KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
CHEY_ECO57      KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
CHEB_THETN      QYIMSLAP-CPVVIISSEGALT-TFEALELGAVDFVAKPGG-----------------------------
CHEB3_VIBCH     TQIMVERP-LPIVMLSSHEGAITTLEALYLGAVDFVAKPGG-----------------------------
MAK3_SCHPO      RRMRHGCAPLPIFALTADMQPTMETQFQEVGITHYLSKPF------------------------------
LYTT_BACAN      NILKKMKNPPAIVFATAYDQY--ALQAFEVDALDYILKPF------------------------------
CLPB1_STRAW     ----------------------------------------------------------------------
CHEY_ECOL6      KTIRGAMSALPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
CHEY_CAMJJ      KKVRKKYEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPF------------------------------
CHEY_CAMJE      KKVRKKYEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPF------------------------------
CHEY_CAMJ8      KKVRKKYEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPF------------------------------
CHEB3_BURTA     DRIMRLMPVAVIMISTTEAGSESALRALELGAIDFIAKP-------------------------------
YXJL_BACSU      KDIMSALPNTKIVILTTFDTEEYVFEGIRAGAVGYLLK--------------------------------
YCBL_BACSU      KIIREKS-NIPVLMISAKGDVDKAL-GLGFGADDYIAKPF------------------------------
SKN7_YEAST      SIVRSFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRD---------------------------
LYTT_BACCR      NILKKMKNPPAIVFATAYDQY--ALQAFEVDALDYILKPF------------------------------
LON2_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      RRLKSAVARIPVIILS------------------------------------------------------
CHEY_YERPE      KTIRTALATLPVLMVTXXXXXXXXXXXXXXGASGYVVKPFTA----------------------------
CHEB2_DESDG     RKIMSQHP-IPVVIVTEQG-AEASFKAMEYGAVEIIQKP-------------------------------
CHEB2_CAUCR     XXXXXXXXDLRVIMLTERG-AEVTLRALDLGAADYIAKP-------------------------------
ARR12_ARATH     ELV-GLEMDLPVIMLSAHSDPKYVMKGVTHGACDYLLKP-------------------------------
Y165_STAES      DDIKDL--DCQVIILSSYDDFEYMKAGIQHHVLDYLLKP-------------------------------
VIRG_RHIRD      RNLA-AKSDIPIIIISGDREETDKVVALELGASDFIAKPF------------------------------
PRR1_SCHPO      CLIRQYDHNTPILAITSNISMNDAVTYFNHGVTDLLVKPF------------------------------
LYTR_STAES      QKINKMKRSPHIIFATAHE--KFAVKAFELNATDYILKPF------------------------------
LYTR_STAEQ      QKINKMKRSPHIIFATAHE--KFAVKAFELNATDYILKPF------------------------------
LUXN_VIBHB      QRIKELSPQTPIVALSG-----------------------------------------------------
LUXN_VIBHA      QRIKELSPQTPIVALSG-----------------------------------------------------
CLPC_MYCTU      ----------------------------------------------------------------------
CLPC_MYCLE      ----------------------------------------------------------------------
CLPC_MYCBO      ----------------------------------------------------------------------
CHEB_PYRAB      RVIMKKYP-VPVIMISAQEGAEATIKALEYGAIDFIPKP-------------------------------
CHEB5_ANADE     RKLMAQHP-IPVVICSATAGAEPALRALECGAVEVVAKP-------------------------------
CHEB2_SYNWW     RRLMPQYP-LPVVMISALSESVF--DALNAGAIDFVAKP-------------------------------
CHEB2_METMA     SHIMEEFP-TPVVIVSALGEKAITLTALEYGAVDVIEKPSG-----------------------------
CHEB2_GEOMG     RIIMGYCP-TPVIVISAKSDDEKVFKALELGAVDFVAKP-------------------------------
CHEB2_CARHZ     QYIMLHRP-TPIIVITQKGALT-TFEALELGAVDYVAKPDG-----------------------------
CHEB1_RHOFD     GRLMRLRP-MPVVMVTERGEITM--KALELGAIDFVAKP-------------------------------
CHEB1_HAHCH     RNLMRLRP-MPVVMISSLTEQGAAVDALEYGAVDFIAKP-------------------------------
CCDB_BACSU      RDILTFDPKAKVIMCTAMRQQRIVTEAIELGAKDFIVKPF------------------------------
ARR21_ARATH     KQITQEFGNLPVLVMS--SDTNKEEESLSCGAMGFIPKP-------------------------------


                         +         .         .         .         .         *         .:210
query           GPAAGTRIIGRSPAIAQVRDLIANVAATDVPVMINGETGTGKELVARSLHALSTRRDQPFIALNCGAVPE
DCTD_RHIME      XXXXGLPLIGQTPVMERLRQTLKHIADTDVDVLVAGETGSGKEVVATLLHQWSRRRTGNFVALNCGALPE
DCTD_RHILE      DAQENLPLIGQTPVMENLRNILRHIADTDVDVLVAGETGSGKEVVAQILHQWSHRRKGNFVALNCGALPE
ALGB_PSEAE      RQGDGLE--SHSPAMAAVLETARQVAATDANILILGESGSGKGELARAIHTWSKRAKKPQVTINCPSLTA
NTRC_KLEPN      SPTAD--IIGEAPAMQDVFXXXXXXXXXXXXXXXNGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPK
NTRC_ECOLI      GPT--TDIIGEAPAMQDVFXXXXXXXXXXXXXXXNGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPK
NTRC_ECO57      GPT--TDIIGEAPAMQDVFXXXXXXXXXXXXXXXNGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPK
NTRC_SALTY      GPT--TDMIGEAPAMQDVFXXXXXXXXXXXXXXXNGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPK
ALGB_PSEPK      KPKDG--LDSHSPAMMAVLETARQVAITDANILILGESGTGKGELARAIHGWSKRARKACVTINCPSLNA
ALGB_PSESM      KPKDG--LDSHSPSMMAILETARQVAVTDANILILGESGTGKGELARAIHGWSKRAKKSCVTINCPSLTA
ATOC_ECOLI      TSWQWGHILTNSPAMMDICKDTAKIALSQASVLISGESGTGKELIARAIHYNSRRAKGPFIKVNCAALPX
NTRC_PROVU      SVSD---MIGEAPAMQEVYXXXXXXXXXXXXXXXNGESGTGKELVAHALHRHSPRALAPFIALNMAAIPK
NTRC_AZOBR      EQLP---LIGRSPAMQEIYRVLARLMGTDLTVTITGESGTGKELVARALHDYGKRRNGPFVAINMAAIPR
YFHA_ECOLI      APATDERIVTRSPLMLRLLEQARLVAQSDVSVLINGQSGTGKEIFAQAIHNASPRNSKPFIAINCGALPE
YFHA_ECO57      APATDERIVTRSPLMLRLLEQARLVAQSDVSVLINGQSGTGKEIFAQAIHNASPRNSKPFIAINCGALPE
ZRAR_SALTY      ASAAQFGMIGSSPAMQHLLNEIAMVAPSDATVLIHGDSGTGKELVARALHACSARSDRPLVTLNCAALNX
ZRAR_SALTI      ASAAQFGMIGSSPAMQHLLNEIAMVAPSDATVLIHGDSGTGKELVARALHACSARSDKPLVTLNCAALNX
ZRAR_ECOLI      --ASQFGMVGKSPAMQHLLSEIALVAPSEATVLIHGDSGTGKELVARAIHASSARSEKPLVTLNCAALNX
NTRC_BRASR      GEFDSIPLVGRSPAMQEIYRVLARLMQTDLTVMISGESGTGKELVARALHDYGRRRNGPFVAVNMAAIPR
ZRAR_ECO57      --ASQFGMVGKSPAMQHLLSEIALVAPSEATVLIHGDSGTGKELVARAIHASSARSEKPLVTLNCAALNX
NTRC_RHIME      ----GMPLVGRSAAMQEIYRVLARLMQTDLTLMITGESGTGKELVARALHDYGKRRNGPFVAINMAAIPR
NTRC_AZOC5      N----IPLVGRSAAMQEIYRLLARLMQTDLTVMIAGESGTGKELVARALHDYGKRRNGPFVAINMAAIPR
ZRAR_KLEOX      -PAAQFGMVGDSPAMRALLNNITLVAPSDATVLIHGESGTGKELVXXXXXXXXXXXXXPLVILNCAALNX
PILR_PSEAE      ---VDNRLLGESPPMRALRNQIGKLARSQAPVYISGESGSGKELVARLIHEQGPRIERPFVPVNCGAIPS
NTRX_AZOC5      PHT----MVGRSSVIQQLRATVDRVGPTNSRILIVGPSGSGKELTARMIHAASARAQGPFVVINAAAITP
STC_CLOBE       -------IIGQSEAMKRLKEQIKSISNSPSTVLIQGESGTGKELIAQSIHNNSNRRSKSFVAINCGAIPK
HOXA_RALEH      TSTPVLRQIVRAPGLDAVCEVAARVARYDLPVMVLGESGTGKELLARAIHYASPRAARAFVSENCAAVPD
HRPR_PSESY      -------------ALSAGHQIAMHSALLDMDLLLCGETGTGKDTLASRIHELSSRTG-PFVGMNCAAIPE
NORR_ENT38      ---AHTEMIGLSPGMMQLKKEIEIVAASDLNVLIGGETGTGKELVAKSIHEASPRAVNPLVYLNCAALPE
WTSA_ERWST      --------------------LIETVAPLEIDLVLEGETGTGKDTLARKIHRLSGCSGR-LIAVNCAAIPE
LUXO_VIBPA      GNQNYQGFIGSSQTMQQVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPK
HRPS_PSESY      -----------------------SISQLGIDVLLSGETGTGKDTTARRIHNMSGRQGR-FVPMNCAAIPE
FHLA_SALTY      -------IIGRSEAMYNVLKQVEMVAQSDSTVLILGETGTGKELIARAIHNLSGRSGRRMVKMNCAAMPA
NIFA_AZOVI      -------VVGHTPTMRRVFDQIRRVAKWNSTVLVLGESGTGKELIASAIHYKSPRAHRPFVRLNCAALPE
LUXO_VIBHB      GNQNYQGFIGSSQTMQQVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPK
LUXO_VIBHA      GNQNYQGFIGSSQTMQQVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPK
YGEV_ECOLI      ------QLVGECRVMRQLKRLISRIAPSPSSVMVVGESGTGKEVVARAIHKLSGRRNKPFIAINCAAIPE
NORR_SALPC      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQSSPRAVNPLVYLNCAALPE
NORR_KLEP7      -------IIGLSGPMLQLKKEIDIVAASDLNVLISGETGTGKELVAKAVHQGSPRAANPLVYLNCAALPE
FHLA_ECOLI      -------IIGRSEAMYSVLKQVEMVAQSDSTVLILGETGTGKELIARAIHNLSGRNNRRMVKMNCAAMPA
NORR_SALTY      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_SALSV      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_SALNS      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_SALA4      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_ECOLI      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECODH      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECOBW      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_CITK8      -----TQMIGLSPNMMQLKKEIEIVAGSDLNVLISGETGTGKELVAKAIHEGSPRAVNPLVYLNCAALPE
VNFA_AZOVI      -------IIGNSKPMLEVYQLIERVVRTRTTVLILGESGVGKELVAGAIHYNSPAAKGPFVKFNCASLPE
NORR_SHIFL      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_SHIF8      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_SHIDS      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_SALTI      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_SALPB      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_SALPA      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_SALG2      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_SALEP      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_SALDC      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_SALCH      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_ECO5E      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECO57      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NIFA_ENTAG      ------QMVGKSQAMRQTMDILRQVSKWDTTVLVRGESGTGKELIANAIHYNSPRAAAPFVKFNCAALPD
NORR_SALAR      -PIKETHMIGLSPAMTQLKKEIEIVASSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_SALHS      -PIKETHMIGLSPAMTQLKKEIEIVAGSDLNVLIGGETGTGKELVAKAIHQGSPRAVNPLVYLNCAALPE
NORR_KLEP3      -------IIGLSAPMLQLKKEIDIVAASDLNVLISGETGTGKELVAKAVHQGSPRAANPLVYLNCAALPE
PSPF_ECOLI      -------LLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
NORR_ECOSM      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
ANFA_AZOVI      -----SNIIGNSKPMQEVYELIHKVASTKATVLILGESGVGKELVANAIHYNSPNAEAALVTSNCAPLPE
NORR_ESCF3      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECOSE      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLIYLNCAALPE
NORR_ECO24      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECOUT      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECOLU      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECOL6      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECOL5      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECOK1      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECO8A      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECO81      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECO45      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECO27      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR2_RALEH     ----GGEIIGQSEAIANLLHELEVVADTDLPVLLLGETGVGKELFAHRLHRQSRRRAQPLVHVNCAALPE
NORR_SHISS      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_SHIBS      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECOLC      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECOHS      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ECO55      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
HRPS_PSESH      -----------------------SISQLGIDVLLSGETGTGKDTIAQRIHTISGRKGR-LVAMNCAAIPE
FLBD_CAUCR      -------MVVRDPAMEQVIKLADQVAPSEASILITGESGSGKEVMARYVHGKSRRAKAPFISVNCAAIPE
XYLR_PSEPU      --------IGHSPAYKRICETIDKAARGRVSVLLLGETGVGKEVIARSVHLRSERAEQPFVAVNCAAIPP
NIFA_HERSE      -------VIGISKAMQEVFAQVHQSAPSRSTMLLRGESGTGKEVIARAIHYLSPRKDGPFIKVNCAAXXX
LUXO_VIBVY      ADSAGSQFIGSSQKMQQVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASRRGDKPFIAINCAAIPK
LUXO_VIBVU      ADSAGSQFIGSSQKMQQVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASRRGDKPFIAINCAAIPK
NORR_ECO7I      -----TQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLVYLNCAALPE
NORR_ERWCT      -PAAESEMVGLSEPMQRLKKEVDIVAGSDLNVLIMGETGVGKELVARAIHHGSSRANHPLVYLNCAALPE
PRPR_SALTY      -------IRGQSPQMEQLRQTITLYARSRAAVLIQGETGTGKELAAQAIHQTFFHRQPPFVAVNCGAITE
NORR_AERHH      -------MIGQSPAMARLRHEIEVVANSELNVLILGETGVGKELIAKAVHRGSQRAKAPLVYLNCAALPE
HYFR_ECOLI      -------IIYQSQAMEDLLQQVDIVAKSDSTVLICGETGTGKEVIARAIHQLSPRRDKPLVKINCAAIPA
PRPR_ECOLI      -------MLGQSPQMEQVRQTILLYARSSAAVLIEGETGTGKELAAQAIHARQGKKSHPFVAVNCGAIAE
TYRR_ENTAG      -------IVAVTPRMRQVVEQARKLAMHDAPLLIIGDTGTGKDMLARACHLRSARGKMPFLALNCASLPD
NIFA_RHIEC      -------IIGDSPALQQVVETVSVVARTNSTVLLRGESGTGKEFFAQAIHELSPRKNKPFVKLNCAALPE
NIFA_KLEPN      -------MVGKSPAMRQIMDIIRQVSRWDTTVLVRGESGTGKELIANAIHHNSPRXXXXXXXXXXXXLPD
NIFA_KLEOX      -------MVGKSPAMRQIMDIIRQVSRWDTTVLVRGESGTGKELIANAIHHNSPRXXXXXXXXXXXXLPD
HOXA_BRAJA      ATSGHIKVVSVKRGVAKVIELGRRAADYDISVLITGESGTGKELLARAIHYGSARANRAFVVENCGALPD
NIFA_RHISN      -------IVGESPALRQVVESVKVVAQTNSAVLLRGESGTGKEFFAKAIHELSPRRKKPFVKLNCAALSA
NIFA_AZOBR      -------VVCTSPNMLEVMAQVHRVAPFKSTVLIRGESGTGKELIARAIHNMSPRKDAPFIRVNCAALPX
NIFA_AZOLI      -------VVCTSPNMLEVMAQVHRVAPFKSTVLIRGESGTGKELIARAIHNMSPRKDAPFIRVNCAALPX
LUXO_VIBC3      -------IIGNSGPMLAMKADIDVVAPSQFNILIHGETGVGKELVARTIHQRSNRKRQPLVYVNCAAIPE
ROCR_BACSU      -------ILGTSPAIQDVIENAKRATRTSSSVLLAGETGTGKELFAQSIHNGSDRSGGPFISQNCAALPD
NORR1_RALEH     GPADDGEIIGQSQAIAGLLHELEVVADTDLPVLLLGETGVGKELFAXXXXXXXXXXXXPLVHVNCAALPE
NORR_AERS4      -------MIGRSPAMDRLRHEINVVASSELNVLILGETGVGKELIAKAVHQGSPRASAPLVYLNCAALPE
ACOR_BACSU      -------VIGQSGRSQAMLMHLERAAATDASVCLSGETGTGKEVAARALHENSERRHGPFVAVNCGAIPS
NIFA_AZOC5      GSAMG--IVGDSPLVKRLIATAQVVARSNSTVLLRGESGTGKELFARAIHELSPRKGKPFVKVNCAALPE
NIFA_RHILT      ----GAEIVGESAALKEVLEIAQIVARSNSPVLLRGESGTGKEFFAKLIHDSSSRHEKPFVKLNCAALSA
NIFA_RHOCA      GPAAPVSIVGSSPAIAEVVAQIKRVASTRMPVLLRGESGTGKELFARAVHAQSPRAKGPFIRVNCAAXXX
NIFA_RHILE      -------IVGESPALKRVLATTKIVAATNSAVLLRGESGTGKECFARAIHALSIRKSKAFIKLNCAALSE
NORR_SERP5      -------IIGLSSVMQQLKQEISIVAGSELNVLITGETGVGKELVVRAIHQGSARAANPLVYLNCAALPE
NIFA_BRAJA      -------IIGDSPALSALLEKIVVVARSNSTVLLRGESGTGKELVAKAIHESSVRAKRPFVKLNCAALPE
LUXO_VIBCH      -----QGFIGSSQTMQAVYRTIDSAASSKASIFITGESGTGKEVCAEAIHAASKRGDKPFIAINCAAIPK
NORR_VIBF1      -PDNHVEMIGESLAMQELQANINAVANTELSVLITGETGVGKELVASALHQRSTRAQQNLVYLNCAALPE
NTRXL_RICCN     DK---TELVGECSVTLKYKMAIAKAATSSCRIMIHGKVGSGKELAARLIHKQSKRVNNPFIIFSPTCMTT
NORR_VIBVU      -------IIGNSQGMRTLQDQIDAVANTELSVLVMGETGVGKELVANAIHHRSDRASNNLVYLNCAALPE
TYRR_ECOLI      --SAFSQIVAVSPKMKHVVEQAQKLAMLSAPLLITGDTGTGKDLFAYACHQASPRAGKPYLALNCASIPE
NORR_VIBVY      -------IIGNSQGMRTLQEQIDAVANTELSVLVMGETGVGKELVANAIHHRSDRASNNLVYLNCAALPE
NTRXL_RICPR     DK---TELVGGCPVTLKYKMEIEKAASSSSRIMIHGKVGSGKELAARLIHKQSKRVNNPFIIFSPTCMTT
TYRR_SALTY      --SAFSQIIAVSAKMKHVVEQARKLAMLSAPLLITGDTGTGKDLFAYACHQASPRSAKPYLALNCASIPE
TYRR_SALTI      --SAFSQIIAVSAKMKHVVEQARKLAMLSAPLLITGDTGTGKDLFAYACHQASPRSAKPYLALNCASIPE
NTRXL_RICFE     DK---TELVGGCSVTLKYKMEIEKAASSSSRIMIHGKVGSGKELAARLIHKQSKRVNNPFIIFSPTCMTT
HUPR_RHOCA      REGMGFETILRTPAMTGAIALARQFASFDVPVLLRGEPGSGRAQLARAMHYVSLRSDKPFYEINLAGLPE
NTRXL_RICTY     DK---TELVGGCSVTLKYKMEIEKAASSSSRIMIHGKVGSGKELAARLIHKQSKRVNNPFIIFSPTCMTT
PGTA_SALTY      --TLQVELIGRSEWMNQFRQRLQQLAETDIAVWFYGEHGTGRMTGARYLHQLGRNAKGPFVRYEL--TPE
TYRR_CITBR      --SAFSQIIAVSAKMKHVVEQARKLATLSAPLLITGNTGTGKDLFAHACHLASPRASKPYLALNCASIPE
YHYA_PSESN      -------IVVKSMAMEKVYELACRVADSDATIFLQGETGVGKEVLARTIHNSSIRKEAPFIKVNCGAIPE
ACOR_RALEH      -----------------------------INLLIHGETGSGKEFLAKALHLASARRGGPFVAVNCAAIPE
NIFA_RHIME      -------IIGESTALMTAVDTAKVMAETNSIVLLRGETGTGKECFAKLIHQHSTRQKKPFIKFNCPAXXX
YQIR_BACSU      -------IIGKSEQMLVALEQAKLGAKTPATILLRGESGTGKELFAHAIHNESDRKYNKFIRVNCAAXXX
NTRXL_RICBR     DK---TELVGNSTITLKYKAEIDKAASSSSRIMIHGKVGSGKELTARLIHKKSKRVNNLFIIFSPTCMTL
TYRR_HAEIN      --------IVQSEAMKSAVENAKRFAMFDAPLLIQGETGSGKDLLAKACHYQSLRRDKKFIAVNCAGLPD
NTRC_RHOCA      PEGTDLPLVGRTAAMQALYRLVARVMNADLPVMIMGESGTGKSLIAKAIHDFSDRRTLPFVVAQA-----
DHAR_ECOLI      ----------------QTRRLIRQAARSSFPVLLCGEEGVGKALLSQAIHNESERAAGPYIAVNCELYGD
DHAR_CITFR      ------------------------------PILLCGEEGVGKELLSQAIHNESERASGPYIAVNCQLYAN
RTCR_ECOLI      -------IATRNPHFNRMIEQIEKVAIKSAPILLNGPTGAGKSFLARRILELKQARHQAFVEVNCATLRG
Y4PA_RHISN      -------IVGRSPSIQQIKQRIEKLAASSLPVMITGQAGTGKKLLARGIHEAARRSGSKLIS------SE
YPLP_BACSU      -------LIGEHQTFLEAKRIAKQFSLSELPVLITGKIGTGKNHFAHAIHLESSRSNEPFISVNCSTHSE
FIXJ_RHIME      ----------------------------------------------------------------------
FIXJ_AZOC5      ----------------------------------------------------------------------
FIXJ_BRAJA      ----------------------------------------------------------------------
NODW_BRAJA      ----------------------------------------------------------------------
CSEB_STRCO      ----------------------------------------------------------------------
LEVR_BACSU      -------------------------------MLLLGPTGSGKSLFANRIYQFAIYSDAPFITFNCADYYN
CSEB_STRAW      ----------------------------------------------------------------------
MPRA_MYCPA      ----------------------------------------------------------------------
MPRA_MYCA1      ----------------------------------------------------------------------
DCTR_RHOCA      ----------------------------------------------------------------------
MPRA_MYCBP      ----------------------------------------------------------------------
MPRA_MYCBO      ----------------------------------------------------------------------
MPRA_MYCVP      ----------------------------------------------------------------------
MPRA_MYCTU      ----------------------------------------------------------------------
MPRA_MYCTA      ----------------------------------------------------------------------
PHOB_SHIFL      ----------------------------------------------------------------------
PHOB_SHIDY      ----------------------------------------------------------------------
PHOB_ECOLI      ----------------------------------------------------------------------
PHOB_ECO57      ----------------------------------------------------------------------
MPRA_MYCUA      ----------------------------------------------------------------------
MPRA_MYCLE      ----------------------------------------------------------------------
ACTR_RHIME      ----------------------------------------------------------------------
YCF27_GALSU     ----------------------------------------------------------------------
PHOB_PSEAE      ----------------------------------------------------------------------
PHOB_KLEPN      ----------------------------------------------------------------------
ACTR_SINMW      ----------------------------------------------------------------------
REGA_RHOS4      ----------------------------------------------------------------------
MPRA_MYCS2      ----------------------------------------------------------------------
MPRA_MYCSS      ----------------------------------------------------------------------
MPRA_MYCSK      ----------------------------------------------------------------------
MPRA_MYCSJ      ----------------------------------------------------------------------
YCF27_GUITH     ----------------------------------------------------------------------
REGA_RHOCA      ----------------------------------------------------------------------
OMPR_SHIFL      ----------------------------------------------------------------------
OMPR_SALTY      ----------------------------------------------------------------------
OMPR_SALTI      ----------------------------------------------------------------------
OMPR_ECOLI      ----------------------------------------------------------------------
OMPR_ECOL6      ----------------------------------------------------------------------
OMPR_ECO57      ----------------------------------------------------------------------
PHOP_SALCH      ----------------------------------------------------------------------
YCF27_CYAPA     ----------------------------------------------------------------------
MALR_BACSU      ----------------------------------------------------------------------
SPHR_SYNE7      ----------------------------------------------------------------------
YKOG_BACSU      ----------------------------------------------------------------------
YCF27_PORAE     ----------------------------------------------------------------------
PHOB_RHIME      ----------------------------------------------------------------------
COPR_PSESM      ----------------------------------------------------------------------
CHEB_NATPD      ----------------------------------------------------------------------
QSEB_HAEIN      ----------------------------------------------------------------------
HNR_SHIFL       ----------------------------------------------------------------------
HNR_ECOLI       ----------------------------------------------------------------------
HNR_ECO57       ----------------------------------------------------------------------
PHOP_SALTY      ----------------------------------------------------------------------
PHOP_SALTI      ----------------------------------------------------------------------
PHOP_SALPA      ----------------------------------------------------------------------
DLTR_STRA5      ----------------------------------------------------------------------
DLTR_STRA3      ----------------------------------------------------------------------
CHEB2_MAGSA     ----------------------------------------------------------------------
BASR_SALTY      ----------------------------------------------------------------------
SP0F_BACTK      ----------------------------------------------------------------------
REGX3_MYCS2     ----------------------------------------------------------------------
QSEB_SALTY      ----------------------------------------------------------------------
QSEB_SALTI      ----------------------------------------------------------------------
AFSQ1_STRCO     ----------------------------------------------------------------------
DCTR_BACME      ----------------------------------------------------------------------
CUSR_ECOLI      ----------------------------------------------------------------------
CUSR_ECOL6      ----------------------------------------------------------------------
CUSR_ECO57      ----------------------------------------------------------------------
TCTD_SALTY      ----------------------------------------------------------------------
REGX3_MYCTU     ----------------------------------------------------------------------
REGX3_MYCBO     ----------------------------------------------------------------------
QSEB_ECOLI      ----------------------------------------------------------------------
PHOP_SHIFL      ----------------------------------------------------------------------
PHOP_ECOLI      ----------------------------------------------------------------------
PHOP_ECOL6      ----------------------------------------------------------------------
Y851_SYNP2      ----------------------------------------------------------------------
QSEB_ECO57      ----------------------------------------------------------------------
CYAB_STIAU      ----------------------------------------------------------------------
CTRA_CAUCR      --AVVRRSKGHAQSVIKTGDIVVNLDAKTVEVNGNRVHLTGKEY--QMLELLSLRK--------------
CTRA_CAUCN      --AVVRRSKGHAQSVIKTGDIVVNLDAKTVEVNGNRVHLTGKEY--QMLELLSLRK--------------
CHEY_THEMA      ----------------------------------------------------------------------
BASR_ECOLI      ----------------------------------------------------------------------
SILR_SALTY      ----------------------------------------------------------------------
RPRY_BACFR      ----------------------------------------------------------------------
LYTR_STAHJ      ----------------------------------------------------------------------
HSSR_STAHJ      ----------------------------------------------------------------------
DCTR_BACHD      ----------------------------------------------------------------------
PHOP_ECO57      ----------------------------------------------------------------------
PHOP_BACSU      ----------------------------------------------------------------------
IRLR_BURPS      ----------------------------------------------------------------------
DHKD_DICDI      ----------------------------------------------------------------------
CHEB_DESPS      ----------------------------------------------------------------------
YESN_BACSU      ----------------------------------------------------------------------
YEDW_ECOLI      ----------------------------------------------------------------------
RCAC_FREDI      ----------------------------------------------------------------------
HSSR_STAAE      ----------------------------------------------------------------------
HSSR_STAAC      ----------------------------------------------------------------------
YCF27_PORYE     ----------------------------------------------------------------------
YCF27_PORPU     ----------------------------------------------------------------------
CHEB1_ANADE     ----------------------------------------------------------------------
HSSR_STAAR      ----------------------------------------------------------------------
HSSR_STAAW      ----------------------------------------------------------------------
HSSR_STAAT      ----------------------------------------------------------------------
HSSR_STAAS      ----------------------------------------------------------------------
HSSR_STAAN      ----------------------------------------------------------------------
HSSR_STAAM      ----------------------------------------------------------------------
HSSR_STAA9      ----------------------------------------------------------------------
HSSR_STAA8      ----------------------------------------------------------------------
HSSR_STAA3      ----------------------------------------------------------------------
HSSR_STAA2      ----------------------------------------------------------------------
HSSR_STAA1      ----------------------------------------------------------------------
CHEY_LISMO      ----------------------------------------------------------------------
CHEY_LISIN      ----------------------------------------------------------------------
CHEY_BACSU      ----------------------------------------------------------------------
HSSR_STAS1      ----------------------------------------------------------------------
CHEB2_RHOS4     ----------------------------------------------------------------------
CHEB1_DECAR     ----------------------------------------------------------------------
ARR7_ARATH      ----------------------------------------------------------------------
ALGR_PSEAE      ----------------------------------------------------------------------
PFER_PSEAE      ----------------------------------------------------------------------
CHEB2_RHOSH     ----------------------------------------------------------------------
ARR6_ARATH      ----------------------------------------------------------------------
CREB_ECOLI      ----------------------------------------------------------------------
YCF27_CYACA     ----------------------------------------------------------------------
NARP_HAEIN      ----------------------------------------------------------------------
PHOB_HAEIN      ----------------------------------------------------------------------
DCTR_BACSU      ----------------------------------------------------------------------
CZCR_RALME      ----------------------------------------------------------------------
YVRH_BACSU      ----------------------------------------------------------------------
CQSS_VIBCH      ----------------------------------------------------------------------
CITB_KLEPN      ----------------------------------------------------------------------
CHVI_RHISN      ----------------------------------------------------------------------
CHVI_RHIME      ----------------------------------------------------------------------
CHEY_HELPJ      ----------------------------------------------------------------------
ARR1_ARATH      ----------------------------------------------------------------------
VIRG_AGRT5      ----------------------------------------------------------------------
VIRG_AGRRH      ----------------------------------------------------------------------
CUTR_STRLI      ----------------------------------------------------------------------
CUTR_STRCO      ----------------------------------------------------------------------
CHVI_RHIRD      ----------------------------------------------------------------------
CHEY_PSEAE      ----------------------------------------------------------------------
CHEB_HALMA      ----------------------------------------------------------------------
CHEB3_RHORT     ----------------------------------------------------------------------
HSSR_STAES      ----------------------------------------------------------------------
HSSR_STAEQ      ----------------------------------------------------------------------
RESD_BACSU      ----------------------------------------------------------------------
LYTT_BACSU      ----------------------------------------------------------------------
HSSR_STAAB      ----------------------------------------------------------------------
CHEY_HELPY      ----------------------------------------------------------------------
CHEB_TREPA      ----------------------------------------------------------------------
PILH_PSEAE      ----------------------------------------------------------------------
PDE2_DICDI      ----------------------------------------------------------------------
ARR5_ARATH      ----------------------------------------------------------------------
ARR4_ARATH      ----------------------------------------------------------------------
YFIK_BACSU      ----------------------------------------------------------------------
VANR_ENTFC      ----------------------------------------------------------------------
CHEB2_CHRVO     ----------------------------------------------------------------------
APRR5_ARATH     ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
RSSB_SERMA      ----------------------------------------------------------------------
GRAR_STAHJ      ----------------------------------------------------------------------
CHEB_ARCFU      ----------------------------------------------------------------------
CHEB2_RHOCS     ----------------------------------------------------------------------
CHEB1_MAGSA     ----------------------------------------------------------------------
ARR3_ARATH      ----------------------------------------------------------------------
SAER_STAAW      ----------------------------------------------------------------------
SAER_STAAS      ----------------------------------------------------------------------
SAER_STAAR      ----------------------------------------------------------------------
SAER_STAAN      ----------------------------------------------------------------------
SAER_STAAM      ----------------------------------------------------------------------
SAER_STAAE      ----------------------------------------------------------------------
SAER_STAAC      ----------------------------------------------------------------------
SAER_STAAB      ----------------------------------------------------------------------
SAER_STAA8      ----------------------------------------------------------------------
SAER_STAA3      ----------------------------------------------------------------------
PRR37_ORYSJ     ----------------------------------------------------------------------
PRR37_ORYSI     ----------------------------------------------------------------------
CHEB_THEMA      ----------------------------------------------------------------------
CHEB_SHISS      ----------------------------------------------------------------------
CHEB_SHIFL      ----------------------------------------------------------------------
CHEB_SHIBS      ----------------------------------------------------------------------
CHEB_SALTY      ----------------------------------------------------------------------
CHEB_SALTI      ----------------------------------------------------------------------
CHEB_SALPA      ----------------------------------------------------------------------
CHEB_SALCH      ----------------------------------------------------------------------
CHEB_ECOUT      ----------------------------------------------------------------------
CHEB_ECOLI      ----------------------------------------------------------------------
CHEB_ECOL6      ----------------------------------------------------------------------
CHEB_ECOL5      ----------------------------------------------------------------------
CHEB_ECO57      ----------------------------------------------------------------------
CHEB3_LEPIN     ----------------------------------------------------------------------
CHEB3_LEPIC     ----------------------------------------------------------------------
CHEB3_HAHCH     ----------------------------------------------------------------------
ARR2_ARATH      ----------------------------------------------------------------------
APRR9_ARATH     ----------------------------------------------------------------------
YBDJ_BACSU      ----------------------------------------------------------------------
RPFC_XANCP      ----------------------------------------------------------------------
RPFC_XANC8      ----------------------------------------------------------------------
LYTT_ENTFA      ----------------------------------------------------------------------
CHLD_PEA        -------------------------------------------------------------------IPL
CHEB2_GEOSL     ----------------------------------------------------------------------
ARCA_SHIFL      ----------------------------------------------------------------------
ARCA_ECOLI      ----------------------------------------------------------------------
ARCA_ECOL6      ----------------------------------------------------------------------
ARCA_ECO57      ----------------------------------------------------------------------
Y4XI_RHISN      ----------------------------------------------------------------------
WALR_STAS1      ----------------------------------------------------------------------
WALR_STAHJ      ----------------------------------------------------------------------
WALR_STAES      ----------------------------------------------------------------------
WALR_STAEQ      ----------------------------------------------------------------------
WALR_STAAW      ----------------------------------------------------------------------
WALR_STAAU      ----------------------------------------------------------------------
WALR_STAAT      ----------------------------------------------------------------------
WALR_STAAS      ----------------------------------------------------------------------
WALR_STAAR      ----------------------------------------------------------------------
WALR_STAAN      ----------------------------------------------------------------------
WALR_STAAM      ----------------------------------------------------------------------
WALR_STAAE      ----------------------------------------------------------------------
WALR_STAAC      ----------------------------------------------------------------------
WALR_STAAB      ----------------------------------------------------------------------
WALR_STAA9      ----------------------------------------------------------------------
WALR_STAA8      ----------------------------------------------------------------------
WALR_STAA3      ----------------------------------------------------------------------
WALR_STAA2      ----------------------------------------------------------------------
WALR_STAA1      ----------------------------------------------------------------------
GRAR_STAES      ----------------------------------------------------------------------
GRAR_STAEQ      ----------------------------------------------------------------------
GRAR_STAAW      ----------------------------------------------------------------------
GRAR_STAAT      ----------------------------------------------------------------------
GRAR_STAAS      ----------------------------------------------------------------------
GRAR_STAAR      ----------------------------------------------------------------------
GRAR_STAAN      ----------------------------------------------------------------------
GRAR_STAAM      ----------------------------------------------------------------------
GRAR_STAAE      ----------------------------------------------------------------------
GRAR_STAAC      ----------------------------------------------------------------------
GRAR_STAAB      ----------------------------------------------------------------------
GRAR_STAA9      ----------------------------------------------------------------------
GRAR_STAA8      ----------------------------------------------------------------------
GRAR_STAA3      ----------------------------------------------------------------------
GRAR_STAA2      ----------------------------------------------------------------------
GRAR_STAA1      ----------------------------------------------------------------------
CHEB_METFK      ----------------------------------------------------------------------
CHEB_METBU      ----------------------------------------------------------------------
CHEB_ERWCT      ----------------------------------------------------------------------
CHEB_ENTCL      ----------------------------------------------------------------------
CHEB3_GEOMG     ----------------------------------------------------------------------
BCER_BACHD      ----------------------------------------------------------------------
ARR14_ARATH     ----------------------------------------------------------------------
YXDJ_BACSU      ----------------------------------------------------------------------
YRKP_BACSU      ----------------------------------------------------------------------
TORS_ECOLI      ----------------------------------------------------------------------
SRRA_STAAW      ----------------------------------------------------------------------
SRRA_STAAU      ----------------------------------------------------------------------
SRRA_STAAS      ----------------------------------------------------------------------
SRRA_STAAR      ----------------------------------------------------------------------
SRRA_STAAN      ----------------------------------------------------------------------
SRRA_STAAM      ----------------------------------------------------------------------
SRRA_STAAC      ----------------------------------------------------------------------
SRRA_STAA8      ----------------------------------------------------------------------
LOVHK_PSESM     ----------------------------------------------------------------------
CHEB2_BORA1     ----------------------------------------------------------------------
ARR17_ARATH     ----------------------------------------------------------------------
GRAR_STAS1      ----------------------------------------------------------------------
EHD1_ORYSJ      ----------------------------------------------------------------------
EHD1_ORYSI      ----------------------------------------------------------------------
CHEB_PELCD      ----------------------------------------------------------------------
CHEB2_XANOR     ----------------------------------------------------------------------
CHEB2_XANOM     ----------------------------------------------------------------------
CHEB1_XANC5     ----------------------------------------------------------------------
CHEB1_XANAC     ----------------------------------------------------------------------
CHEB1_BURPS     ----------------------------------------------------------------------
APRR3_ARATH     ----------------------------------------------------------------------
VANR_ENTFA      ----------------------------------------------------------------------
TORR_ECOLI      ----------------------------------------------------------------------
REGX3_MYCLE     ----------------------------------------------------------------------
LYTT_OCEIH      ----------------------------------------------------------------------
LYTR_STAAW      ----------------------------------------------------------------------
LYTR_STAAS      ----------------------------------------------------------------------
LYTR_STAAR      ----------------------------------------------------------------------
LYTR_STAAN      ----------------------------------------------------------------------
LYTR_STAAM      ----------------------------------------------------------------------
LYTR_STAAC      ----------------------------------------------------------------------
LYTR_STAAB      ----------------------------------------------------------------------
LYTR_STAA8      ----------------------------------------------------------------------
LYTR_STAA3      ----------------------------------------------------------------------
DPIA_SHIFL      ----------------------------------------------------------------------
DPIA_ECOLI      ----------------------------------------------------------------------
DPIA_ECOL6      ----------------------------------------------------------------------
DPIA_ECO57      ----------------------------------------------------------------------
CHEB_YERPN      ----------------------------------------------------------------------
CHEB_YERPE      ----------------------------------------------------------------------
CHEB_YERPA      ----------------------------------------------------------------------
ARR11_ARATH     ----------------------------------------------------------------------
AGMR_PSEAE      ----------------------------------------------------------------------
Y4021_VIBPA     ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
CTRA_OCHA4      --AIVRRSKGHAQSVITTGDLVVNLDAKTVEVSGQRVHLTGKEY--QMLELLSLRK--------------
CTRA_BRUSU      --AIVRRSKGHAQSVITTGDLVVNLDAKTVEVAGQRVHLTGKEY--QMLELLSLRK--------------
CTRA_BRUSI      --AIVRRSKGHAQSVITTGDLVVNLDAKTVEVAGQRVHLTGKEY--QMLELLSLRK--------------
CTRA_BRUO2      --AIVRRSKGHAQSVITTGDLVVNLDAKTVEVAGQRVHLTGKEY--QMLELLSLRK--------------
CTRA_BRUME      --AIVRRSKGHAQSVITTGDLVVNLDAKTVEVAGQRVHLTGKEY--QMLELLSLRK--------------
CTRA_BRUC2      --AIVRRSKGHAQSVITTGDLVVNLDAKTVEVAGQRVHLTGKEY--QMLELLSLRK--------------
CTRA_BRUAB      --AIVRRSKGHAQSVITTGDLVVNLDAKTVEVAGQRVHLTGKEY--QMLELLSLRK--------------
CTRA_BRUA2      --AIVRRSKGHAQSVITTGDLVVNLDAKTVEVAGQRVHLTGKEY--QMLELLSLRK--------------
CTRA_BRUA1      --AIVRRSKGHAQSVITTGDLVVNLDAKTVEVAGQRVHLTGKEY--QMLELLSLRK--------------
CHEB_YERPS      ----------------------------------------------------------------------
CHEB1_BURTA     ----------------------------------------------------------------------
CHEB1_BURP1     ----------------------------------------------------------------------
CHEB1_BURMA     ----------------------------------------------------------------------
YSO1_PLEBO      ----------------------------------------------------------------------
TORR_ECO57      ----------------------------------------------------------------------
RCSC_ECOLI      ----------------------------------------------------------------------
PRR95_ORYSJ     ----------------------------------------------------------------------
PDTAR_MYCTU     ----------------------------------------------------------------------
GACA_PSEAE      ----------------------------------------------------------------------
CHEB_THIDA      ----------------------------------------------------------------------
CHEB_BORPE      ----------------------------------------------------------------------
CHEB_BORPA      ----------------------------------------------------------------------
CHEB_BORBR      ----------------------------------------------------------------------
CHEB2_RHORT     ----------------------------------------------------------------------
CHLD_TOBAC      -------------------------------IAICGKRGTAKTLMARGLHALADRAESPFVQIPLGVTED
CHEB_SALRD      ----------------------------------------------------------------------
CHEB2_XANC8     ----------------------------------------------------------------------
CHEB1_XANCP     ----------------------------------------------------------------------
ARR18_ARATH     ----------------------------------------------------------------------
YCCH_BACSU      ----------------------------------------------------------------------
REGA_RHOSU      ----------------------------------------------------------------------
PILG_PSEAE      ----------------------------------------------------------------------
CHEB_TREDE      ----------------------------------------------------------------------
CHEB2_ACIBL     ----------------------------------------------------------------------
CHEB1_RALME     ----------------------------------------------------------------------
VIRG_AGRT9      ----------------------------------------------------------------------
RCSC_SALTY      ----------------------------------------------------------------------
RCSC_SALTI      ----------------------------------------------------------------------
PRRA_MYCTU      ----------------------------------------------------------------------
PRRA_MYCBO      ----------------------------------------------------------------------
LYTR_STAS1      ----------------------------------------------------------------------
CHEB_CHRSD      ----------------------------------------------------------------------
CHEB_BURXL      ----------------------------------------------------------------------
CHEB_BACHD      ----------------------------------------------------------------------
CHEB2_SHESM     ----------------------------------------------------------------------
CHEB2_RALEJ     ----------------------------------------------------------------------
ARLR_STAHJ      ----------------------------------------------------------------------
TRPO_PSEAE      ----------------------------------------------------------------------
LONH_HALSA      ----------------------------------------------------------------------
GACA_PSEU2      ----------------------------------------------------------------------
DCUR_SHIFL      ----------------------------------------------------------------------
DCUR_ECOLI      ----------------------------------------------------------------------
DCUR_ECOL6      ----------------------------------------------------------------------
DCUR_ECO57      ----------------------------------------------------------------------
CQSS_VIBHB      ----------------------------------------------------------------------
CHEB1_DESVH     ----------------------------------------------------------------------
CHEB1_CHRVO     ----------------------------------------------------------------------
CHEB1_BURCA     ----------------------------------------------------------------------
APRR7_ARATH     ----------------------------------------------------------------------
Y3287_YERPE     ----------------------------------------------------------------------
PRRA_MYCLE      ----------------------------------------------------------------------
PHYR_METEA      ----------------------------------------------------------------------
PCOR_ECOLX      ----------------------------------------------------------------------
CPXR_SHIFL      ----------------------------------------------------------------------
CPXR_ECOLI      ----------------------------------------------------------------------
CPXR_ECO57      ----------------------------------------------------------------------
CHEB_NOCSJ      ----------------------------------------------------------------------
CHEB3_BURS3     ----------------------------------------------------------------------
BVGA_BORPE      ----------------------------------------------------------------------
BVGA_BORPA      ----------------------------------------------------------------------
BVGA_BORBR      ----------------------------------------------------------------------
ARR10_ARATH     ----------------------------------------------------------------------
RSTA_ECOLI      ----------------------------------------------------------------------
MTRA_MYCTU      ----------------------------------------------------------------------
MTRA_MYCPA      ----------------------------------------------------------------------
MTRA_MYCLE      ----------------------------------------------------------------------
MTRA_MYCBO      ----------------------------------------------------------------------
LOVHK_PSEU2     ----------------------------------------------------------------------
LOVHK_PSE14     ----------------------------------------------------------------------
GTCR_ANEMI      ----------------------------------------------------------------------
CLPB_STRAL      ----GRRLIGQSEAVQAVSDAVAGIADPDRPTLFLGPTGVGKTEL<