[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07164.1

[Show Plain Result]


## Summary of Sequence Search
    1::219
   58::199     1e-14  31%  205 aa  PDTAR_MYCTU RecName: Full=Probable transcriptional regulatory
  324::388     6e-10  42%  396 aa  NASR_KLEOX RecName: Full=Nitrate regulatory protein;
    8::159     5e-06  28%  228 aa  DCTR_BACME RecName: Full=Probable C4-dicarboxylate response
    7::161     2e-05  29%  230 aa  DCTR_BACHD RecName: Full=Probable C4-dicarboxylate response
  415::590     1e-04  27%  618 aa  HSCA_VARPS RecName: Full=Chaperone protein hscA homolog;
  106::190     4e-04  31%  196 aa  AMIR_PSEAE RecName: Full=Aliphatic amidase regulator;
   67::163     8e-04  26%  299 aa  URED_HALMA RecName: Full=Urease accessory protein ureD;
    1::219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxLRILLVRDPHEADPLNVETIRAGLAQAGFTEVQTVDADLRLP
PDTAR_MYCTU     ----------------------------------------------------------------------
NASR_KLEOX      ----------------------------------------------------------------------
DCTR_BACME      ------------------------------VLLIED----DPMVQEVNRQFIEQVGFTVIAAASNGLEGV
DCTR_BACHD      ----------------------------IRVLLIED----DPMVQEVNRMFVEKSGFTIVGTTATGEEGM
HSCA_VARPS      ---------------------------------------------QTIPTAMAQ-DFTTYQ--DGQTALA
AMIR_PSEAE      ----------------------------------------------------------------------
URED_HALMA      --------------------------------------EADTVFIQSPTGGVAQGDRHDVSITVGDEAVA


                         .         .         *         .         .         .         .:140
query           DTITASQPDLVIIASESAARDTIEHVCVSTQHAPRPIVLFTDNDDAQRIKAALSAGITAYIVDGLRAERV
PDTAR_MYCTU     ------KPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDL
NASR_KLEOX      ----------------------------------------------------------------------
DCTR_BACME      QLIKQHQPDLTIIDMYMPSQDGLTTLQIRANGYKTDVIAVTAASDIETVRKVLQYGAVDYIMKPFKFERM
DCTR_BACHD      VKTRELQPDLILLDIFMPKQDGLSFIKIREQYIDVDIIAVTAANDTKTIKTLLRYGVMDYLVKPFTFERL
HSCA_VARPS      LHVVQGERDLVADC-RSLARFTLRGIPPMAAGAARIRVTFTVDADAKEQGSGVEASVAVKPSYGLSDDQI
AMIR_PSEAE      ------------------------------------------------------------ITQPLDAHRV
URED_HALMA      HVSTQSSTKVQTMTCNYAAADTTLSVGAGLDYVPEPTILHADSRYLQELSVDLAPGATAVVSD-------


                         +         .         .         .         .         *         .:210
query           KTVLDVAYARFQLDQQLRAELDATKLKLAERKTVERAKGLLMQARGISEDEAFKRLRSMAMERGIRLVDA
PDTAR_MYCTU     IPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRV
NASR_KLEOX      --------------QQLSGQLASLKDALEERKLIEKAKSVLMTYQGMQEEQAWQALRKMAMDKNQRMVEI
DCTR_BACME      KQALE-QYRSFQVEHITQSELDSMLFQQFEEKADLLPKGL------------------------------
DCTR_BACHD      KAAL-TQYEEMFRKMQKEAELEMIKQKQAQANMDDLPKGL------------------------------
HSCA_VARPS      ATMLQESFSTAQQDMQARARVDAERMLLATQSALDADGDLLGEEERAVIDASMAKLREAAKGNDAAAIEG
AMIR_PSEAE      LPVLVSARRISEEMAKLKQKTEQLQERIAGQARINQAKALLMQRHGWDEREAHQYLSREAMKRREPILKI
URED_HALMA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AQRVIDVMA
PDTAR_MYCTU     AEVVLETL-
NASR_KLEOX      ARALLTVKA
DCTR_BACME      ---------
DCTR_BACHD      ---------
HSCA_VARPS      ATKAL----
AMIR_PSEAE      AQELL----
URED_HALMA      ---------