[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07169.1

[Show Plain Result]


## Summary of Sequence Search
    1::454
  128::440     1e-29  28%  447 aa  Y4WB_RHISN RecName: Full=Uncharacterized zinc protease-like protein
   98::405     5e-16  26%  409 aa  YMXG_BACSU RecName: Full=Uncharacterized zinc protease ymxG;       
   99::337     1e-14  24%  412 aa  Y293_RICCN RecName: Full=Uncharacterized zinc protease RC0293;     
  165::412     2e-14  29%  445 aa  Y855_MYCLE RecName: Full=Uncharacterized zinc protease ML0855;     
  152::428     3e-14  26%  459 aa  Y5738_STRCO RecName: Full=Uncharacterized zinc protease SCO5738;   
  100::306     2e-13  23%  412 aa  Y522_RICBR RecName: Full=Uncharacterized zinc protease RBE_0522;   
  100::381     7e-13  24%  412 aa  Y210_RICTY RecName: Full=Uncharacterized zinc protease RT0210;     
   99::306     3e-12  23%  412 aa  Y338_RICFE RecName: Full=Uncharacterized zinc protease RF_0338;    
  100::381     3e-12  24%  412 aa  Y219_RICPR RecName: Full=Uncharacterized zinc protease RP219;      
  162::421     2e-10  26%  438 aa  Y2805_MYCBO RecName: Full=Uncharacterized zinc protease Mb2805c;   
  162::421     2e-10  26%  438 aa  Y2782_MYCTU RecName: Full=Uncharacterized zinc protease
  128::288     9e-10  26%  466 aa  MPPB_LENED RecName: Full=Mitochondrial-processing peptidase subunit
  125::448     9e-10  23%  465 aa  MPPB_BLAEM RecName: Full=Mitochondrial-processing peptidase subunit
  118::279     1e-09  28%  457 aa  MPPB_SCHPO RecName: Full=Probable mitochondrial-processing
  174::462     8e-09  22%  512 aa  Y4WA_RHISN RecName: Full=Uncharacterized zinc protease y4wA;       
  121::283     3e-06  22%  462 aa  MPPB_YEAST RecName: Full=Mitochondrial-processing peptidase subunit
  143::297     4e-06  23%  476 aa  MPPB_NEUCR RecName: Full=Mitochondrial-processing peptidase subunit
  147::473     1e-05  21%  489 aa  MPPB_MOUSE RecName: Full=Mitochondrial-processing peptidase subunit
  148::474     3e-05  20%  490 aa  MPPB_BOVIN RecName: Full=Mitochondrial-processing peptidase subunit
  192::286     5e-05  25%  531 aa  MPPB_ARATH RecName: Full=Probable mitochondrial-processing
  147::257     1e-04  22%  489 aa  MPPB_RAT RecName: Full=Mitochondrial-processing peptidase subunit
  147::257     1e-04  22%  489 aa  MPPB_PONAB RecName: Full=Mitochondrial-processing peptidase subunit
  147::257     1e-04  22%  489 aa  MPPB_HUMAN RecName: Full=Mitochondrial-processing peptidase subunit
    1::454

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y4WB_RHISN      ----------------------------------------------------------------------
YMXG_BACSU      ----------------------------------------------------------------------
Y293_RICCN      ----------------------------------------------------------------------
Y855_MYCLE      ----------------------------------------------------------------------
Y5738_STRCO     ----------------------------------------------------------------------
Y522_RICBR      ----------------------------------------------------------------------
Y210_RICTY      ----------------------------------------------------------------------
Y338_RICFE      ----------------------------------------------------------------------
Y219_RICPR      ----------------------------------------------------------------------
Y2805_MYCBO     ----------------------------------------------------------------------
Y2782_MYCTU     ----------------------------------------------------------------------
MPPB_LENED      ----------------------------------------------------------------------
MPPB_BLAEM      ----------------------------------------------------------------------
MPPB_SCHPO      ----------------------------------------------------------------------
Y4WA_RHISN      ----------------------------------------------------------------------
MPPB_YEAST      ----------------------------------------------------------------------
MPPB_NEUCR      ----------------------------------------------------------------------
MPPB_MOUSE      ----------------------------------------------------------------------
MPPB_BOVIN      ----------------------------------------------------------------------
MPPB_ARATH      ----------------------------------------------------------------------
MPPB_RAT        ----------------------------------------------------------------------
MPPB_PONAB      ----------------------------------------------------------------------
MPPB_HUMAN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTASPER
Y4WB_RHISN      ---------------------------------------------------------------------K
YMXG_BACSU      ----------------------------------------------------------------------
Y293_RICCN      ----------------------------------------------------------------------
Y855_MYCLE      ----------------------------------------------------------------------
Y5738_STRCO     ----------------------------------------------------------------------
Y522_RICBR      ----------------------------------------------------------------------
Y210_RICTY      ----------------------------------------------------------------------
Y338_RICFE      ----------------------------------------------------------------------
Y219_RICPR      ----------------------------------------------------------------------
Y2805_MYCBO     ----------------------------------------------------------------------
Y2782_MYCTU     ----------------------------------------------------------------------
MPPB_LENED      ----------------------------------------------------------------------
MPPB_BLAEM      ------------------------------------------------------------------SQDV
MPPB_SCHPO      ----------------------------------------------------------------------
Y4WA_RHISN      ----------------------------------------------------------------TVTPES
MPPB_YEAST      ----------------------------------------------------------------------
MPPB_NEUCR      ----------------------------------------------------------------------
MPPB_MOUSE      ------------------------------------------------------------------SRDL
MPPB_BOVIN      ------------------------------------------------------------------SKDL
MPPB_ARATH      ----------------------------------------------------------------------
MPPB_RAT        ------------------------------------------------------------------SKDL
MPPB_PONAB      ------------------------------------------------------------------SKDL
MPPB_HUMAN      ------------------------------------------------------------------SKDL


                         +         .         .         .         .         *         .:210
query           EQSLRLAAQLIKSPTYPDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSIT
Y4WB_RHISN      DEAFQLLRLAIEQPRFDQQPVDRLRAQIVSSILARAKDPETAAQFAWMRAIYGDHPYSEEGTVQTLAAVT
YMXG_BACSU      --ALDVLADMFFHSTFDENELKKEKNVVYEEIKMYEDAPDDIVHDLLSKATYGNHSLGILGTEETLASFN
Y293_RICCN      DKALNILADIIQNSIFSDEEIAKEYQVIMQEIAHHQDNPDDLVYEKFYNKVYREQPLGKSGTAKTLATFT
Y855_MYCLE      -------------------------------------------------ALFGDHPVGVIGTMESVSAMT
Y5738_STRCO     -----------------------ERGAILEEIAMTEDDPGDCVHDLFAHTMFGDNALGVLGTVDTVNALT
Y522_RICBR      -KALAIIADIVQNSAFAEEEIAKEYQVILQEIAHAQDNPDDLVYEKFYNSVFKDQPLGILGTSKTIETFN
Y210_RICTY      -KALNILADIIQNSIFADEEISKEYQIIMQEIAHHHDNPDDLIYETFYNTVYKDQPLGKSGTAKTLVKFT
Y338_RICFE      DKALNILADIIQNSIFAEEEIAKEYQVILQEIAHSQDNPDDLIYEKFYSSVYKDQPLGILGASKTLSSFT
Y219_RICPR      -KALNILADIIQNSIFADEEIAKEYQIIMQEIAHHHDNPDDLIYETFYNTVYKGQPLGKSGTTKTLVTFT
Y2805_MYCBO     -----------------------------------------------------DHPVGVIGSAQSVSVMT
Y2782_MYCTU     -----------------------------------------------------DHPVGVIGSAQSVSVMT
MPPB_LENED      -----IISDILQNSKLESGAIERERDVILREQQEVDKQLEEVVFDHLHAVAFQGQPLGILGPKNNILSIQ
MPPB_BLAEM      AKGVNILGDILQNSTLDPGAIDRERAVILREAEEVDKQVEEVVFDHLHAAAFPENALGILGPKENIQTLS
MPPB_SCHPO      --AVAVLADILTNSSISASAVERERQVILREQEEVDKMADEVVFDHLHATAYQGHPLGILGPKENIESLT
Y4WA_RHISN      LRTMEFEADRMRHLVLTDAVIVPERDVILEERRRVENDPEQLLEEEMQATLYQNHPYRIPTIGHEMEQLN
MPPB_YEAST      -KAVDILSDILTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGILGPIKNIKSIT
MPPB_NEUCR      ---------ILQNSKLEESAIERERDVILRXXXXXXXXXXXXXFDHLHATAYQHQPLGILGPRENIRDIT
MPPB_MOUSE      PRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGILGPTENIKSIN
MPPB_BOVIN      PRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGILGPTENIKSIN
MPPB_ARATH      -QALDVLADILQNSKFEEQRINRERDVILREMQEVEGQTDEVVLDHLHATAFQYTPLGILGPAQNVKSIT
MPPB_RAT        PRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGILGPTENIKSIS
MPPB_PONAB      PRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGILGPTENIKSIS
MPPB_HUMAN      PRAVEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGILGPTENIKSIS


                         .         .         .         +         .         .         .:280
query           HDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPHPAQQ
Y4WB_RHISN      TSDLKAVHERIFARGNLTIAVVGAIDPGTLKRDLDRIFGGLPAG---PSLTPVVDAVPKLGRRVAYDLPQ
YMXG_BACSU      GDSLRQYMHDYYTPDRVVISVAGNISDSFIKDVEKWFAKGKATGLEKPEFHTEKLTRKKE-------TEQ
Y293_RICCN      KEHFFNFIDKYYNAANLYLSIAGNIDHDKIVIIAEQLFSSLKQGVKSSFIPAKYI---GGNGFINKELEQ
Y855_MYCLE      RTQLHSFHVRRYTPERMVVAVAGNVDHDEMEHFGSRLIRGRQS--APPRKSTGRINGGPALTLGKRDAEQ
Y5738_STRCO     ADRIRRFYRKHYDPTHLVVAAAGNVDHKVVRQVAFEKSGALKDPAAQPLXXXXXXXXXXXXELIGRKTEQ
Y522_RICBR      RDHFLKFTGKHYNAENFYLSIAGNVDHEEIVKEAERLFSSLTQGEKSNFSPAKYI---GGHSFINKDLEQ
Y210_RICTY      QEHFLNFIGKHYNAENLYLSIAGNIEHNKIVIIAEELFASLKQGVTSSFIPAKYI---GGKGFIHKELEQ
Y338_RICFE      KEHFLSFIDKHYNAGNLYLSVAGNVDHDKIVSSAERLFSSLKQGEKSNFLPAKYI---GGNSFINKDLEQ
Y219_RICPR      KEHFLNFIGKHYNAENLYLSIAGNIEHNKIVMIAEELFASLKQGVKSSFIPAKYI---GGKGFIHKELEQ
Y2805_MYCBO     RAQLQSFHLRRYTPERMVVAAAGNVDHDGLEHFGSRLVRGRRPVA--PRKGTGRVNGSPRLTLVSRDAEQ
Y2782_MYCTU     RAQLQSFHLRRYTPERMVVAAAGNVDHDGLEHFGSRLVRGRRPVA--PRKGTGRVNGSPRLTLVSRDAEQ
MPPB_LENED      RDDLASYIQTNYTADRMVLVGTGGVDHQSLVKLAEKHFSSLPVSANPLALSERKPTFVGSEARIDDELPT
MPPB_BLAEM      QADLQAYIKNNYTADRMVVVGAGNVDHAELCKLAETNFGKLPQGSGKAKF--VRPAFTGSDVRIVDDMPT
MPPB_SCHPO      REDLLQYIKDNYRSDRMIISSAGSISHEELEPSAEQLSLGAPRGLKPRF---VGSEIRARDDDSP----T
Y4WA_RHISN      REDALKFYDRYYAPNNAILVVAGDVDAGRVRQLADETFGTLPRGPDLPARQNTKRIVALTDPRVTVPSFQ
MPPB_YEAST      RTDLKDYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHVPKSESPVPLGSPRGPLPVKENTLP----T
MPPB_NEUCR      RTELVNYIKNNYTADRMVLVGAGGVPHEQLVEMADKYFSKLPATAPVSSASILSKKKPGSDIRIDDTIPT
MPPB_MOUSE      RKDLVDYITTHYKGPRIVLAAAGGVCHNELLELAKHFGDSLCSKGAIPALPPCKFT--GSEIRVRDDKMP
MPPB_BOVIN      RKDLVDYITTHYKGPRIVLAAAGGVSHDELLELAKHFGESLSTHKGEPALPPCKFT--GSEIRVRDDKMP
MPPB_ARATH      REDLQNYIKTHYTASRMVIAAAGA----------------------------------------------
MPPB_RAT        RKDLVDYITTHYKGPRIVLAAAGGVCHNELLELAK-----------------------------------
MPPB_PONAB      RKDLVDYITTHYKGPRIVLAAAGGVSHDELLDLAK-----------------------------------
MPPB_HUMAN      RKDLVDYITTHYKGPRIVLAAAGGVSHDELLDLAK-----------------------------------


                         .         *         .         .         .         .         +:350
query           ASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTK
Y4WB_RHISN      AQLSLAYPGIPRKDPQFFAANLMNQILGGGAFTSRLWNEVREKRGLAYGIYSTLENIDHASALVIGTGTR
YMXG_BACSU      AHLCLGFKGLEVGHERIYDLIVLNNVLGGS-MSSRLFQDVREDKGLAYSVYSYHSSYEDSGMLTIYGGTG
Y293_RICCN      TSLVLGFEGTSYINLEKLYQTHLLSIIFGGGMSSRLFQSIREKLGLAYAVGSYNSAYFDSGVFTIYASTA
Y855_MYCLE      THVLLGVRTPGRSWEHRWALSVLHTALGGG-LSSRLFQEIRETRGLAYSVYSALDIFADSGALSVYAACL
Y5738_STRCO     AHVILGMPGLARTDERRWAMGVLNTALGGG-MSSRLFQEVREKRGLAYSVYSYTSGFADCGLFGVYAGCR
Y522_RICBR      TTLILGFEGTSYINLERLYQTQLLAIIFGGGMSSRLFQHIREKLGLAYAVGSYNSPYFDSGVFTIYAST-
Y210_RICTY      TSLVLGFECTSYINLEKLYQTYLLSIIFGGGVSSRLFQSIREKLGLAYVVGSYNSAYFDSGVFTIYASTA
Y338_RICFE      TTLILGFEGTPYINLERLYRTQLLAIIFGGGMSSRLFQHIREKLGLAYAVGSYNSTYSDSGVFTIYAST-
Y219_RICPR      TSLVLGFECTSYINLGQLYQTYLLSIIFGGGMSSRLFQSIREKLGLAYVVGSYNSAYFDSGVFTIYAST-
Y2805_MYCBO     THVSLGIRTPGRGWEHRWALSVLHTALGGG-LSSRLFQEVRETRGLAYSVYSALDLFADSGALSVYAACL
Y2782_MYCTU     THVSLGIRTPGRGWEHRWALSVLHTALGGG-LSSRLFQEVRETRGLAYSVYSALDLFADSGALSVYAACL
MPPB_LENED      AHVAIAVEGVGWSSPDYFP---------------------------------------------------
MPPB_BLAEM      AHIALAVEGASWTSADHWPLLVASAMIGSYDRSSKLA-QIVAKHNLANSFTSFNTTYSDTGLWGIYIQSN
MPPB_SCHPO      ANIAIAVEGMSWKHPDYF----------------------------------------------------
Y4WA_RHISN      KSVTTSYGTAEQGEAEALDILSEILGGGT---RSRIYQELVVKQAIASSGGAYFNRSLDPSSFTVFGSPR
MPPB_YEAST      THIAIALEGVSWSAPDYF----------------------------------------------------
MPPB_NEUCR      ANIAIAVEGVSWSDDDYF----------------------------------------------------
MPPB_MOUSE      AHLAIAVEAVGWAHPDTLIGNWDRSFGGGMNLSSKLA-QLTCHGNLCHSFQSFNTSYTDTGLWGLYMVCE
MPPB_BOVIN      AHLAVAVEAVGWAHPDTLIGNWDRSFGGGMNLSSKLA-QLTCHGNLCHSFQSFNTSYTDTGLWGIYMVCE
MPPB_ARATH      ----------------------------------------------------------------------
MPPB_RAT        ----------------------------------------------------------------------
MPPB_PONAB      ----------------------------------------------------------------------
MPPB_HUMAN      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWT
Y4WB_RHISN      PDRAAETLSLIQAEVRRMSEEGVSEDELTAAKKKLIGGYAINLNSSSAVAQTLVQIQLEDRGIEYVERRK
YMXG_BACSU      ANQLQQLSETIQETLATLKRDGITSKELENSKEQMKGSLMLSLESNSKMSRNGKNELLLG-KHKTLDEII
Y293_RICCN      HDKLELLYKEIKNEIIKMTEQVSTEEILRA----------------------------------------
Y855_MYCLE      PGRFADVMQVISEVLASVAGDGITEAECRIAKGSLRGGIILGLEDSNSWMSRLGNYGKY----RGIEHTL
Y5738_STRCO     PSQVHDVLKICRDELDHVAEHGLTDDEIGRAVGQLQGSTVLGLEDTGALMNRIGKSELCWGEQMSVDDML
Y522_RICBR      ----------------------------------------------------------------------
Y210_RICTY      HEKL-ELLYSXXXXXXXXXXXXVSTEELMRAKIQLRSNLQMAQEQNEEIGKNYSVFGKYILPEEIIEIIT
Y338_RICFE      ----------------------------------------------------------------------
Y219_RICPR      AHNKLELLYRXXXXXXXXXXXXVSTEEIIRAKMQLRSNLQMAQEQNEEIGKNYSVFGKYILPEEIIEIIT
Y2805_MYCBO     PERFADVMRVTADVLESVARDGITEAECGIAKGSLRGGLVLGLEDSSSRMSRLGRSELNYGKHRSIEHTL
Y2782_MYCTU     PERFADVMRVTADVLESVARDGITEAECGIAKGSLRGGLVLGLEDSSSRMSRLGRSELNYGKHRSIEHTL
MPPB_LENED      ----------------------------------------------------------------------
MPPB_BLAEM      NRDNLDDLATVREWMR--LATAPSEGEVAIAKQQLKTSLLLALDGTTPVAEEIGQMLAYGRRLSPFEI-D
MPPB_SCHPO      ----------------------------------------------------------------------
Y4WA_RHISN      GXXXXXXXXXXXXXXXRKIIEGITDVELEKAKNRFVRSIIFARDSQSGM------AGIYGAALATGDT--
MPPB_YEAST      ----------------------------------------------------------------------
MPPB_NEUCR      ----------------------------------------------------------------------
MPPB_MOUSE      QATVADMLHVVQN-EWKRLCTDVTESEVARAKNLLKTNMLLQLDGSTPICEDIGQMLCYNIPIPELE---
MPPB_BOVIN      PATVADMLHVVQKEWMR-LCTSVTESEVARAKNLLKTNMLLQLDGSTPICEDIGQMLCYNIPIPELE---
MPPB_ARATH      ----------------------------------------------------------------------
MPPB_RAT        ----------------------------------------------------------------------
MPPB_PONAB      ----------------------------------------------------------------------
MPPB_HUMAN      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SQINKVTREQVRAAFQRHVHPDAMATVIVGGPEK
Y4WB_RHISN      QLIQAVTVEDVRAVAKRLLSAD--PTVMTVGP--
YMXG_BACSU      NELNAVNLERVNGARQLFTEDYALALISPSG---
Y293_RICCN      ----------------------------------
Y855_MYCLE      QQIDEVTVEQVNA---------------------
Y5738_STRCO     ARIASVTPDDVRA---------------------
Y522_RICBR      ----------------------------------
Y210_RICTY      N---------------------------------
Y338_RICFE      ----------------------------------
Y219_RICPR      N---------------------------------
Y2805_MYCBO     RQIEQVTVEEVNAV-ARHLLSRRYGAAVLG----
Y2782_MYCTU     RQIEQVTVEEVNAV-ARHLLSRRYGAAVLG----
MPPB_LENED      ----------------------------------
MPPB_BLAEM      RLVDAVTVEDVKRVANEFIYDRDLAIVAVGPVE-
MPPB_SCHPO      ----------------------------------
Y4WA_RHISN      ----------------------------------
MPPB_YEAST      ----------------------------------
MPPB_NEUCR      ----------------------------------
MPPB_MOUSE      ARIDAVDAETVRRVCTKYIHDKSPAIAALGPIER
MPPB_BOVIN      ARIDAVNAEIIREVCTKYIYDKSPAVAAVGPIEQ
MPPB_ARATH      ----------------------------------
MPPB_RAT        ----------------------------------
MPPB_PONAB      ----------------------------------
MPPB_HUMAN      ----------------------------------