[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07569.1

[Show Plain Result]


## Summary of Sequence Search
    1::224
   13::175     4e-21  36%  177 aa  Y2166_ALISL RecName: Full=UPF0115 protein VSAL_I2166;
   14::175     3e-19  34%  176 aa  Y3116_VIBHB RecName: Full=UPF0115 protein VIBHAR_03116;
   13::175     4e-19  35%  177 aa  Y1940_VIBFM RecName: Full=UPF0115 protein VFMJ11_1940;
   13::175     4e-19  35%  177 aa  Y1807_VIBF1 RecName: Full=UPF0115 protein VF_1807;
   13::172     9e-19  35%  174 aa  Y2181_TOLAT RecName: Full=UPF0115 protein Tola_2181;
   14::167     1e-18  38%  176 aa  Y379_YERPG RecName: Full=UPF0115 protein YpAngola_A0379;
   14::167     1e-18  38%  176 aa  Y2749_YERPE RecName: Full=UPF0115 protein YPO2749/y1583/YP_2414;
   14::167     1e-18  38%  176 aa  Y1403_YERP3 RecName: Full=UPF0115 protein YpsIP31758_1403;
   14::172     3e-18  35%  183 aa  YFCN_ECO5E RecName: Full=UPF0115 protein yfcN;
   14::172     3e-18  35%  183 aa  YFCN_ECO57 RecName: Full=UPF0115 protein yfcN;
   14::175     3e-18  33%  176 aa  Y2204_VIBPA RecName: Full=UPF0115 protein VP2204;
   13::175     3e-18  33%  176 aa  Y1979_VIBVU RecName: Full=UPF0115 protein VV1_1979;
   14::172     3e-18  37%  176 aa  Y1279_YERE8 RecName: Full=UPF0115 protein YE1279;
   13::175     6e-18  33%  176 aa  Y2436_VIBVY RecName: Full=UPF0115 protein VV2436;
   23::185     8e-18  33%  186 aa  Y2901_VIBC3 RecName: Full=UPF0115 protein VC0395_A1701;
   23::185     8e-18  33%  186 aa  Y2119_VIBCH RecName: Full=UPF0115 protein VC_2119;
   23::185     8e-18  33%  186 aa  Y2042_VIBCM RecName: Full=UPF0115 protein VCM66_2042;
   14::172     1e-17  34%  183 aa  YFCN_SHIFL RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_SHIF8 RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_SHIBS RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_SHIB3 RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ESCF3 RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECOUT RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECOSM RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECOSE RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECOLU RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECOLI RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECOLC RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECOL6 RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECOL5 RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECOHS RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECODH RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECOBW RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECO8A RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECO81 RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECO55 RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECO45 RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECO27 RecName: Full=UPF0115 protein yfcN;
   14::172     1e-17  34%  183 aa  YFCN_ECO24 RecName: Full=UPF0115 protein yfcN;
   14::172     2e-17  34%  183 aa  Y454_CITK8 RecName: Full=UPF0115 protein CKO_00454;
   14::164     2e-17  36%  180 aa  Y3071_ERWCT RecName: Full=UPF0115 protein ECA3071;
   14::164     2e-17  36%  180 aa  Y2813_PECCP RecName: Full=UPF0115 protein PC1_2813;
   14::172     2e-17  34%  183 aa  YFCN_SHISS RecName: Full=UPF0115 protein yfcN;
   14::172     2e-17  34%  183 aa  YFCN_SHIDS RecName: Full=UPF0115 protein yfcN;
   14::172     2e-17  34%  183 aa  YFCN_ECO7I RecName: Full=UPF0115 protein yfcN;
   54::175     2e-17  40%  176 aa  Y966_PHOPR RecName: Full=UPF0115 protein PBPRA0966;
   13::172     2e-17  34%  183 aa  Y2879_ENT38 RecName: Full=UPF0115 protein Ent638_2879;
   14::172     5e-17  33%  183 aa  Y2677_KLEP7 RecName: Full=UPF0115 protein KPN78578_26770;
   14::172     1e-16  32%  176 aa  Y3376_SERP5 RecName: Full=UPF0115 protein Spro_3376;
   35::172     2e-16  36%  183 aa  Y1152_ERWT9 RecName: Full=UPF0115 protein ETA_11520;
   14::172     3e-16  32%  183 aa  YFCN_SALTY RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALTI RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALSV RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALPK RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALPC RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALPB RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALPA RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALNS RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALHS RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALG2 RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALEP RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALDC RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  32%  183 aa  YFCN_SALA4 RecName: Full=UPF0115 protein yfcN;
   14::172     3e-16  33%  183 aa  Y1418_KLEP3 RecName: Full=UPF0115 protein KPK_1418;
   60::167     6e-16  42%  176 aa  Y1467_SHESA RecName: Full=UPF0115 protein Shewana3_1467;
   14::172     7e-16  32%  183 aa  YFCN_SALAR RecName: Full=UPF0115 protein yfcN;
   27::172     7e-16  34%  180 aa  Y1805_PROMH RecName: Full=UPF0115 protein PMI1805;
   60::167     1e-15  42%  176 aa  Y3081_SHEON RecName: Full=UPF0115 protein SO_3081;
   60::167     1e-15  42%  176 aa  Y1414_SHESM RecName: Full=UPF0115 protein Shewmr4_1414;
   60::167     2e-15  42%  176 aa  Y2848_SHEB9 RecName: Full=UPF0115 protein Sbal195_2848;
   60::167     2e-15  41%  176 aa  Y1555_SHESW RecName: Full=UPF0115 protein Sputw3181_1555;
   60::167     3e-15  41%  176 aa  Y2771_SHEB8 RecName: Full=UPF0115 protein Shew185_2771;
   60::167     3e-15  41%  176 aa  Y2754_SHEB5 RecName: Full=UPF0115 protein Sbal_2754;
   60::167     3e-15  41%  176 aa  Y1605_SHEB2 RecName: Full=UPF0115 protein Sbal223_1605;
   60::167     6e-15  40%  176 aa  Y2453_SHEPC RecName: Full=UPF0115 protein Sputcn32_2453;
   45::170     8e-15  32%  187 aa  YDAL_ECOLI RecName: Full=Uncharacterized protein ydaL;
    9::165     1e-14  31%  168 aa  Y391_PASMU RecName: Full=UPF0115 protein PM0391;
    9::171     1e-14  32%  177 aa  Y1679_HAEDU RecName: Full=UPF0115 protein HD_1679;
   14::173     2e-14  30%  178 aa  Y3198_PHOLL RecName: Full=UPF0115 protein plu3198;
   82::172     2e-12  37%  176 aa  Y092_BUCBP RecName: Full=UPF0115 protein bbp_092;
    6::165     8e-12  28%  167 aa  Y1202_HAEIN RecName: Full=UPF0115 protein HI1202;
   82::172     8e-12  34%  176 aa  Y091_BUCAP RecName: Full=UPF0115 protein BUsg_091;
   37::173     1e-11  28%  186 aa  Y098_BUCAI RecName: Full=UPF0115 protein BU098;
   37::173     1e-11  28%  186 aa  Y096_BUCA5 RecName: Full=UPF0115 protein BUAP5A_096;
   83::173     4e-11  32%  186 aa  Y097_BUCAT RecName: Full=UPF0115 protein BUAPTUC7_097;
   48::170     7e-11  31%  174 aa  Y2357_AERHH RecName: Full=UPF0115 protein AHA_2357;
  671::778     1e-08  36%  779 aa  MUTS2_STRA5 RecName: Full=MutS2 protein;
  671::778     1e-08  36%  779 aa  MUTS2_STRA3 RecName: Full=MutS2 protein;
  671::778     1e-08  36%  779 aa  MUTS2_STRA1 RecName: Full=MutS2 protein;
  672::777     2e-08  32%  777 aa  MUTS2_STRSV RecName: Full=MutS2 protein;
  672::777     2e-08  31%  777 aa  MUTS2_STRGC RecName: Full=MutS2 protein;
  700::778     4e-08  37%  779 aa  MUTS2_STRPZ RecName: Full=MutS2 protein;
  698::777     6e-08  35%  778 aa  MUTS2_STRZP RecName: Full=MutS2 protein;
  698::777     6e-08  35%  778 aa  MUTS2_STRZJ RecName: Full=MutS2 protein;
  698::777     6e-08  35%  778 aa  MUTS2_STRR6 RecName: Full=MutS2 protein;
  698::777     6e-08  35%  778 aa  MUTS2_STRPS RecName: Full=MutS2 protein;
  698::777     6e-08  35%  778 aa  MUTS2_STRPN RecName: Full=MutS2 protein;
  698::777     6e-08  35%  778 aa  MUTS2_STRPJ RecName: Full=MutS2 protein;
  698::777     6e-08  35%  778 aa  MUTS2_STRPI RecName: Full=MutS2 protein;
  698::777     6e-08  35%  778 aa  MUTS2_STRP7 RecName: Full=MutS2 protein;
  698::777     6e-08  35%  778 aa  MUTS2_STRP4 RecName: Full=MutS2 protein;
  698::777     6e-08  35%  778 aa  MUTS2_STRP2 RecName: Full=MutS2 protein;
  691::776     6e-08  33%  776 aa  MUTS2_STRMU RecName: Full=MutS2 protein;
  700::778     7e-08  35%  779 aa  MUTS2_STRP1 RecName: Full=MutS2 protein;
  700::778     9e-08  35%  779 aa  MUTS2_STRPG RecName: Full=MutS2 protein;
  700::778     9e-08  35%  779 aa  MUTS2_STRP8 RecName: Full=MutS2 protein;
  698::777     1e-07  35%  778 aa  MUTS2_STRZT RecName: Full=MutS2 protein;
  698::773     2e-07  38%  773 aa  MUTS2_DESMR RecName: Full=MutS2 protein;
  713::790     3e-07  36%  792 aa  MUTS2_THERP RecName: Full=MutS2 protein;
  704::782     5e-07  34%  783 aa  MUTS2_STRTD RecName: Full=MutS2 protein;
  704::782     5e-07  34%  783 aa  MUTS2_STRT2 RecName: Full=MutS2 protein;
  704::782     5e-07  34%  783 aa  MUTS2_STRT1 RecName: Full=MutS2 protein;
  698::776     6e-07  33%  777 aa  MUTS2_STRU0 RecName: Full=MutS2 protein;
  712::788     1e-06  34%  788 aa  MUTS2_LACJO RecName: Full=MutS2 protein;
  748::818     1e-06  38%  819 aa  MUTS2_GEMAT RecName: Full=MutS2 protein;
  715::791     1e-06  35%  791 aa  MUTS2_LACGA RecName: Full=MutS2 protein;
  699::778     2e-06  30%  778 aa  MUTS2_STRSY RecName: Full=MutS2 protein;
  699::777     2e-06  33%  778 aa  MUTS2_STRS7 RecName: Full=MutS2 protein;
  699::778     2e-06  30%  778 aa  MUTS2_STRS2 RecName: Full=MutS2 protein;
  699::777     2e-06  33%  778 aa  MUTS2_STREM RecName: Full=MutS2 protein;
  699::777     2e-06  33%  778 aa  MUTS2_STRE4 RecName: Full=MutS2 protein;
  706::782     2e-06  34%  782 aa  MUTS2_STAS1 RecName: Full=MutS2 protein;
  685::793     3e-06  31%  793 aa  MUTS2_CLOTH RecName: Full=MutS2 protein;
  701::777     4e-06  36%  777 aa  MUTS2_CARHZ RecName: Full=MutS2 protein;
  677::768     5e-06  33%  769 aa  MUTS2_DESAD RecName: Full=MutS2 protein;
  706::782     7e-06  34%  782 aa  MUTS2_STACT RecName: Full=MutS2 protein;
  638::784     7e-06  31%  784 aa  MUTS2_GEOKA RecName: Full=MutS2 protein;
  678::786     7e-06  28%  787 aa  MUTS2_CALS8 RecName: Full=MutS2 protein;
  669::785     9e-06  32%  785 aa  MUTS2_LACAC RecName: Full=MutS2 protein;
  739::817     1e-05  33%  818 aa  MUTS2_TREDE RecName: Full=MutS2 protein;
  696::783     1e-05  31%  786 aa  MUTS2_LACCB RecName: Full=MutS2 protein;
  696::783     1e-05  31%  786 aa  MUTS2_LACC3 RecName: Full=MutS2 protein;
  707::783     1e-05  32%  783 aa  MUTS2_FINM2 RecName: Full=MutS2 protein;
  645::789     1e-05  26%  789 aa  MUTS2_ALKMQ RecName: Full=MutS2 protein;
  709::785     2e-05  36%  785 aa  MUTS2_LACH4 RecName: Full=MutS2 protein;
  700::778     2e-05  34%  778 aa  MUTS2_FUSNN RecName: Full=MutS2 protein;
  697::782     3e-05  31%  782 aa  MUTS2_STAEQ RecName: Full=MutS2 protein;
  708::784     3e-05  34%  784 aa  MUTS2_GEOTN RecName: Full=MutS2 protein;
  716::756     3e-05  49%  793 aa  MUTS2_SYMTH RecName: Full=MutS2 protein;
  712::785     3e-05  31%  788 aa  MUTS2_ENTFA RecName: Full=MutS2 protein;
  710::785     3e-05  33%  785 aa  MUTS2_CLONN RecName: Full=MutS2 protein;
  711::786     4e-05  33%  786 aa  MUTS2_LACS1 RecName: Full=MutS2 protein;
  715::790     4e-05  30%  791 aa  MUTS2_HALOH RecName: Full=MutS2 protein;
  697::782     6e-05  30%  782 aa  MUTS2_STAES RecName: Full=MutS2 protein;
  722::800     6e-05  33%  800 aa  MUTS2_LEUMM RecName: Full=MutS2 protein;
  701::785     6e-05  31%  785 aa  MUTS2_BREBN RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAAW RecName: Full=MutS2 protein;
  634::719     7e-05  30%  719 aa  MUTS2_STAAU RecName: Full=MutS2 protein;Flags: Fragment;
  697::782     7e-05  30%  782 aa  MUTS2_STAAT RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAAS RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAAR RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAAN RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAAM RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAAE RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAAC RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAAB RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAA9 RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAA8 RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAA3 RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAA2 RecName: Full=MutS2 protein;
  697::782     7e-05  30%  782 aa  MUTS2_STAA1 RecName: Full=MutS2 protein;
  723::800     7e-05  33%  801 aa  MUTS2_LEUCK RecName: Full=MutS2 protein;
  712::784     7e-05  30%  787 aa  MUTS2_LACPL RecName: Full=MutS2 protein;
  706::778     7e-05  32%  780 aa  MUTS2_BORBU RecName: Full=MutS2 protein;
  711::786     7e-05  32%  787 aa  MUTS2_ANATD RecName: Full=MutS2 protein;
  710::782     1e-04  32%  785 aa  MUTS2_PEDPA RecName: Full=MutS2 protein;
  683::790     1e-04  27%  790 aa  MUTS2_ALKOO RecName: Full=MutS2 protein;
  640::784     2e-04  29%  784 aa  MUTS2_GEOSW RecName: Full=MutS2 protein;
   73::132     3e-04  32%  206 aa  YLL3_SCHPO RecName: Full=Smr domain-containing protein C11H11.03c;
  105::197     3e-04  28%  202 aa  Y674_TREPA RecName: Full=Uncharacterized protein TP_0674;
  711::787     3e-04  27%  787 aa  MUTS2_LACSS RecName: Full=MutS2 protein;
  711::786     3e-04  32%  786 aa  MUTS2_CLOK5 RecName: Full=MutS2 protein;
  711::786     3e-04  32%  786 aa  MUTS2_CLOK1 RecName: Full=MutS2 protein;
  668::792     3e-04  27%  792 aa  MUTS2_CLOCE RecName: Full=MutS2 protein;
  707::785     3e-04  30%  786 aa  MUTS2_CLOB8 RecName: Full=MutS2 protein;
  705::783     4e-04  32%  783 aa  MUTS2_STAHJ RecName: Full=MutS2 protein;
  687::762     4e-04  32%  762 aa  MUTS2_HELPY RecName: Full=MutS2 protein;
  687::762     4e-04  32%  762 aa  MUTS2_HELPJ RecName: Full=MutS2 protein;
  709::785     4e-04  32%  785 aa  MUTS2_BACHD RecName: Full=MutS2 protein;
  712::784     5e-04  30%  787 aa  MUTS2_LACBA RecName: Full=MutS2 protein;
  713::787     8e-04  29%  790 aa  MUTS2_THETN RecName: Full=MutS2 protein;
  687::759     8e-04  29%  763 aa  MUTS2_SULSY RecName: Full=MutS2 protein;
  695::787     8e-04  25%  787 aa  MUTS2_BACSK RecName: Full=MutS2 protein;
    1::224

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNVFRTSIGQVSNLRDRNR
Y2166_ALISL     ----------------------------------------------------SLFREAVQGSKKLRQDTI
Y3116_VIBHB     -----------------------------------------------------LFKDAVQGVKKLRQDTI
Y1940_VIBFM     ----------------------------------------------------SLFREAVQGSKKLQQDTI
Y1807_VIBF1     ----------------------------------------------------SLFREAVQGSKKLQQDTI
Y2181_TOLAT     ----------------------------------------------------SLFREAIAGARPIKDTIR
Y379_YERPG      -----------------------------------------------------LFKESIAGAKKLRQDTI
Y2749_YERPE     -----------------------------------------------------LFKESIAGAKKLRQDTI
Y1403_YERP3     -----------------------------------------------------LFKESIAGAKKLRQDTI
YFCN_ECO5E      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECO57      -----------------------------------------------------LFRQLMAGTRKIKQDTI
Y2204_VIBPA     -----------------------------------------------------LFKEAVQGVKKLRQDTI
Y1979_VIBVU     ----------------------------------------------------SLFREAVQGIKKLPQDTI
Y1279_YERE8     -----------------------------------------------------LFKESIAGAKKLKQDTI
Y2436_VIBVY     ----------------------------------------------------SLFREAVQGIKKLPQDTI
Y2901_VIBC3     ----------------------------------------------------SLFRDEVKGVKKLRQDTI
Y2119_VIBCH     ----------------------------------------------------SLFRDEVKGVKKLRQDTI
Y2042_VIBCM     ----------------------------------------------------SLFRDEVKGVKKLRQDTI
YFCN_SHIFL      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_SHIF8      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_SHIBS      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_SHIB3      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ESCF3      -----------------------------------------------------LFRQLMAGTRQIKQDTI
YFCN_ECOUT      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECOSM      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECOSE      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECOLU      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECOLI      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECOLC      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECOL6      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECOL5      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECOHS      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECODH      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECOBW      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECO8A      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECO81      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECO55      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECO45      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECO27      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECO24      -----------------------------------------------------LFRQLMAGTRKIKQDTI
Y454_CITK8      -----------------------------------------------------LFRQLMTGTRQIKQDTI
Y3071_ERWCT     -----------------------------------------------------LFRTSITGTKKLRQDTY
Y2813_PECCP     -----------------------------------------------------LFRTSITGTKKLRQDTY
YFCN_SHISS      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_SHIDS      -----------------------------------------------------LFRQLMAGTRKIKQDTI
YFCN_ECO7I      -----------------------------------------------------LFRQLMAGTRKIKQDTI
Y966_PHOPR      ----------------------------------------------------------------------
Y2879_ENT38     ----------------------------------------------------SLFRQLMSGTRQIAQDTI
Y2677_KLEP7     -----------------------------------------------------LFRQLMTGTRKIKQDTI
Y3376_SERP5     -----------------------------------------------------LFRESVVDAKKLR-QDT
Y1152_ERWT9     ----------------------------------------------------------------------
YFCN_SALTY      -----------------------------------------------------LFRQLMVGTRKIKQDTI
YFCN_SALTI      -----------------------------------------------------LFRQLMVGTRKIKQDTI
YFCN_SALSV      -----------------------------------------------------LFRQLMVGTRKIKQDTI
YFCN_SALPK      -----------------------------------------------------LFRQLMVGTRQIKQDTI
YFCN_SALPC      -----------------------------------------------------LFRQLMVGTRKIKQDTI
YFCN_SALPB      -----------------------------------------------------LFRQLMVGTRKIKQDTI
YFCN_SALPA      -----------------------------------------------------LFRQLMVGTRQIKQDTI
YFCN_SALNS      -----------------------------------------------------LFRQLMVGTRKIKQDTI
YFCN_SALHS      -----------------------------------------------------LFRQLMVGTRKIKQDTI
YFCN_SALG2      -----------------------------------------------------LFRQLMVGTRKIKQDTI
YFCN_SALEP      -----------------------------------------------------LFRQLMVGTRKIKQDTI
YFCN_SALDC      -----------------------------------------------------LFRQLMVGTRKIKQDTI
YFCN_SALA4      -----------------------------------------------------LFRQLMVGTRKIKQDTI
Y1418_KLEP3     -----------------------------------------------------LFRQLMTGTRKIKQDTI
Y1467_SHESA     ----------------------------------------------------------------------
YFCN_SALAR      -----------------------------------------------------LFRQLMVGTRQIKQDTI
Y1805_PROMH     -----------------------------------------------------------------QDKIR
Y3081_SHEON     ----------------------------------------------------------------------
Y1414_SHESM     ----------------------------------------------------------------------
Y2848_SHEB9     ----------------------------------------------------------------------
Y1555_SHESW     ----------------------------------------------------------------------
Y2771_SHEB8     ----------------------------------------------------------------------
Y2754_SHEB5     ----------------------------------------------------------------------
Y1605_SHEB2     ----------------------------------------------------------------------
Y2453_SHEPC     ----------------------------------------------------------------------
YDAL_ECOLI      ----------------------------------------------------------------------
Y391_PASMU      -----------------------------------------------------LFRGAVKGVKALKQDKF
Y1679_HAEDU     -----------------------------------------------------LFRTAIKGTKKIKQDTF
Y3198_PHOLL     ----------------------------------------------------HLFQQSVAGTKRINQDTV
Y092_BUCBP      ----------------------------------------------------------------------
Y1202_HAEIN     ----------------------------------------------------DLFRTETKGIKPIKQDTF
Y091_BUCAP      ----------------------------------------------------------------------
Y098_BUCAI      ----------------------------------------------------------------------
Y096_BUCA5      ----------------------------------------------------------------------
Y097_BUCAT      ----------------------------------------------------------------------
Y2357_AERHH     ----------------------------------------------------------------------
MUTS2_STRA5     ----------------------------------------------------------------------
MUTS2_STRA3     ----------------------------------------------------------------------
MUTS2_STRA1     ----------------------------------------------------------------------
MUTS2_STRSV     ----------------------------------------------------------------------
MUTS2_STRGC     ----------------------------------------------------------------------
MUTS2_STRPZ     ----------------------------------------------------------------------
MUTS2_STRZP     ----------------------------------------------------------------------
MUTS2_STRZJ     ----------------------------------------------------------------------
MUTS2_STRR6     ----------------------------------------------------------------------
MUTS2_STRPS     ----------------------------------------------------------------------
MUTS2_STRPN     ----------------------------------------------------------------------
MUTS2_STRPJ     ----------------------------------------------------------------------
MUTS2_STRPI     ----------------------------------------------------------------------
MUTS2_STRP7     ----------------------------------------------------------------------
MUTS2_STRP4     ----------------------------------------------------------------------
MUTS2_STRP2     ----------------------------------------------------------------------
MUTS2_STRMU     ----------------------------------------------------------------------
MUTS2_STRP1     ----------------------------------------------------------------------
MUTS2_STRPG     ----------------------------------------------------------------------
MUTS2_STRP8     ----------------------------------------------------------------------
MUTS2_STRZT     ----------------------------------------------------------------------
MUTS2_DESMR     ----------------------------------------------------------------------
MUTS2_THERP     ----------------------------------------------------------------------
MUTS2_STRTD     ----------------------------------------------------------------------
MUTS2_STRT2     ----------------------------------------------------------------------
MUTS2_STRT1     ----------------------------------------------------------------------
MUTS2_STRU0     ----------------------------------------------------------------------
MUTS2_LACJO     ----------------------------------------------------------------------
MUTS2_GEMAT     ----------------------------------------------------------------------
MUTS2_LACGA     ----------------------------------------------------------------------
MUTS2_STRSY     ----------------------------------------------------------------------
MUTS2_STRS7     ----------------------------------------------------------------------
MUTS2_STRS2     ----------------------------------------------------------------------
MUTS2_STREM     ----------------------------------------------------------------------
MUTS2_STRE4     ----------------------------------------------------------------------
MUTS2_STAS1     ----------------------------------------------------------------------
MUTS2_CLOTH     ----------------------------------------------------------------------
MUTS2_CARHZ     ----------------------------------------------------------------------
MUTS2_DESAD     ----------------------------------------------------------------------
MUTS2_STACT     ----------------------------------------------------------------------
MUTS2_GEOKA     ----------------------------------------------------------------------
MUTS2_CALS8     ----------------------------------------------------------------------
MUTS2_LACAC     ----------------------------------------------------------------------
MUTS2_TREDE     ----------------------------------------------------------------------
MUTS2_LACCB     ----------------------------------------------------------------------
MUTS2_LACC3     ----------------------------------------------------------------------
MUTS2_FINM2     ----------------------------------------------------------------------
MUTS2_ALKMQ     -----------------------------------------------------------GDAVRILSLNQ
MUTS2_LACH4     ----------------------------------------------------------------------
MUTS2_FUSNN     ----------------------------------------------------------------------
MUTS2_STAEQ     ----------------------------------------------------------------------
MUTS2_GEOTN     ----------------------------------------------------------------------
MUTS2_SYMTH     ----------------------------------------------------------------------
MUTS2_ENTFA     ----------------------------------------------------------------------
MUTS2_CLONN     ----------------------------------------------------------------------
MUTS2_LACS1     ----------------------------------------------------------------------
MUTS2_HALOH     ----------------------------------------------------------------------
MUTS2_STAES     ----------------------------------------------------------------------
MUTS2_LEUMM     ----------------------------------------------------------------------
MUTS2_BREBN     ----------------------------------------------------------------------
MUTS2_STAAW     ----------------------------------------------------------------------
MUTS2_STAAU     ----------------------------------------------------------------------
MUTS2_STAAT     ----------------------------------------------------------------------
MUTS2_STAAS     ----------------------------------------------------------------------
MUTS2_STAAR     ----------------------------------------------------------------------
MUTS2_STAAN     ----------------------------------------------------------------------
MUTS2_STAAM     ----------------------------------------------------------------------
MUTS2_STAAE     ----------------------------------------------------------------------
MUTS2_STAAC     ----------------------------------------------------------------------
MUTS2_STAAB     ----------------------------------------------------------------------
MUTS2_STAA9     ----------------------------------------------------------------------
MUTS2_STAA8     ----------------------------------------------------------------------
MUTS2_STAA3     ----------------------------------------------------------------------
MUTS2_STAA2     ----------------------------------------------------------------------
MUTS2_STAA1     ----------------------------------------------------------------------
MUTS2_LEUCK     ----------------------------------------------------------------------
MUTS2_LACPL     ----------------------------------------------------------------------
MUTS2_BORBU     ----------------------------------------------------------------------
MUTS2_ANATD     ----------------------------------------------------------------------
MUTS2_PEDPA     ----------------------------------------------------------------------
MUTS2_ALKOO     ----------------------------------------------------------------------
MUTS2_GEOSW     ----------------------------------------------------------------------
YLL3_SCHPO      ----------------------------------------------------------------------
Y674_TREPA      ----------------------------------------------------------------------
MUTS2_LACSS     ----------------------------------------------------------------------
MUTS2_CLOK5     ----------------------------------------------------------------------
MUTS2_CLOK1     ----------------------------------------------------------------------
MUTS2_CLOCE     ----------------------------------------------------------------------
MUTS2_CLOB8     ----------------------------------------------------------------------
MUTS2_STAHJ     ----------------------------------------------------------------------
MUTS2_HELPY     ----------------------------------------------------------------------
MUTS2_HELPJ     ----------------------------------------------------------------------
MUTS2_BACHD     ----------------------------------------------------------------------
MUTS2_LACBA     ----------------------------------------------------------------------
MUTS2_THETN     ----------------------------------------------------------------------
MUTS2_SULSY     ----------------------------------------------------------------------
MUTS2_BACSK     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VEHPVKKPNPEPVQTRLNDKAVLEASLSDEFDVENLLDVDETMSFRRPGIGEDVIKKLRRGEWVPQDKVD
Y2166_ALISL     IHQPSKNFSEQQKQRKLKEGKNEEFFFSDEF--VPLLNEDGPVRYARDGVSKYEVKRLRRGVYVPDVFLD
Y3116_VIBHB     IQQPKKNTKQKEITRSNREASDSEFYFSDEF--VPLLNADGPTRYARDDVSTYEVKRLRRGVYVPDVFLD
Y1940_VIBFM     IHQPSKNFSDLQQQRKLKEGKNEEFFFSDEF--VPLLSEDGPIRYARDDVSKYEVKRLRRGVYVPDVFLD
Y1807_VIBF1     IHQPSKNFSDLQQQRKLKEGKNEEFFFSDEF--VPLLSEDGPIRYARDDVSKYEVKRLRRGVYVPDVFLD
Y2181_TOLAT     LHSPAIKQKAQIREIRETQQAL--HYFSDEY--EPLLNQDGPVKYCRADVSTYEVKKLRRGDYIPDMMLD
Y379_YERPG      VHHTPPKLGKKIAPERLLQEQV-DASFSDEF--QPLLDTDGPTRYVRPGVDNFEVKKLRRGDYSPEMFLD
Y2749_YERPE     VHHTPPKLGKKIAPERLLQEQV-DASFSDEF--QPLLDTDGPTRYVRPGVDNFEVKKLRRGDYSPEMFLD
Y1403_YERP3     VHHTPPKLGKKIAPERLLQEQV-DASFSDEF--QPLLDTDGPTRYVRPGVDNFEVKKLRRGDYSPEMFLD
YFCN_ECO5E      VHRPQRKKVSEPVKRLIQEQVDASHYFSDEF--QPLLNADGPVKYVRPGVDHFEAKKLRRGDYSPELFLD
YFCN_ECO57      VHRPQRKKVSEPVKRLIQEQVDASHYFSDEF--QPLLNADGPVKYVRPGVDHFEAKKLRRGDYSPELFLD
Y2204_VIBPA     IQQPKKNTKQKEIKRSNREASDSEFYFSDEFVPR--LNEEGPTRYARDDVSTYEVKRLRRGVYVPDVFLD
Y1979_VIBVU     VQQPNRNTKQKEIKRISREASDSEFYFSDEF--VPLLNEEGPTRYARDDVSTYEVKRLRRGVYVPDVFLD
Y1279_YERE8     VHRSPPKLGKKIAPERLLQEQV-DASFSDEFQPQ--LDTEGPTRYVRPGVDHFEVKKLRRGDYSPDMFLD
Y2436_VIBVY     VQQPNRNTKQKEIKRISREASDSEFYFSDEF--VPLLSEEGPTRYARDDVSTYEVKRLRRGVYVPDVFLD
Y2901_VIBC3     LHAPNRNPKQKEIRRTEREASDNDFYFSDEF-MPHLTDEGPTR-YARSDVSKYEVKRLRRGVYVPDVFLD
Y2119_VIBCH     LHAPNRNPKQKEIRRTEREASDNDFYFSDEF-MPHLTDEGPTR-YARSDVSKYEVKRLRRGVYVPDVFLD
Y2042_VIBCM     LHAPNRNPKQKEIRRTEREASDNDFYFSDEF-MPHLTDEGPTR-YARSDVSKYEVKRLRRGVYVPDVFLD
YFCN_SHIFL      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_SHIF8      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_SHIBS      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_SHIB3      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ESCF3      VHRPPRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECOUT      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECOSM      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECOSE      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECOLU      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECOLI      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECOLC      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECOL6      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECOL5      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECOHS      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECODH      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECOBW      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECO8A      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECO81      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECO55      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECO45      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECO27      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECO24      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
Y454_CITK8      VHRPQRKKITEPVKRLIQEQADASHYFSDEF--QPLLNTDGPVKYVRADVSHFELKKMRRGDYSPELFLD
Y3071_ERWCT     THKPLRRKIGEPAKRALQEQVDASFYFSDEFQPQ--LDTEGPTRYVRPGASHYELKKLRRGDYSPELFLD
Y2813_PECCP     THKPLRRKIGEPAKRALQEQVDASFYFSDEFQPQ--LDAEGPTRYVRPGASHYELKKLRRGDYSPELFLD
YFCN_SHISS      VHRPQRKKISEPVKRLIPEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_SHIDS      VHRPQSKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
YFCN_ECO7I      VHRPQRKKISEPVKRLIQEQADASHYFSDEF--QPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLD
Y966_PHOPR      -----------------------EFYFSDEFEPH--LNEHGPTQYARTGVSKYEVKKLRRGIYVPDMYLD
Y2879_ENT38     VHRPIRKKVTEPVKRLLQEQADNSHYFSDEF--QPLLNTQGAVKYVREDVSHFELKKLRRGDYSPELFLD
Y2677_KLEP7     VHRPQRKKITEVAPKRLLQEQVDNSHFSDEF--QPLLNTEGSTKYVRPDVSHFELKKLRRGDYSPELFLD
Y3376_SERP5     IVHRKPKPKTKQIQRLLQEQVDASHYFSDEYQPQ--LEEEGPTRYVRPGYSAFELKKLRRGDYSPELFLD
Y1152_ERWT9     ---PRKKFNQVPVKRLLSEQMDASHYFSDEF--QPLLASEGAVRYVRSDVSHYELKKLRRGDFTPEIFLD
YFCN_SALTY      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALTI      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALSV      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALPK      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALPC      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALPB      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALPA      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALNS      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALHS      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALG2      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALEP      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALDC      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
YFCN_SALA4      VHRPLRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
Y1418_KLEP3     VHRPQRKKVTEVAPKRLQEQADNSHYFSDEF--QPLLNTEGSTKYVRADVSHFELKKLRRGDYSPELFLD
Y1467_SHESA     -----------------------------------LLPVQGPMRWLDEGVDSLELKRLRRGDYQPDLLLD
YFCN_SALAR      VHRPQRKKITEPTRRLIQEQADASHYFSDEF--QPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLD
Y1805_PROMH     HQTPRKKVTHYPTERLQQEQIDASYYFSDEFQPN--LATEGPMRYLREGANAYELKKLRRGDYVPEFFLD
Y3081_SHEON     -----------------------------------LLPVQGPMRWLDEGVDSLELKRLRRGDYQPDLLLD
Y1414_SHESM     -----------------------------------LLPVQGPMRWLDEGVDSLELKRLRRGDYQPDLLLD
Y2848_SHEB9     -----------------------------------LLPVQGPMRWLEEGIDSLELKRLRRGDYQPDLLLD
Y1555_SHESW     -----------------------------------LLPIQGPMRWLDDGVDSLELKRLRRGDYQPDLLLD
Y2771_SHEB8     -----------------------------------LLPVQGPMRWLEEGVDSLELKRLRRGDYQPDLLLD
Y2754_SHEB5     -----------------------------------LLPVQGPMRWLEEGVDSLELKRLRRGDYQPDLLLD
Y1605_SHEB2     -----------------------------------LLPVQGPMRWLEEGVDSLELKRLRRGDYQPDLLLD
Y2453_SHEPC     -----------------------------------LLPIQGPMRWLDDGVDSLELKRLRRGDYQPDLLLD
YDAL_ECOLI      ----------------------------DNFLTTGFLDISQPLEFRREGLQHGVLDKLRSGKYPQQASLN
Y391_PASMU      IAPRQKMSKKKSTLRDIREKEDTLFYFSDEY--EPLLNEESAVRYLREGEDSHILKQLRRGDFSPELFLD
Y1679_HAEDU     V--PKTMPRKKVSEWRTQQQKDTEFFFSDEYE-PLLKEENEKVKYLRADIDPYILKQLGRGDFQPDLFLD
Y3198_PHOLL     LHSPRRKKTSYIAPERIQQEQI-DASFSDEFQPN--LDSEGPTRYVRGDTNHYELKKLRRGDYSPELFLD
Y092_BUCBP      ----------------------------------------------------DVLKKLKIGKYVPEIILD
Y1202_HAEIN     VAPRQKRDQKKIELKELRAKEDTLFYFSDEYE-PLLNDNDGVVKYLRDGEDSHLLKQLRRGDFSPELFLD
Y091_BUCAP      ----------------------------------------------------NVLKKLKKGKYYPDIFLD
Y098_BUCAI      -----KKNNNHPVSQRVFFEQNAHSHYFSYRNNKNLFKENPVSYIRHQSL-YNVLKNLKKGRYNPDISID
Y096_BUCA5      -----KKNNNHPVSQRVFFEQNAHSHYFSYRNNKNLFKENPVSYIRHQSL-YNVLKNLKKGRYNPDISID
Y097_BUCAT      ----------------------------------------------------NVLKNLKKGRYNPDISID
Y2357_AERHH     ------------------EKLGVDHYFSDEYQPH--LEADGPTRYVREDVSKFELKKLKRGSYPPEIYLD
MUTS2_STRA5     ----------------------------DEF---TLVRVQEEQKVKSKQI--NVVKKADSSG--PRARLD
MUTS2_STRA3     ----------------------------DEF---TLVRVQEEQKVKSKQI--NVVKKADSSG--PRARLD
MUTS2_STRA1     ----------------------------DEF---TLVRVQEEQKVKSKQI--NVVKKADSSG--PRARLD
MUTS2_STRSV     ----------------------------------NLLKAEKEQQPKRKQV--NVVKRANTAG--PKARLD
MUTS2_STRGC     ----------------------------------NLLKAEKEQQPKRKQV--NVVKRANTAG--PRARLD
MUTS2_STRPZ     ----------------------------------------------------------------PRARLD
MUTS2_STRZP     ----------------------------------------------------------------PQARLD
MUTS2_STRZJ     ----------------------------------------------------------------PQARLD
MUTS2_STRR6     ----------------------------------------------------------------PQARLD
MUTS2_STRPS     ----------------------------------------------------------------PQARLD
MUTS2_STRPN     ----------------------------------------------------------------PQARLD
MUTS2_STRPJ     ----------------------------------------------------------------PQARLD
MUTS2_STRPI     ----------------------------------------------------------------PQARLD
MUTS2_STRP7     ----------------------------------------------------------------PQARLD
MUTS2_STRP4     ----------------------------------------------------------------PQARLD
MUTS2_STRP2     ----------------------------------------------------------------PQARLD
MUTS2_STRMU     ----------------------------------------------------------RTSQKAPSARLD
MUTS2_STRP1     ----------------------------------------------------------------PRARLD
MUTS2_STRPG     ----------------------------------------------------------------PRARLD
MUTS2_STRP8     ----------------------------------------------------------------PRARLD
MUTS2_STRZT     ----------------------------------------------------------------PQARLD
MUTS2_DESMR     --------------------------------------------------------------------VD
MUTS2_THERP     -----------------------------------------------------------------EPEIH
MUTS2_STRTD     ----------------------------------------------------------------PRARLD
MUTS2_STRT2     ----------------------------------------------------------------PRARLD
MUTS2_STRT1     ----------------------------------------------------------------PRARLD
MUTS2_STRU0     ----------------------------------------------------------------PRARLD
MUTS2_LACJO     -------------------------------------------------------------------ELD
MUTS2_GEMAT     ----------------------------------------------------------------------
MUTS2_LACGA     -------------------------------------------------------------------ELD
MUTS2_STRSY     ----------------------------------------------------------------PKARLD
MUTS2_STRS7     ----------------------------------------------------------------PRARLD
MUTS2_STRS2     ----------------------------------------------------------------PKARLD
MUTS2_STREM     ----------------------------------------------------------------PRARLD
MUTS2_STRE4     ----------------------------------------------------------------PRARLD
MUTS2_STAS1     -------------------------------------------------------------------ELD
MUTS2_CLOTH     --------------------------------ISNLKLVDEQIVLNNSGIGKIGMSKAKS----ISTEID
MUTS2_CARHZ     -------------------------------------------------------------------ELD
MUTS2_DESAD     -------------------------------------------------VTEKADKKAPKGEMTL--KID
MUTS2_STACT     -------------------------------------------------------------------ELD
MUTS2_GEOKA     ----VFQPGDEVKVTSLNQKGYLIEKVSDEWQVQGILKMERDLEYIGSAPAKDVIATVKGKDAHVSLELD
MUTS2_CALS8     ----------------------------------NISDIEEVEEGEKK-VYQTTSKNVKLREKSVDLSID
MUTS2_LACAC     ---------------------IIKVKVSDR-DVER---IDNSQSTAKPKRLVRATSAVRRSN--AHSELD
MUTS2_TREDE     ----------------------------------------------------------------PSFELR
MUTS2_LACCB     -----------------------------------------------------VVKVSGGGMSGPSTTLD
MUTS2_LACC3     -----------------------------------------------------VVKVSGGGMSGPSTTLD
MUTS2_FINM2     -------------------------------------------------------------------EID
MUTS2_ALKMQ     VGHVLNEVDPK------GEVQVQAGIMKVNMHISNLERVSPEKDIQQSGTGK--IMKSKTGD--TKSEVD
MUTS2_LACH4     -------------------------------------------------------------------ELD
MUTS2_FUSNN     -----------------------------------------------------------------RSEID
MUTS2_STAEQ     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_GEOTN     -------------------------------------------------------------------ELD
MUTS2_SYMTH     -------------------------------------------------------------------EVD
MUTS2_ENTFA     -------------------------------------------------------------------QLD
MUTS2_CLONN     --------------------------------------------------------------------VD
MUTS2_LACS1     --------------------------------------------------------------------LD
MUTS2_HALOH     --------------------------------------------------------------------LD
MUTS2_STAES     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_LEUMM     -----------------------------------------------------------------KSSLD
MUTS2_BREBN     ----------------------------------------------------------RRSDNIKMD-LD
MUTS2_STAAW     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAAU     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAAT     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAAS     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAAR     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAAN     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAAM     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAAE     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAAC     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAAB     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAA9     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAA8     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAA3     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAA2     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_STAA1     ----------------------------------------------------------RQNRQTIKTELD
MUTS2_LEUCK     -----------------------------------------------------------------KSRLD
MUTS2_LACPL     --------------------------------------------------------------------LD
MUTS2_BORBU     --------------------------------------------------------------------ID
MUTS2_ANATD     --------------------------------------------------------------------ID
MUTS2_PEDPA     --------------------------------------------------------------------LD
MUTS2_ALKOO     --------------------------------VSNLERIKEEKDTKKTGVGKIVKSKAENIKM----EID
MUTS2_GEOSW     ------QPGDEVKVTSLNQKGYLVEKVSDEWQVQNERDLEYIGS--APKTETKPLATVKGKDYHVGLELD
YLL3_SCHPO      ------------------------------------------------------------------DEID
Y674_TREPA      -------------------------------------------------------RKLRTA--VPEARLD
MUTS2_LACSS     -------------------------------------------------------------------QLD
MUTS2_CLOK5     --------------------------------------------------------------------VD
MUTS2_CLOK1     --------------------------------------------------------------------VD
MUTS2_CLOCE     -----------------NGEAQVQAGIMKNVHISNLKLVDEQQQIQRTGMGKIGVSKAQN----MSTEID
MUTS2_CLOB8     -----------------------------------------------------------------ESRVD
MUTS2_STAHJ     -------------------------------------------------------------------KTE
MUTS2_HELPY     -------------------------------------------------------------------RLD
MUTS2_HELPJ     -------------------------------------------------------------------RLD
MUTS2_BACHD     -------------------------------------------------------------------ELD
MUTS2_LACBA     --------------------------------------------------------------------LD
MUTS2_THETN     --------------------------------------------------------------------LD
MUTS2_SULSY     --------------------------------------------------------------------IN
MUTS2_BACSK     ---------------------------------------------------EKAITTIRGNDAHVKAELD


                         +         .         .         .         .         *         .:210
query           LHGLRSDEAREALANFLRRSVRNGVRCVRVIHGKGIGSPDKLPVLKGKVRSWLVQKEEVIAFVQARESQG
Y2166_ALISL     MHGMKQDEAKRELGSMIAYCLKENISCASVMHGIG------KHILKQKVPLWLAQHPDVMAFHQAPLEFG
Y3116_VIBHB     MHGMTQQEAKRELGAMIAYCVKNEIHCACVQHGIG------KHILKQKAPLWLAQHPDVMAFHQAPLEFG
Y1940_VIBFM     MHGMKQDEAKRELGSMIAYCLKENISCASVMHGIG------KHILKQKVPLWLAQHPDVMAFHQAPLEFG
Y1807_VIBF1     MHGMKQDEAKRELGSMIAYCLKENISCASVMHGIG------KHILKQKVPLWLAQHPDVMAFHQAPLEFG
Y2181_TOLAT     LHGLTQQQAKSELAALIEACRRQHIRCACVMHGHGKN------ILKQRIPLWLAQHPDVMAFHQAPKLWG
Y379_YERPG      LHGLTQKQAKQELGALIAACKREHVHCACVMHGHG------KHVLKQQTPLWMAQHPDVLAFHQAPKEWG
Y2749_YERPE     LHGLTQKQAKQELGALIAACKREHVHCACVMHGHG------KHVLKQQTPLWMAQHPDVLAFHQAPKEWG
Y1403_YERP3     LHGLTQKQAKQELGALIAACKREHVHCACVMHGHG------KHVLKQQTPLWMAQHPDVLAFHQAPKEWG
YFCN_ECO5E      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECO57      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
Y2204_VIBPA     MHGMTQQEAKRELGAMIAYCVKNEIHCACVQHGIG------KHILKQKAPLWLAQHPDVMAFHQAPLEFG
Y1979_VIBVU     MHGMTQQEAKRELGAMIAYCVKNEVHCACVQHGIG------KHILKQKTPRWLAQHPDVLAFHQAPLEFG
Y1279_YERE8     LHGLTQKQAKQELGALIAACKREHVHCACVMHGHG------KHVLKQQTPLWLAQHPDVLAFHQAPKEWG
Y2436_VIBVY     MHGMTQQEAKRELGAMIAYCVKNEVHCACVQHGIG------KHILKQKTPLWLAQHPDVLAFHQAPLEFG
Y2901_VIBC3     MHGMTQQEAKRELGAMIAYCLKENVHCACVQHGIG------KHILKQNVPLWLAQHPDVLAFHQAPLEFG
Y2119_VIBCH     MHGMTQQEAKRELGAMIAYCLKENVHCACVQHGIG------KHILKQNVPLWLAQHPDVLAFHQAPLEFG
Y2042_VIBCM     MHGMTQQEAKRELGAMIAYCLKENVHCACVQHGIG------KHILKQNVPLWLAQHPDVLAFHQAPLEFG
YFCN_SHIFL      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SHIF8      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SHIBS      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SHIB3      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ESCF3      LHGLTQLQAKQELGALIATCRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECOUT      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECOSM      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECOSE      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECOLU      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECOLI      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECOLC      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECOL6      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECOL5      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECOHS      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECODH      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECOBW      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECO8A      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECO81      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECO55      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECO45      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECO27      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECO24      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
Y454_CITK8      LHGLTQQQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
Y3071_ERWCT     LHGLTQLQAKQELGALLAACRREHVYCACVMHGHG------KHILKQQTPLWLAQHPDVLAFHQAPKEFG
Y2813_PECCP     LHGLTQLQAKQELGALLAACRREHVYCACVMHGHG------KHILKQQTPLWLAQHPDVLAFHQAPKEFG
YFCN_SHISS      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SHIDS      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_ECO7I      LHGLTQLQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKVYG
Y966_PHOPR      MHGMTQQEAKRELAAMLAACIKESVSCACVMHGIG------KHILKKKAPLWLAQHPDVMAFHQAPLEFG
Y2879_ENT38     LHGLTQMQAKQELGALIAACRREHVFCTCVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
Y2677_KLEP7     LHGLTQQQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHIMAFHQAPKEYG
Y3376_SERP5     LHGLTQMQAKQELGALIAACRREHVHCACVMHGHG------KHILKQQTPLWLAQHPDVLVFHQAPKEWG
Y1152_ERWT9     LHGLTQKQAKQELGALIAACRREHIFCASVMHGHG------KHILKQQTPLWLAQHPWVMAFHQAPKLFG
YFCN_SALTY      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALTI      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALSV      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALPK      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALPC      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALPB      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALPA      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALNS      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALHS      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALG2      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALEP      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALDC      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
YFCN_SALA4      LHGLTQLQAKQELGALIAACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
Y1418_KLEP3     LHGLTQQQAKQELGALIAACRREHVFCACVMHGHG------KHILKQQTPLWLAQHPHIMAFHQAPKEYG
Y1467_SHESA     LHGYRQSEAKLELAALIQACVKQQSQCCCVMHGYGTG------ILKQQVPMWLVQHPKVKAFHQAPKEWG
YFCN_SALAR      LHGLTQLQAKQELGALITACRREHIFCACVMHGHG------KHILKQQTPLWLAQHPHVMAFHQAPKEYG
Y1805_PROMH     LHGLTQLIAKQEIGALIAACRREHVYCACIMHGHG------KHILKQQTPLWLAQHPDIIAFHQAPKEWG
Y3081_SHEON     LHGYRQSEAKLELAALIQACVKQQSQCCCVMHGYGTG------ILKQQVPMWLVQHPMVKAFHQAPKEWG
Y1414_SHESM     LHGYRQSEAKLELAALIQACVKQQSQCCCVMHGYGTG------ILKQQVPMWLVQHPMVKAFHQAPKEWG
Y2848_SHEB9     LHGYRQSEAKLELAALIQACVKQQSLCCCIMHGYGSG------ILKQQVPMWLVQHPMVKAFHQAPKEWG
Y1555_SHESW     LHGYRQSEAKLELAALIQACVKQQSQCCCVMHGYGSG------ILKQQVPMWLVQHPMVKAFHQAPKEWG
Y2771_SHEB8     LHGYRQSEAKLELAALIQACVKQQSLCCCIMHGYGSG------ILKQQVPMWLVQHPMVKAFHQAPKEWG
Y2754_SHEB5     LHGYRQSEAKLELAALIQACVKQQSLCCCIMHGYGSG------ILKQQVPMWLVQHPMVKAFHQAPKEWG
Y1605_SHEB2     LHGYRQSEAKLELAALIQACVKQQSLCCCIMHGYGSG------ILKQQVPMWLVQHPMVKAFHQAPKEWG
Y2453_SHEPC     LHGYRQSEAKLELVALIQACVKQQSQCCCVMHGYGSG------ILKQQVPMWLVQHPMVKAFHQAPKEWG
YDAL_ECOLI      LLRQPVEECRKMVFSFIQQALADGLRNVLIIHGKGRDDKSHANIVRSYVARWLTEFDDVQAYCTALPHHG
Y391_PASMU      LHGLTKEQAKIELASLLQACENEHVYCASVMTGYG------SYILKRQIPRWLVQHPKVRALHQAPKAWG
Y1679_HAEDU     LHGLTRQKAKTELAALILACEREQVYCASIMTGYGTRT------LKEQIPRWLVQHPKVIALHQAPKQWG
Y3198_PHOLL     LHGLTQMQAKQEIGALIAACRREHVYCACIMHGHG------KHILKQQTPLWLAQHPDIIAFHQAPKEWG
Y092_BUCBP      VHGLNQDQAKRKLGELLNICHKENLFCASVIHGHGRN------ILKNKIPIWLSRHPSVIAFYKIPKKFG
Y1202_HAEIN     LHGLTREQAKQEXXXXXXXCENEHVDCASIMTGYGTFT------LKKQIPRWLVQHPKVRALHQAPREWG
Y091_BUCAP      LHGLNQYQARKKLGQLIAICQKEKMFCAHIMHGYGKN------ILKKQIPFWLSQHPDIVAFHQAPKMFG
Y098_BUCAI      LHGLTQHQAQQALGELITTCQKEKIFCAHIMHGHG------KHILKKQTPFWLSQHPDIIAFHEAPKFFG
Y096_BUCA5      LHGLTQHQAQQALGELITTCQKEKIFCAHIMHGHG------KHILKKQTPFWLSQHPDIIAFHEAPKFFG
Y097_BUCAT      LHGLTQHQAQQALGELITTCQKEKIFCAHIMHGHG------KHILKKQTPFWLSQHPDIIAFHEAPKFFG
Y2357_AERHH     LHGMNXXXXXXXXXXXXXXCQKENIHVASVMHGIG------KHILKQRIPSWLAQHPNVQAFHQAPREWG
MUTS2_STRA5     LRGKRYEEAMQELDNFIDQALLNNMGQVDIIHGIGTG------VIREGVTKYLRRNKHVKHFAYAPQNAG
MUTS2_STRA3     LRGKRYEEAMQELDNFIDQALLNNMGQVDIIHGIGTG------VIREGVTKYLRRNKHVKHFAYAPQNAG
MUTS2_STRA1     LRGKRYEEAMQELDNFIDQALLNNMGQVDIIHGIGTG------VIREGVTKYLRRNKHVKHFAYAPQNAG
MUTS2_STRSV     LRGKRYEEAMEELDAFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLRRNKHVKSFGYAPQNAG
MUTS2_STRGC     LRGKRYEEAMKELDEFIDQALLNNMAQVDIIHGIGTG------VIREGVNKYLRRNKHVKSFGYAPQNAG
MUTS2_STRPZ     LRGKRYEEAMQELDHFIDQSLLNNMGQVDIIHGIGTG------VIREGVTKYLRRHKHVKHFAYAPQNAG
MUTS2_STRZP     LRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLQRNKHVKSFGYAPQNAG
MUTS2_STRZJ     LRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLQRNKHVKSFGYAPQNAG
MUTS2_STRR6     LRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLQRNKHVKSFGYAPQNAG
MUTS2_STRPS     LRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLQRNKHVKSFGYAPQNAG
MUTS2_STRPN     LRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLQRNKHVKSFGYAPQNAG
MUTS2_STRPJ     LRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLQRNKHVKSFGYAPQNAG
MUTS2_STRPI     LRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLQRNKHVKSFGYAPQNAG
MUTS2_STRP7     LRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLQRNKHVKSFGYAPQNAG
MUTS2_STRP4     LRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLQRNKHVKSFGYAPQNAG
MUTS2_STRP2     LRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLQRNKHVKSFGYAPQNAG
MUTS2_STRMU     LRGKRYEEAMQELDEFIDQALLNNMAQVDIIHGIGTG------VIRDGVTKYLRRNKQVKEFGYAPQNAG
MUTS2_STRP1     LRGKRYEEAMQELDHFIDQALLNNMGQVDIIHGIGTG------VIREGVTKYLRRNKHVKHFAYAPQNAG
MUTS2_STRPG     LRGKRYEEAMQELDHFIDQALLNNMGQVDIIHGIGTG------VIREGVTKYLRRHKHVKHFAYAPQNAG
MUTS2_STRP8     LRGKRYEEAMQELDHFIDQALLNNMGQVDIIHGIGTG------VIREGVTKYLRRHKHVKHFAYAPQNAG
MUTS2_STRZT     LRGKRYEEAMNELDIFIDQALLNNMAQVDIIHGIGTG------VIREGVTKYLQRNKHVKSFGYAPQNAG
MUTS2_DESMR     LRGMRADVAESELLAFVDNALLRGHGELEVIHGRGTGA------LRREVHRMLKDHPQVASFAIAPEDRG
MUTS2_THERP     LRGLHVEEALDRLDRYLDRAVRAGLPWVRVVHGKGTGT------LRQAIHAFLRDHPLVKSWELAGPHEG
MUTS2_STRTD     LRGKRYEEAMQELDAFIDQALLNNMSQVEIIHGIGTG------VIRDAVTKYLRRHRHVKNFEYAPQSAG
MUTS2_STRT2     LRGKRYEEAMQELDAFIDQALLNNMSQVEIIHGIGTG------VIRDAVTKYLRRHRHVKNFEYAPQSAG
MUTS2_STRT1     LRGKRYEEAMQELDAFIDQALLNNMSQVEIIHGIGTG------VIRDAVTKYLRRHRHVKNFEYAPQSAG
MUTS2_STRU0     LRGKRYEEAMQELDAFIDQALVNNMSQVDIIHGIGTG------VIREAVTKYLRRHKHVKSFAYAPQNAG
MUTS2_LACJO     LRGQRYEEALTNLDRYIDSSLLAGLNTVTIIHGIGTGA------IRNGVQQYLKRNRHVKSYSYAPANQG
MUTS2_GEMAT     --GLRVDEVDDQVLQALDAAVRNDLRELRIIHGKGTGA------LRSRVSEMLKKDTRVTGFRLGAWNEG
MUTS2_LACGA     LRGQRYEEALTNLDRYLDASLLAGLNTVTIIHGIGTGA------IRNGVQQYLKRNRHVKSYNYAPANQG
MUTS2_STRSY     LRGKRYEEAMMELDEFIDQALLNNLAQVDIVHGIGTG------VIREGVTKYLRRNKQIKEFGYAPQNAG
MUTS2_STRS7     LRGKRYEEAMQELDAFIDQALLNNMSQVDIIHGIGTG------VIREAVGKYLRRNKHVKSFGYAPQNAG
MUTS2_STRS2     LRGKRYEEAMMELDEFIDQALLNNLAQVDIVHGIGTG------VIREGVTKYLRRNKQIKEFGYAPQNAG
MUTS2_STREM     LRGKRYEEAMQELDAFIDQALLNNMSQVDIIHGIGTG------VIREAVGKYLRRNKHVKSFGYAPQNAG
MUTS2_STRE4     LRGKRYEEAMQELDAFIDQALLNNMSQVDIIHGIGTG------VIREAVGKYLRRNKHVKSFGYAPQNAG
MUTS2_STAS1     LRGYRYDEAMVAVDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQNHLKRHKSVASYRNGMPSEG
MUTS2_CLOTH     VRGYNLEEAIESVDKYLDDAYLSGLTEVSIIHGKGTG------VLRSGIQKFLKSDSRVKSFRLGKYGEG
MUTS2_CARHZ     IRGMNTLEAEPVVEKYLDNAYLAGVEKVRIIHGKGTGA------LKKFLWDYLREVPFVKKFNFAPQNQG
MUTS2_DESAD     LRGKRADVAISELDRFFDQALLRGATELEIVHGRGTGA------LRREVHIFLDDNPAVAGYSLAPEDRG
MUTS2_STACT     LRGYRYEEAITALDQYLDQAMLSNYENVYIIHGKGTGA------LQKAVQQHLKKHKNVASFRTGMPSEG
MUTS2_GEOKA     LRGERYEDALIRLEKYLDDAVLAGYARVSIIHGKGTGA------LRQGVQQFLKQHRAVKSFRFGEANEG
MUTS2_CALS8     VRGKTSDDAILDVDKYLDDAYTSGLRQVTIIHGKGTG------VLRQAIRNFLKRHPLVKSFRDGTYGEG
MUTS2_LACAC     LRGQRYDEAMTNLDRYIDSVLLAGLDTVTIIHGIGTGA-----IRKG-VWQYLRSSNHVKNFNYAPANEG
MUTS2_TREDE     LLGMRAEEAQKALQDQMDLALVHGITEFAIIHGKGHG------ILQELSHDFLKRSPYVKAFRFAKPEEG
MUTS2_LACCB     LRGERYDQAMADLDQYIDAALLAGYPSVTIIHGLGTGA------IRNGVTQYLKRNRQVKTYGFAPQNAG
MUTS2_LACC3     LRGERYDQAMADLDQYIDAALLAGYPSVTIIHGLGTGA------IRNGVTQYLKRNRQVKTYGFAPQNAG
MUTS2_FINM2     LRGKNIEEAIYELDKYIDDCVIVGLKKVNIIHGKGTG------MLRKGIREYLRSDKRVKKIEDAGYNEG
MUTS2_ALKMQ     VRGKNLEEAMLEIDKYLDDSYIVGLTQVTIIHGVGTG------VLKAGIKQMLKKNKHVRTHREGVYGEG
MUTS2_LACH4     LRGQRYDEAMTNLDRYIDSALLAGLDIVTIIHGIGTGA-----IRKG-VWQYLRSSNHVKGFNYAPANEG
MUTS2_FUSNN     LRGKMVDEAVYELETYLDRATLNGYTEVYVIHGKGTGA------LREGILKYLKACKYVKEYRIGGHGEG
MUTS2_STAEQ     LRGYRYEEALNELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVRQFRGGMPSEG
MUTS2_GEOTN     LRGERYEDALVRLEKYIDDAVLAGYPRVSIIHGKGTGA------LRQGVQQFLKQHRAVKSFRFGAANEG
MUTS2_SYMTH     LRGLMVEEALERVDKFLDDAVLAGLPQVRIIHGKGTGA--------------------------------
MUTS2_ENTFA     LRGKRYEEALAEVDQYIDAAILAGYPQVTIVHGKGTGA------LRTGITEFLKNHRSVKSYEFAPQNQG
MUTS2_CLONN     LRGMDSEEATYTADKYLDDACMSGLSEVTIIHGKGTG------VLRTAINDMLKRHPHVKSYRLGNYGEG
MUTS2_LACS1     LRGERYENAMVKVDRYIDAAVLAGYNSVTIIHGKGTGA------LRTGIINYLKQNKAVKNFEFASPNNG
MUTS2_HALOH     LRGERYETAQHKLDKYLDDVFLAGLKQVEIIHGKGTGA------LRKAVHTVLEKNPHITSYRLGRQEEG
MUTS2_STAES     LRGYRYEEALNELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVRQFRGGMPNEG
MUTS2_LEUMM     LRGVRYEAALTELDRYLDTAVLANISPVEIIHGKGTGA------LRQGVTEFLRSDRRVKSYHFASANAG
MUTS2_BREBN     LRGYNVEDSIREIDQFLDDALLAGLHSVSIIHGHGTG------VLRKGVHEYLRSHRNVKSFRLGGQGEG
MUTS2_STAAW     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAAU     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAAT     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAAS     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAAR     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAAN     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAAM     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAAE     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAAC     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAAB     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAA9     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAA8     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAA3     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAA2     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_STAA1     LRGYRYEDALIELDQYLDQAVLSNYEQVYIIHGKGTGA------LQKGVQQHLKKHKSVSDFRGGMPSEG
MUTS2_LEUCK     LRGVRYEAALAELDRYLDTAVLANLGTVEIIHGKGTGA------LRQGVTEFLRSDRRVKAYHFANANAG
MUTS2_LACPL     LRGVRYEDAMTQVDRYIDAALLAGYPSVTIVHGKGTGA------LREGITNYLKSNRQVKSFHFAAPNHG
MUTS2_BORBU     IRGMRSVDALDFLNKKIDNIILNGINKFEIIHGKGEGH------LMREVHNLLKELKFIRKYYFAHPSDG
MUTS2_ANATD     VRGKTSDDAILEVDKYLDDAYTAGLKQVTIIHGKGTG------VLRQAIRNFLRRHPHVKSFRDGTYGEG
MUTS2_PEDPA     LRGKRYEEALTETDRYIDAALLAGYDEVTIVHGKGTGA------LRSGITKYLKNNRRIKAFEYAPANAG
MUTS2_ALKOO     VRGQNLEEAMLNVDKYLDDAYIAGLTHVTIIHGVGTG------VLSAGLKQMLKKHKHTKSFREGEYGEG
MUTS2_GEOSW     LRGERYEDAIVRLEKYIDDALLAGYPRVSIIHGKGTGA------LRKGVQEFLKKHRSVKNFHFGEANEG
YLL3_SCHPO      LHGLYIDEAVQAVQQRIENCIRRGDNHLHIIVGRGNHSANHVEKLRPAIVRMLEQQ--------------
Y674_TREPA      LHGMTCSEARSALDSFFAQARERLLQKVEIV-XXXXXXXXXXXVLAPSVKRYVQAHPHAGELFHPAERRG
MUTS2_LACSS     LRGKRYEEAMAEVDQYIDAALLANYQQVTIVHGKGTGA------IRQGVQEYLQANRQVKKYEYAPANAG
MUTS2_CLOK5     LRGMDSIEAAYITDKYLDDAYVAGLKEVTIIHGKGTG------ILRSSITNMLKSHSHVKNYRIGEYGEG
MUTS2_CLOK1     LRGMDSIEAAYITDKYLDDAYVAGLKEVTIIHGKGTG------ILRSSITNMLKSHSHVKNYRIGEYGEG
MUTS2_CLOCE     LRGMMLSEAVDVVDKYLDDASIAGMGGVTLIHGKGTGA------LRAGLHQHLKHNPHIKSFRLGKLGEG
MUTS2_CLOB8     LRGLDAEEACYKADKYLDDAYMANLGEVTIVHGKGTG------VLRKAINDMLKRHPHVKSYRLGAYGEG
MUTS2_STAHJ     LHGYRYEEAVSELDQYIDQAVLSNYEQVYIIHGKGTGA------LQKAVQNHLNKHKSVKSYRGGMPSEG
MUTS2_HELPY     LRGQRSEEXXXXXXXXXXXXXXGGFEEVLICHGKGSG------ILEKFVKEFLKNHPKVVSFSDAPINLG
MUTS2_HELPJ     LRGQRSEEXXXXXXXXXXXXXXGGFEEVLICHGKGSG------ILEKFVKEFLKNHPKVVSFSDAPINLG
MUTS2_BACHD     LRGERYEEAMLKVEKYLDDALLAGYASVSIIHGKGTGA------LRKGVKDLLKRHPHVKSARDGGANEG
MUTS2_LACBA     LRGHRYEEAMAEVDRYIDSALLAGYPSVTIIHGKGTGA------LRKGVTDYLKRNNRIKSFGFSPANAG
MUTS2_THETN     VRGMTLDDALLEVEKYIDDAYLAGLNQVTIIHGRGTG------VLRTGIAKFLRNSKYVKSFRLGRYGEG
MUTS2_SULSY     LIGKTKEEAIKELEKYIDKVILEGYTTFKIIHGYGAG------VLRNAVREYLDKLPFKLKYEDAPYHEG
MUTS2_BACSK     LRGERYEDAMRRVEKYIDDALLAGYHQVSIIHGKGTGA------LRKGVKQFVANHPRVKSARDGGMNEG


                         .         .         .         +         .         .         .:280
query           GAGALMVLLRQPKT
Y2166_ALISL     GAGAILVLLSIP--
Y3116_VIBHB     GDGALLVLLSIPE-
Y1940_VIBFM     GAGAILVLLSIP--
Y1807_VIBF1     GAGAILVLLSIP--
Y2181_TOLAT     GDAAILVLIEQ---
Y379_YERPG      GTAA----------
Y2749_YERPE     GTAA----------
Y1403_YERP3     GTAA----------
YFCN_ECO5E      GDAALLVLI-----
YFCN_ECO57      GDAALLVLI-----
Y2204_VIBPA     GDGALLVLLSIPE-
Y1979_VIBVU     GDGALLVLLSIPE-
Y1279_YERE8     GTAALLVLV-----
Y2436_VIBVY     GDGALLVLLSIPE-
Y2901_VIBC3     GDGALLVLLSIPE-
Y2119_VIBCH     GDGALLVLLSIPE-
Y2042_VIBCM     GDGALLVLLSIPE-
YFCN_SHIFL      GDAALLVLI-----
YFCN_SHIF8      GDAALLVLI-----
YFCN_SHIBS      GDAALLVLI-----
YFCN_SHIB3      GDAALLVLI-----
YFCN_ESCF3      GDAALLVLI-----
YFCN_ECOUT      GDAALLVLI-----
YFCN_ECOSM      GDAALLVLI-----
YFCN_ECOSE      GDAALLVLI-----
YFCN_ECOLU      GDAALLVLI-----
YFCN_ECOLI      GDAALLVLI-----
YFCN_ECOLC      GDAALLVLI-----
YFCN_ECOL6      GDAALLVLI-----
YFCN_ECOL5      GDAALLVLI-----
YFCN_ECOHS      GDAALLVLI-----
YFCN_ECODH      GDAALLVLI-----
YFCN_ECOBW      GDAALLVLI-----
YFCN_ECO8A      GDAALLVLI-----
YFCN_ECO81      GDAALLVLI-----
YFCN_ECO55      GDAALLVLI-----
YFCN_ECO45      GDAALLVLI-----
YFCN_ECO27      GDAALLVLI-----
YFCN_ECO24      GDAALLVLI-----
Y454_CITK8      GDAALLVLI-----
Y3071_ERWCT     G-------------
Y2813_PECCP     G-------------
YFCN_SHISS      GDAALLVLI-----
YFCN_SHIDS      GDAALLVLI-----
YFCN_ECO7I      GDAALLVLI-----
Y966_PHOPR      GNGALLVLIDIPE-
Y2879_ENT38     GDAALLVLI-----
Y2677_KLEP7     GDAALLILI-----
Y3376_SERP5     GTAAILLLV-----
Y1152_ERWT9     GDAALLVLI-----
YFCN_SALTY      GDAALLVLI-----
YFCN_SALTI      GDAALLVLI-----
YFCN_SALSV      GDAALLVLI-----
YFCN_SALPK      GDAALLVLI-----
YFCN_SALPC      GDAALLVLI-----
YFCN_SALPB      GDAALLVLI-----
YFCN_SALPA      GDAALLVLI-----
YFCN_SALNS      GDAALLVLI-----
YFCN_SALHS      GDAALLVLI-----
YFCN_SALG2      GDAALLVLI-----
YFCN_SALEP      GDAALLVLI-----
YFCN_SALDC      GDAALLVLI-----
YFCN_SALA4      GDAALLVLI-----
Y1418_KLEP3     GDAALLVLI-----
Y1467_SHESA     GDAALLVLI-----
YFCN_SALAR      GDAALLVLI-----
Y1805_PROMH     GDAALLLLV-----
Y3081_SHEON     GDAALLVLI-----
Y1414_SHESM     GDAALLVLI-----
Y2848_SHEB9     GDAALLVLI-----
Y1555_SHESW     GDAALLVLI-----
Y2771_SHEB8     GDAALLVLI-----
Y2754_SHEB5     GDAALLVLI-----
Y1605_SHEB2     GDAALLVLI-----
Y2453_SHEPC     GDAALLVLI-----
YDAL_ECOLI      GSGACYVALRK---
Y391_PASMU      GDAAILIL------
Y1679_HAEDU     GDAAILVLIEQPES
Y3198_PHOLL     GNAALLILI-----
Y092_BUCBP      RSTAILFLI-----
Y1202_HAEIN     GEAAILILV-----
Y091_BUCAP      NDAAIMVII-----
Y098_BUCAI      SDAAIIVII-----
Y096_BUCA5      SDAAIIVII-----
Y097_BUCAT      SDAAIIVII-----
Y2357_AERHH     GDSAILVLL-----
MUTS2_STRA5     GSGATIVTL-----
MUTS2_STRA3     GSGATIVTL-----
MUTS2_STRA1     GSGATIVTL-----
MUTS2_STRSV     GSGATIVIFK----
MUTS2_STRGC     GSGATIVIFK----
MUTS2_STRPZ     GSGATIVTL-----
MUTS2_STRZP     GSGATIVTFK----
MUTS2_STRZJ     GSGATIVTFK----
MUTS2_STRR6     GSGATIVTFK----
MUTS2_STRPS     GSGATIVTFK----
MUTS2_STRPN     GSGATIVTFK----
MUTS2_STRPJ     GSGATIVTFK----
MUTS2_STRPI     GSGATIVTFK----
MUTS2_STRP7     GSGATIVTFK----
MUTS2_STRP4     GSGATIVTFK----
MUTS2_STRP2     GSGATIVTFK----
MUTS2_STRMU     GSGATIVTFK----
MUTS2_STRP1     GSGATIVTL-----
MUTS2_STRPG     GSGATIVTL-----
MUTS2_STRP8     GSGATIVTL-----
MUTS2_STRZT     GSGATIVTFK----
MUTS2_DESMR     GDGMTMVTLK----
MUTS2_THERP     GLGVTVVYL-----
MUTS2_STRTD     GSGCTIATL-----
MUTS2_STRT2     GSGCTIATL-----
MUTS2_STRT1     GSGCTIATL-----
MUTS2_STRU0     GSGCTIATL-----
MUTS2_LACJO     GTGATIVYLQ----
MUTS2_GEMAT     GAGVTVAEL-----
MUTS2_LACGA     GTGATIVNLQ----
MUTS2_STRSY     GSGCTIVTFK----
MUTS2_STRS7     GSGCTIANL-----
MUTS2_STRS2     GSGCTIVTFK----
MUTS2_STREM     GSGCTIANL-----
MUTS2_STRE4     GSGCTIANL-----
MUTS2_STAS1     GFGVTVVEIK----
MUTS2_CLOTH     ESGVTIVELR----
MUTS2_CARHZ     GDGATEVYLK----
MUTS2_DESAD     GDGMTEVEL-----
MUTS2_STACT     GFGVTVAELK----
MUTS2_GEOKA     GTGVTIVELK----
MUTS2_CALS8     EQGVTIVELR----
MUTS2_LACAC     GNGATIVQLK----
MUTS2_TREDE     GSGKTIVSL-----
MUTS2_LACCB     GSGATIV-------
MUTS2_LACC3     GSGATIV-------
MUTS2_FINM2     GLGATFIYLK----
MUTS2_ALKMQ     GMGVTIVELK----
MUTS2_LACH4     GNGATIVKLK----
MUTS2_FUSNN     GLGCTVVTLK----
MUTS2_STAEQ     GFGVTVAELK----
MUTS2_GEOTN     GTGVTVVELK----
MUTS2_SYMTH     --------------
MUTS2_ENTFA     GNGATVV-------
MUTS2_CLONN     GNGVTVVELK----
MUTS2_LACS1     GNGATVVYFK----
MUTS2_HALOH     GSGVTIADLK----
MUTS2_STAES     GFGVTVAELK----
MUTS2_LEUMM     GDGATIVELK----
MUTS2_BREBN     GVGATIAELK----
MUTS2_STAAW     GFGVTVATLK----
MUTS2_STAAU     GFGVTVATLK----
MUTS2_STAAT     GFGVTVATLK----
MUTS2_STAAS     GFGVTVATLK----
MUTS2_STAAR     GFGVTVATLK----
MUTS2_STAAN     GFGVTVATLK----
MUTS2_STAAM     GFGVTVATLK----
MUTS2_STAAE     GFGVTVATLK----
MUTS2_STAAC     GFGVTVATLK----
MUTS2_STAAB     GFGVTVATLK----
MUTS2_STAA9     GFGVTVATLK----
MUTS2_STAA8     GFGVTVATLK----
MUTS2_STAA3     GFGVTVATLK----
MUTS2_STAA2     GFGVTVATLK----
MUTS2_STAA1     GFGVTVATLK----
MUTS2_LEUCK     GDGATIAEL-----
MUTS2_LACPL     GNGATEV-------
MUTS2_BORBU     GSGKTIV-------
MUTS2_ANATD     EQGVTVVELK----
MUTS2_PEDPA     GNGATIV-------
MUTS2_ALKOO     GMGVTIVHLK----
MUTS2_GEOSW     GTGVTIVELK----
YLL3_SCHPO      --------------
Y674_TREPA      GKGTTWVLLKR---
MUTS2_LACSS     GNGATIVTFK----
MUTS2_CLOK5     GTGVTIVELK----
MUTS2_CLOK1     GTGVTIVELK----
MUTS2_CLOCE     ENGVTVVELK----
MUTS2_CLOB8     GDGVTMVELK----
MUTS2_STAHJ     GFGVTVAELK----
MUTS2_HELPY     GSGVKIVKL-----
MUTS2_HELPJ     GSGVKIVKL-----
MUTS2_BACHD     GLGNTVVELR----
MUTS2_LACBA     GDGSTVV-------
MUTS2_THETN     GDGVTIVEL-----
MUTS2_SULSY     GLGVTIV-------
MUTS2_BACSK     GLGNTVIELK----