[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07698.1

[Show Plain Result]


## Summary of Sequence Search
    1::115
    3::107     5e-35  65%  109 aa  FKBP_NEIMB RecName: Full=FK506-binding protein;       
    4::107     6e-35  65%  109 aa  FKBP_NEIMA RecName: Full=FK506-binding protein;       
    4::107     1e-33  63%  109 aa  FKBP_NEIMC RecName: Full=FK506-binding protein;       
   43::135     4e-31  66%  209 aa  FKB2B_RHIOR RecName: Full=FK506-binding protein 2B;       
  256::361     1e-29  62%  364 aa  FKBP4_DICDI RecName: Full=FK506-binding protein 4;       
   11::104     7e-29  64%  107 aa  FKBP1_DICDI RecName: Full=FK506-binding protein 1;       
   16::124     2e-27  56%  124 aa  FKBP_STRCH RecName: Full=FK506-binding protein;       
    4::107     6e-27  57%  112 aa  FKBP_SCHPO RecName: Full=FK506-binding protein;       
    2::107     1e-26  56%  108 aa  FKB12_DROME RecName: Full=12 kDa FK506-binding protein;       
  247::356     2e-26  55%  357 aa  FKB39_DROME RecName: Full=39 kDa FK506-binding nuclear protein;    
   24::133     4e-26  57%  136 aa  FKBP2_CANGA RecName: Full=FK506-binding protein 2;       
    2::105     1e-25  55%  108 aa  FKB1A_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase
    2::105     1e-25  56%  108 aa  FKB1A_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase
    2::105     2e-25  55%  108 aa  FKB1A_RAT RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP1A;
    8::113     2e-25  51%  120 aa  FKB1A_NEUCR RecName: Full=Peptidyl-prolyl cis-trans isomerase
   18::107     4e-25  60%  108 aa  FKBP_YARLI RecName: Full=FK506-binding protein 1;       
    3::113     4e-25  53%  114 aa  FKBP_CANGA RecName: Full=FK506-binding protein 1;       
   41::132     6e-25  54%  133 aa  FKBP2_DICDI RecName: Full=FK506-binding protein 2;       
    2::105     6e-25  55%  108 aa  FKB1A_RABIT RecName: Full=Peptidyl-prolyl cis-trans isomerase
    2::105     6e-25  55%  108 aa  FKB1A_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase
    2::105     1e-24  55%  108 aa  FKB1A_XENLA RecName: Full=Peptidyl-prolyl cis-trans isomerase
    2::107     1e-24  53%  108 aa  FKBP_CRYNV RecName: Full=FK506-binding protein 1;       
   39::131     1e-24  57%  135 aa  FKBP2_YEAST RecName: Full=FK506-binding protein 2;       
   11::107     1e-24  58%  112 aa  FKB1A_ASPFU RecName: Full=FK506-binding protein 1A;       
    4::107     2e-24  54%  111 aa  FKBP_GIBZE RecName: Full=FK506-binding protein 1;       
  364::466     2e-24  55%  467 aa  FKBP4_NEUCR RecName: Full=FK506-binding protein 4;       
   41::133     2e-24  54%  141 aa  FKBP2_CRYNE RecName: Full=FK506-binding protein 2;       
   14::113     3e-24  58%  114 aa  FKBP_YEAST RecName: Full=FK506-binding protein 1;       
    2::107     4e-24  51%  108 aa  FKBP_CRYNE RecName: Full=FK506-binding protein 1;       
   44::135     5e-24  54%  144 aa  FKBP2_YARLI RecName: Full=FK506-binding protein 2;       
    2::111     6e-24  51%  112 aa  FKBP_DEBHA RecName: Full=FK506-binding protein 1;       
  307::408     8e-24  53%  412 aa  FKBP4_SPOFR RecName: Full=46 kDa FK506-binding nuclear protein;    
   43::134     1e-23  55%  140 aa  FKBP2_MOUSE RecName: Full=FK506-binding protein 2;       
   45::136     1e-23  55%  142 aa  FKBP2_HUMAN RecName: Full=FK506-binding protein 2;       
   43::134     1e-23  55%  140 aa  FKBP2_BOVIN RecName: Full=FK506-binding protein 2;       
   24::113     1e-23  58%  114 aa  FKBP_KLULA RecName: Full=FK506-binding protein 1;       
  392::494     2e-23  52%  495 aa  FKBP4_GIBZE RecName: Full=FK506-binding protein 4;       
  149::256     2e-23  53%  268 aa  FKBA_AERHY RecName: Full=FKBP-type peptidyl-prolyl cis-trans
  276::381     2e-23  53%  382 aa  FKBP4_RHIOR RecName: Full=FK506-binding protein 4;       
   39::131     2e-23  54%  140 aa  FKBP2_KLULA RecName: Full=FK506-binding protein 2;       
    2::107     2e-23  51%  108 aa  FKB1A_EMENI RecName: Full=FK506-binding protein 1A;       
  127::235     3e-23  50%  241 aa  FKBY_HAEIN RecName: Full=Probable FKBP-type peptidyl-prolyl
  300::404     3e-23  52%  405 aa  FKBP4_CRYNE RecName: Full=FK506-binding protein 4;       
   55::146     3e-23  53%  559 aa  FKB70_WHEAT RecName: Full=70 kDa peptidyl-prolyl isomerase;        
   24::113     4e-23  59%  114 aa  FKBP_ASHGO RecName: Full=FK506-binding protein 1;       
    2::107     4e-23  50%  108 aa  FKB1B_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase
   89::205     5e-23  54%  208 aa  FKBP3_ARATH RecName: Full=FKBP-type peptidyl-prolyl cis-trans
    2::105     5e-23  51%  108 aa  FKB1B_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase
    2::105     5e-23  51%  108 aa  FKB1B_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase
    2::105     7e-23  51%  108 aa  FKB1B_RAT RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP1B;
    2::107     1e-22  52%  108 aa  FKBP1_RHIOR RecName: Full=FK506-binding protein 1;       
    2::105     2e-22  51%  108 aa  FKB1B_RABIT RecName: Full=Peptidyl-prolyl cis-trans isomerase
   48::139     3e-22  53%  163 aa  FKB22_ARATH RecName: Full=FK506-binding protein 2-2;       
  304::406     5e-22  50%  407 aa  FKBP3_YARLI RecName: Full=FK506-binding protein 3;       
   57::142     8e-22  57%  551 aa  FKB70_ARATH RecName: Full=70 kDa peptidyl-prolyl isomerase;        
    9::106     8e-22  51%  110 aa  FKB1B_NEUCR RecName: Full=Peptidyl-prolyl cis-trans isomerase
  264::374     1e-21  51%  375 aa  FKBP4_USTMA RecName: Full=FK506-binding protein 4;       
   41::134     1e-21  55%  458 aa  FKBP4_RAT RecName: Full=FK506-binding protein 4;       
   41::134     1e-21  55%  458 aa  FKBP4_RABIT RecName: Full=FK506-binding protein 4;       
   11::115     1e-21  49%  116 aa  FKBP_ASPOR RecName: Full=FK506-binding protein 1;       
   41::134     1e-21  55%  458 aa  FKBP4_MOUSE RecName: Full=FK506-binding protein 4;       
  375::477     1e-21  50%  478 aa  FKBP4_EMENI RecName: Full=FK506-binding protein 4;       
  315::417     1e-21  53%  418 aa  FKBP3_ASHGO RecName: Full=FK506-binding protein 3;       
    2::114     3e-21  46%  120 aa  FKB1B_ASPFU RecName: Full=FK506-binding protein 1B;       
   45::136     3e-21  52%  151 aa  FKB15_VICFA RecName: Full=FK506-binding protein 2;       
   40::135     5e-21  55%  457 aa  FKBP5_SAIBB RecName: Full=FK506-binding protein 5;       
   40::135     5e-21  55%  457 aa  FKBP5_SAGOE RecName: Full=FK506-binding protein 5;       
  289::391     5e-21  50%  392 aa  FKBP4_YEAST RecName: Full=FK506-binding protein 4;       
   41::134     5e-21  53%  459 aa  FKBP4_HUMAN RecName: Full=FK506-binding protein 4;       
  329::436     5e-21  48%  437 aa  FKBP3_CANGA RecName: Full=FK506-binding protein 3;       
   41::134     7e-21  54%  459 aa  FKBP4_BOVIN RecName: Full=FK506-binding protein 4;       
   40::127     7e-21  56%  135 aa  FKBP2_EMENI RecName: Full=FK506-binding protein 2;       
   40::135     9e-21  54%  457 aa  FKBP5_PONAB RecName: Full=FK506-binding protein 5;       
   40::135     9e-21  54%  457 aa  FKBP5_HUMAN RecName: Full=FK506-binding protein 5;       
   40::135     9e-21  54%  457 aa  FKBP5_AOTNA RecName: Full=FK506-binding protein 5;       
  307::409     9e-21  49%  411 aa  FKBP3_YEAST RecName: Full=FK506-binding nuclear protein;       
   37::128     1e-20  49%  217 aa  FKBP2_NEUCR RecName: Full=FK506-binding protein 2;       
  144::252     1e-20  48%  272 aa  FKBA_NEIMB RecName: Full=Probable FKBP-type peptidyl-prolyl
   39::128     2e-20  53%  185 aa  FKBP2_PODAN RecName: Full=FK506-binding protein 2;       
   14::117     2e-20  47%  118 aa  FKBP_CORGL RecName: Full=Probable FK506-binding protein;       
  315::417     2e-20  50%  418 aa  FKBP3_KLULA RecName: Full=FK506-binding protein 3;       
   29::126     4e-20  51%  134 aa  FKBP2_ASPFU RecName: Full=FK506-binding protein 2;       
   48::139     4e-20  51%  153 aa  FKB21_ARATH RecName: Full=FK506-binding protein 2-1;       
   32::148     4e-20  46%  581 aa  FKB10_MOUSE RecName: Full=FK506-binding protein 10;       
   35::149     4e-20  48%  582 aa  FKB10_HUMAN RecName: Full=FK506-binding protein 10;       
   40::135     9e-20  53%  456 aa  FKBP5_MOUSE RecName: Full=FK506-binding protein 5;       
   40::135     1e-19  52%  457 aa  FKBP5_CERAE RecName: Full=FK506-binding protein 5;       
   97::205     1e-19  49%  206 aa  FKBB_SHIFL RecName: Full=FKBP-type 22 kDa peptidyl-prolyl cis-trans
   97::205     1e-19  49%  206 aa  FKBB_ECOLI RecName: Full=FKBP-type 22 kDa peptidyl-prolyl cis-trans
   34::150     2e-19  46%  583 aa  FKB10_BOVIN RecName: Full=FK506-binding protein 10;       
  329::436     2e-19  45%  437 aa  FKBP3_DEBHA RecName: Full=FK506-binding protein 3;       
   39::126     2e-19  51%  134 aa  FKBP2_ASPOR RecName: Full=FK506-binding protein 2;       
  178::265     3e-19  47% 1622 aa  FKBP5_DICDI RecName: Full=FK506-binding protein 5;       
   65::170     4e-19  49%  196 aa  MIP_TRYCR RecName: Full=Macrophage infectivity potentiator;        
  290::397     4e-19  46%  398 aa  FKBP4_CANGA RecName: Full=FK506-binding protein 4;       
  318::425     5e-19  45%  426 aa  FKBP3_CANAL RecName: Full=FK506-binding protein 3;       
  125::229     8e-19  48%  233 aa  MIP_LEGLO RecName: Full=Outer membrane protein MIP;       
    2::109     8e-19  48%  112 aa  FKB12_VICFA RecName: Full=Peptidyl-prolyl isomerase FKBP12;        
   35::126     1e-18  48%  195 aa  FKBP2_GIBZE RecName: Full=FK506-binding protein 2;       
   23::117     2e-18  49%  439 aa  FKB59_DROME RecName: Full=FK506-binding protein 59;       
   94::210     3e-18  49%  217 aa  FKBP4_ARATH RecName: Full=Probable FKBP-type peptidyl-prolyl
   11::111     3e-18  50%  112 aa  FKB12_ARATH RecName: Full=Peptidyl-prolyl isomerase FKBP12;        
  119::227     4e-18  42%  230 aa  MIP_COXBU RecName: Full=Peptidyl-prolyl cis-trans isomerase Mip;   
  101::212     4e-18  44%  223 aa  FKBP2_ARATH RecName: Full=Probable FKBP-type peptidyl-prolyl
  125::229     5e-18  47%  233 aa  MIP_LEGPH RecName: Full=Outer membrane protein MIP;       
  254::361     5e-18  44%  362 aa  FKBPH_SCHPO RecName: Full=Probable peptidyl-prolyl cis-trans
   36::126     5e-18  48%  135 aa  FKBP2_DEBHA RecName: Full=FK506-binding protein 2;       
  125::229     1e-17  46%  233 aa  MIP_LEGPN RecName: Full=Outer membrane protein MIP;       
  125::229     1e-17  46%  233 aa  MIP_LEGPC RecName: Full=Outer membrane protein MIP;       
  272::360     1e-17  53%  361 aa  FKBP4_SCHPO RecName: Full=FK506-binding protein 39 kDa;       
  134::238     3e-17  47%  243 aa  MIP_LEGMI RecName: Full=Outer membrane protein MIP;       
  386::488     4e-17  42%  489 aa  FKBP4_ASPFU RecName: Full=FK506-binding protein 4;       
    3::112     7e-17  39%  385 aa  FKBP5_RHIOR RecName: Full=FK506-binding protein 5;       
  367::469     7e-17  43%  470 aa  FKBP4_ASPOR RecName: Full=FK506-binding protein 4;       
   41::134     7e-17  45%  211 aa  FKB14_PONAB RecName: Full=FK506-binding protein 14;       
   41::134     7e-17  45%  211 aa  FKB14_HUMAN RecName: Full=FK506-binding protein 14;       
   41::134     1e-16  45%  211 aa  FKB14_MOUSE RecName: Full=FK506-binding protein 14;       
   52::141     5e-16  43%  570 aa  FKBP9_RAT RecName: Full=FK506-binding protein 9;       
   53::141     8e-16  44%  570 aa  FKBP9_MOUSE RecName: Full=FK506-binding protein 9;       
   46::140     8e-16  47%  218 aa  FKBP7_MOUSE RecName: Full=FK506-binding protein 7;       
  263::366     1e-15  42%  574 aa  FKBP9_BOVIN RecName: Full=FK506-binding protein 9;       
  260::362     2e-15  42%  570 aa  FKBP9_HUMAN RecName: Full=FK506-binding protein 9;       
  137::240     3e-15  43%  258 aa  MIP_CHLPN RecName: Full=Peptidyl-prolyl cis-trans isomerase Mip;   
   50::144     5e-15  47%  222 aa  FKBP7_PONAB RecName: Full=FK506-binding protein 7;       
  141::248     5e-15  41%  270 aa  FKBA_ECOLI RecName: Full=FKBP-type peptidyl-prolyl cis-trans
  141::248     5e-15  41%  270 aa  FKBA_ECOL6 RecName: Full=FKBP-type peptidyl-prolyl cis-trans
  141::248     5e-15  41%  270 aa  FKBA_ECO57 RecName: Full=FKBP-type peptidyl-prolyl cis-trans
   15::115     7e-15  44%  120 aa  FKB1B_EMENI RecName: Full=FK506-binding protein 1B;       
  129::232     9e-15  40%  243 aa  MIP_CHLTR RecName: Full=Peptidyl-prolyl cis-trans isomerase Mip;   
  129::232     1e-14  39%  243 aa  MIP_CHLMU RecName: Full=Peptidyl-prolyl cis-trans isomerase Mip;   
  120::224     2e-14  37%  242 aa  FKBP6_ARATH RecName: Full=FKBP-type peptidyl-prolyl cis-trans
  115::253     3e-14  45%  256 aa  FKBP7_ARATH RecName: Full=Probable FKBP-type peptidyl-prolyl
   54::145     8e-14  45%  203 aa  FKB11_BOVIN RecName: Full=FK506-binding protein 11;       
   52::143     3e-13  43%  201 aa  FKB11_MOUSE RecName: Full=FK506-binding protein 11;       
   10::121     4e-13  47%  124 aa  FKBP_CANAL RecName: Full=FK506-binding protein 1;       
  109::222     4e-13  46%  223 aa  FKBP3_RABIT RecName: Full=FK506-binding protein 3;       
  110::223     5e-13  46%  224 aa  FKBP3_BOVIN RecName: Full=FK506-binding protein 3;       
  184::289     7e-13  31% 1219 aa  FKB15_HUMAN RecName: Full=FK506-binding protein 15;AltName:
  110::223     1e-12  44%  224 aa  FKBP3_HUMAN RecName: Full=FK506-binding protein 3;       
   35::129     1e-12  36%  167 aa  FKB2A_RHIOR RecName: Full=FK506-binding protein 2A;       
   57::143     1e-12  43%  201 aa  FKB11_HUMAN RecName: Full=FK506-binding protein 11;       
  122::239     2e-12  37%  247 aa  FKBP5_ARATH RecName: Full=Probable FKBP-type peptidyl-prolyl
  136::224     6e-12  44%  227 aa  FKBZ_PSEAE RecName: Full=Probable FKBP-type 25 kDa peptidyl-prolyl
  110::223     6e-12  43%  224 aa  FKBP3_MOUSE RecName: Full=FK506-binding protein 3;       
   46::140     2e-11  37%  327 aa  FKBP6_HUMAN RecName: Full=FK506-binding protein 6;       
  144::248     2e-11  40%  251 aa  FKBA_BUCBP RecName: Full=FKBP-type peptidyl-prolyl cis-trans
   46::140     4e-11  36%  327 aa  FKBP6_MOUSE RecName: Full=FK506-binding protein 6;       
   50::181     6e-11  47%  259 aa  FKBP7_HUMAN RecName: Full=FK506-binding protein 7;       
  130::237     6e-11  38%  241 aa  FKBA_BUCAI RecName: Full=FKBP-type peptidyl-prolyl cis-trans
  183::288     1e-10  30% 1216 aa  FKB15_MOUSE RecName: Full=FK506-binding protein 15;AltName:
  144::249     2e-10  38%  252 aa  FKBA_BUCAP RecName: Full=FKBP-type peptidyl-prolyl cis-trans
   45::139     3e-10  35%  326 aa  FKBP6_BOVIN RecName: Full=FK506-binding protein 6;       
  115::201     4e-09  37%  366 aa  FKBP6_DICDI RecName: Full=FK506-binding protein 6;       
   38::132     1e-08  34%  194 aa  FKBP3_DICDI RecName: Full=FK506-binding protein 3;       
   87::225     8e-08  35%  232 aa  FKBP1_ARATH RecName: Full=Probable FKBP-type peptidyl-prolyl
    2::46      1e-07  47%  142 aa  FKB9L_HUMAN RecName: Full=Putative FK506-binding protein 9-like
   45::86      6e-06  43%  157 aa  FKBP1_METJA RecName: Full=Putative FKBP-type peptidyl-prolyl
  148::242     1e-05  34%  449 aa  TIG_LACGA RecName: Full=Trigger factor;         Short=TF;
    8::87      1e-05  42%  154 aa  FKBP_METTL RecName: Full=FKBP-type peptidyl-prolyl cis-trans
   99::200     1e-05  41%  412 aa  FKBP8_HUMAN RecName: Full=FK506-binding protein 8;       
   55::156     2e-05  33%  365 aa  FKB42_ARATH RecName: Full=42 kDa peptidyl-prolyl isomerase;        
  156::241     2e-05  36%  434 aa  TIG_SODGM RecName: Full=Trigger factor;         Short=TF;
  152::232     2e-05  35%  439 aa  TIG_CAMLR RecName: Full=Trigger factor;         Short=TF;
  165::238     3e-05  34%  452 aa  TIG_OLICO RecName: Full=Trigger factor;         Short=TF;
  150::243     3e-05  30%  432 aa  TIG_HAES2 RecName: Full=Trigger factor;         Short=TF;
  150::243     3e-05  30%  432 aa  TIG_HAES1 RecName: Full=Trigger factor;         Short=TF;
  172::232     3e-05  34%  443 aa  TIG_CAMC1 RecName: Full=Trigger factor;         Short=TF;
  110::190     5e-05  40%  402 aa  FKBP8_MOUSE RecName: Full=FK506-binding protein 8;       
  156::244     7e-05  30%  439 aa  TIG_DICNV RecName: Full=Trigger factor;         Short=TF;
  154::240     9e-05  32%  434 aa  TIG_SHEPA RecName: Full=Trigger factor;         Short=TF;
  165::238     1e-04  32%  473 aa  TIG_METRJ RecName: Full=Trigger factor;         Short=TF;
  158::242     1e-04  31%  442 aa  TIG_LACAC RecName: Full=Trigger factor;         Short=TF;
  154::241     1e-04  33%  432 aa  TIG_HAEIG RecName: Full=Trigger factor;         Short=TF;
  157::230     2e-04  38%  435 aa  TIG_LEPCP RecName: Full=Trigger factor;         Short=TF;
  148::242     2e-04  31%  452 aa  TIG_LACH4 RecName: Full=Trigger factor;         Short=TF;
  162::224     2e-04  46%  442 aa  TIG_COXBU RecName: Full=Trigger factor;         Short=TF;
  162::224     2e-04  46%  442 aa  TIG_COXB2 RecName: Full=Trigger factor;         Short=TF;
  162::224     2e-04  46%  442 aa  TIG_COXB1 RecName: Full=Trigger factor;         Short=TF;
  172::232     2e-04  30%  441 aa  TIG_CAMC5 RecName: Full=Trigger factor;         Short=TF;
  158::243     2e-04  30%  427 aa  TIG_STRU0 RecName: Full=Trigger factor;         Short=TF;
  173::240     2e-04  32%  434 aa  TIG_SHEHH RecName: Full=Trigger factor;         Short=TF;
  165::236     2e-04  33%  491 aa  TIG_RHIME RecName: Full=Trigger factor;         Short=TF;
  161::241     2e-04  37%  436 aa  TIG_AERS4 RecName: Full=Trigger factor;         Short=TF;
  157::244     2e-04  31%  431 aa  TIG_ACTSZ RecName: Full=Trigger factor;         Short=TF;
    9::43      2e-04  46%   45 aa  FKBP3_VICFA RecName: Full=FKBP-type peptidyl-prolyl cis-trans
  158::208     3e-04  41%  432 aa  TIG_SALAR RecName: Full=Trigger factor;         Short=TF;
  157::228     3e-04  29%  433 aa  TIG_IDILO RecName: Full=Trigger factor;         Short=TF;
  154::241     3e-04  31%  432 aa  TIG_HAEIN RecName: Full=Trigger factor;         Short=TF;
  154::241     3e-04  31%  432 aa  TIG_HAEI8 RecName: Full=Trigger factor;         Short=TF;
  156::230     3e-04  32%  435 aa  TIG_GEOSF RecName: Full=Trigger factor;         Short=TF;
  158::243     4e-04  31%  427 aa  TIG_STRS7 RecName: Full=Trigger factor;         Short=TF;
  160::236     4e-04  36%  477 aa  TIG_OCHA4 RecName: Full=Trigger factor;         Short=TF;
  154::241     4e-04  31%  432 aa  TIG_HAEIE RecName: Full=Trigger factor;         Short=TF;
  158::208     4e-04  39%  432 aa  TIG_ENTS8 RecName: Full=Trigger factor;         Short=TF;
  160::236     4e-04  36%  477 aa  TIG_BRUSU RecName: Full=Trigger factor;         Short=TF;
  160::236     4e-04  36%  477 aa  TIG_BRUO2 RecName: Full=Trigger factor;         Short=TF;
  160::236     4e-04  36%  477 aa  TIG_BRUME RecName: Full=Trigger factor;         Short=TF;
  160::236     4e-04  36%  471 aa  TIG_BRUAB RecName: Full=Trigger factor;         Short=TF;
  160::236     4e-04  36%  471 aa  TIG_BRUA2 RecName: Full=Trigger factor;         Short=TF;
  160::236     4e-04  36%  471 aa  TIG_BRUA1 RecName: Full=Trigger factor;         Short=TF;
  158::228     4e-04  31%  434 aa  TIG_AZOSE RecName: Full=Trigger factor;         Short=TF;
    5::83      4e-04  35%  231 aa  FKBP2_METJA RecName: Full=Putative FKBP-type peptidyl-prolyl
  165::236     6e-04  32%  491 aa  TIG_SINMW RecName: Full=Trigger factor;         Short=TF;
  166::233     6e-04  36%  449 aa  TIG_JANMA RecName: Full=Trigger factor;         Short=TF;
  158::241     6e-04  31%  432 aa  TIG_ESCF3 RecName: Full=Trigger factor;         Short=TF;
  151::241     6e-04  29%  432 aa  TIG_ALISL RecName: Full=Trigger factor;         Short=TF;
  158::241     6e-04  37%  436 aa  TIG_AERHH RecName: Full=Trigger factor;         Short=TF;
  158::241     7e-04  27%  432 aa  TIG_VIBFM RecName: Full=Trigger factor;         Short=TF;
  153::230     7e-04  27%  429 aa  TIG_SYMTH RecName: Full=Trigger factor;         Short=TF;
  156::240     7e-04  29%  434 aa  TIG_SHELP RecName: Full=Trigger factor;         Short=TF;
  159::240     7e-04  32%  434 aa  TIG_SHEDO RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALTY RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALTI RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALSV RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALPK RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALPC RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALPB RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALPA RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALNS RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALHS RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALG2 RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALEP RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALDC RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALCH RecName: Full=Trigger factor;         Short=TF;
  158::208     7e-04  39%  432 aa  TIG_SALA4 RecName: Full=Trigger factor;         Short=TF;
  165::236     7e-04  32%  491 aa  TIG_RHISN RecName: Full=Trigger factor;         Short=TF;
  162::235     7e-04  34%  511 aa  TIG_PARL1 RecName: Full=Trigger factor;         Short=TF;
  162::220     7e-04  36%  437 aa  TIG_NITSB RecName: Full=Trigger factor;         Short=TF;
  172::249     7e-04  27%  444 aa  TIG_CAMJR RecName: Full=Trigger factor;         Short=TF;
  172::249     7e-04  27%  444 aa  TIG_CAMJE RecName: Full=Trigger factor;         Short=TF;
  172::249     7e-04  27%  444 aa  TIG_CAMJ8 RecName: Full=Trigger factor;         Short=TF;
  167::227     7e-04  31%  444 aa  TIG_ACIBY RecName: Full=Trigger factor;         Short=TF;
  167::227     7e-04  31%  444 aa  TIG_ACIBT RecName: Full=Trigger factor;         Short=TF;
  167::227     7e-04  31%  444 aa  TIG_ACIBS RecName: Full=Trigger factor;         Short=TF;
  167::227     7e-04  31%  444 aa  TIG_ACIBC RecName: Full=Trigger factor;         Short=TF;
  167::227     7e-04  31%  444 aa  TIG_ACIB5 RecName: Full=Trigger factor;         Short=TF;
  167::227     7e-04  31%  444 aa  TIG_ACIB3 RecName: Full=Trigger factor;         Short=TF;
  294::380     7e-04  31%  635 aa  PAS1_ARATH RecName: Full=Peptidyl-prolyl isomerase PASTICCINO1;    
  112::182     0.001  36%  328 aa  Y327_RICBR RecName: Full=Uncharacterized protein RBE_0327;
  158::241     0.001  27%  432 aa  TIG_VIBF1 RecName: Full=Trigger factor;         Short=TF;
  157::211     0.001  35%  441 aa  TIG_TERTT RecName: Full=Trigger factor;         Short=TF;
  157::240     0.001  30%  434 aa  TIG_SHEAM RecName: Full=Trigger factor;         Short=TF;
  150::233     0.001  33%  444 aa  TIG_RHOS4 RecName: Full=Trigger factor;         Short=TF;
  150::233     0.001  33%  444 aa  TIG_RHOS1 RecName: Full=Trigger factor;         Short=TF;
  159::241     0.001  30%  435 aa  TIG_NITMU RecName: Full=Trigger factor;         Short=TF;
  152::242     0.001  30%  439 aa  TIG_LACDB RecName: Full=Trigger factor;         Short=TF;
  152::242     0.001  30%  439 aa  TIG_LACDA RecName: Full=Trigger factor;         Short=TF;
  165::249     0.001  35%  451 aa  TIG_CUPTR RecName: Full=Trigger factor;         Short=TF;
  158::208     0.001  37%  432 aa  TIG_CITK8 RecName: Full=Trigger factor;         Short=TF;
  171::231     0.001  30%  435 aa  TIG_CAMFF RecName: Full=Trigger factor;         Short=TF;
    1::115

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQTTPSGLQFEDTVVGSGDEAKAGKHVTVHYTGWLFENGQAGRKFDSSKDRNDPFVFPLGAGHVIRGWDE
FKBP_NEIMB      ------GLIIEDLQEGFGKEAVKGKEITVHYTGWL----ENGTKFDSSLDRRQPLTITLGVGQVIKGWDE
FKBP_NEIMA      -------LIIEDLQEGFGKEAVKGKEITVHYTGWL----ENGTKFDSSLDRRQPLTITLGVGQVIKGWDE
FKBP_NEIMC      -------LIIEDLQESFGKEAVKGKEITVHYTGWL----EDGTKFDSSLDRRQPLTITLGVGQVIKGWDE
FKB2B_RHIOR     -------------------KSHSGDELSMHYTGTLFDTGE---KFDSSLDRNEPFVFTLGAGQVIQGWDQ
FKBP4_DICDI     --TLPSGLQYEDLVVGSGPSPKSGKKVGVKYIGKLTN----GKTFDSSL--RTPFTFRIGIREVIRGWDI
FKBP1_DICDI     ---------------GKGNIPPVGSNVTVHHAGTLTN----GTVFDSSRKRGQPFNFKLGAGQVIKGWDE
FKBP_STRCH      ----PADLAIKDIWEGDGPVAQAGQTVSVHYVGVAFSTGE---EFDASWNRGTPLQFQLGAGQVISGWDQ
FKBP_SCHPO      ----------EKQVISSGDFPKPGDRITMHYTGTLTN----GKKFDSSVDRGSPFVCTIGVGQLIRGWDE
FKB12_DROME     ------GVQVVPIAPGDGSTPKNGQKVTVHYTGTLDD----GTKFDSSRDRNKPFKFTIGKGEVIRGWDE
FKB39_DROME     -RTITGGVKIVDQVVGKGEEAKQGKRVSVYYIGRLQSNNKT---FDSLL-KGKPFKFALGGGEVIKGWDV
FKBP2_CANGA     ------GLKFEITISKCKLKALPGDMVSVHYTGSLAENGKV---FDSSLRRNEPIQFKLGAGQVIAGWEQ
FKB1A_MOUSE     ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFTLGKQEVIRGWEE
FKB1A_BOVIN     ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFVLGKQEVIRGWEE
FKB1A_RAT       ------GVQVETISSGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFTLGKQEVIRGWEE
FKB1A_NEUCR     ------GLQIEVQQEGQGTETRRGDNVDVHYKGVL----TSGKKFDASYDRGEPLNFTVGQGQVIKGWDE
FKBP_YARLI      ---------------------KKGDAVTIHYVGTL-ENGQ---KFDSSRDRGEPFKTTIGVGDVIRGWDE
FKBP_CANGA      -ETIEGGVKIDRLSPGDGKTPKQGDLVTIHYTGTL-ENGQ---KFDSSVDRGSPFQCNIGVGQVIKGWDA
FKBP2_DICDI     -------------------KTKSGDKLKIHYTGTLLN----GDKFDSSVDRGTPFEFKIGVGQVIKGWDQ
FKB1A_RABIT     ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFMLGKQEVIRGWEE
FKB1A_HUMAN     ------GVQVETISPGDGRTPKRGQTCVVHYTGML----EDGKKFDSSRDRNKPFKFMLGKQEVIRGWEE
FKB1A_XENLA     ------GVQVETITEGDGRTPKKGQTVVVHYVGSL----ENGKKFDSSRDRNKPFKFIIGRCEVIRGWEE
FKBP_CRYNV      ------GVTVENISAGDGKTPQPGDNVTIHYVGTLLD----GSKFDSSRDRGTPFVCRIGQGQVIRGWDE
FKBP2_YEAST     -------------------KAMPGDKVKVHYTGSLLESGTV---FDSSYSRGSPIAFELGVGRVIKGWDQ
FKB1A_ASPFU     ---------------GNGDFPKKGDFVTIHYTGRLTD----GSKFDSSVDRNEPFQTQIGTGRVIKGWDE
FKBP_GIBZE      ----------EKTIIGSGPSPQVGQKVTMEYTGWLQEDGTKGDQFDTSVGRGD-FVVNIGVGQVIKGWDE
FKBP4_NEUCR     ------GVTIDDRKVGTGRAAKNGDRVGMRYIGKL----QNGKVFDSNK-KGAPFSFKLGKGEVIKGWDI
FKBP2_CRYNE     -------------------KSRKGDRLSMHYTGTLAKDGS---KFDSSLDRNRPFEFTLGAGQVIKGWDQ
FKBP_YEAST      --------------ISPGDGAKTGDLVTIHYTGTL-ENGQ---KFDSSVDRGSPFQCNIGVGQVIKGWDV
FKBP_CRYNE      ------GVTVENISAGDGKTPQPGDSVTIHYVGTLLD----GSKFDSSRDRGTPFVCRIGQGQVIRGWDE
FKBP2_YARLI     -------------------KARKGDTVSVHYTGKL----EDGTVFDSSVERGQPIQFPLGTGRVIPGWDQ
FKBP_DEBHA      --SAPATTQVEILQEGDGKTPKPGDLVTIHYTGTL----ENGKKFDSSRDRGKPFQCTIGVGQVIVGWDT
FKBP4_SPOFR     ------GVSIEDLKVGSGPVAKAGKVVMVYYEGRLKQNN---KMFDNCV-KGPGFKFRLGSKEVISGWDV
FKBP2_MOUSE     -------------------KSRKGDVLHMHYTGKL----EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQ
FKBP2_HUMAN     -------------------KSRKGDVLHMHYTGKL----EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQ
FKBP2_BOVIN     -------------------KSRKGDVLHMHYTGKL----EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQ
FKBP_KLULA      ---------------------KPGDLVTIHYTGTL-ENGQ---KFDSSVDRGSPFQCNIGVGQVIKGWDA
FKBP4_GIBZE     ------GVTVDDRTVGNGRTVKSGDTVGVRYIGKL----QNGKQFDANK-KGKPFSFKAGKGQVIKGWDI
FKBA_AERHY      VKSTESGLQYQVEKMGTGAKPKATDIVKVHYTGTLTD----GTKFDSSVDRGEPATFPLN--QVIPGWTE
FKBP4_RHIOR     ----PNGLIIEDIKMGEGASCKNGQRVGMRYIGKL-TNGKVFDKNVSGK----PFSFLLGRGEVIKGWDL
FKBP2_KLULA     -------------------KASKGDVVSVHYTGKLRDSGEI---FDSSYNRGVPIQFKLGYSQVISGWDQ
FKB1A_EMENI     ------GVEVQRISPGDGKNPKPGDTVSIHYTGTLAD----GSKFDSSRDRPGTFVTQIGVGRVIKGWDE
FKBY_HAEIN      VKTTQSGLMYKIESAGKGDTIKSTDTVKVHYTGKL----PNGKVFDSSVERGQPVEFQLD--QVIKGWTE
FKBP4_CRYNE     ----PSGLIIEDIKIGDGPVAKTGKRLGMRYIGKLTN----GKQFDANTS-GKPFSFVLGKGEVIRGWDE
FKB70_WHEAT     ------------------DTPEVGDEVEVHYTGTLLD----GKKFDSSRDRDDTFKFKLGQGQVIKGWDQ
FKBP_ASHGO      ---------------------KTGDLVTIHYTGTL-ENEQ---KFDSSVDRGSPFQCNIGVGQVIKGWDV
FKB1B_MOUSE     ------GVEIETISPGDGRTPKKGQICVVHYTGML----QNGKKFDSSRDRNKPFKFRIGKQEVIKGFEE
FKBP3_ARATH     ---SPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKL-ENGKV---FDSSYNRGKPLTFRIGVGEVIKGWDQ
FKB1B_HUMAN     ------GVEIETISPGDGRTPKKGQTCVVHYTGML----QNGKKFDSSRDRNKPFKFRIGKQEVIKGFEE
FKB1B_BOVIN     ------GVEIETISPGDGRTPKKGQTCVVHYTGML----QNGKKFDSSRDRNKPFKFRIGKQEVIKGFEE
FKB1B_RAT       ------GVEIETISPGDGRTPKKGQICVVHYTGML----QNGKKFDSSRDRNKPFKFRIGKQEVIKGFEE
FKBP1_RHIOR     ------GVTVETIQPGDGKNPKKGDTVTMHYTGTL----QNGSVFDSSVRRNEPFVTQIGVGRVIKGWDE
FKB1B_RABIT     ------GVEIETISPGDGRTPKKGQTCVVHYTGML----QNGKKFDSSRDRNKPFKFRIGKQEVIKGFEE
FKB22_ARATH     -------------------QAHKGDTIKVHYRGKLTD----GTVFDSSFERGDPFEFKLGSGQVIKGWDQ
FKBP3_YARLI     ------GVKIEDRTVGEGPSAKVGSKVGVRYVGKLAN----GKVFDSNS-KGKPFYFSVGKGEVIRGWDI
FKB70_ARATH     -----------------------GDEVEVHYTGTLLD----GTKFDSSRDRATPFKFTLGQGQVIKGWDI
FKB1B_NEUCR     -------------VAGTGPQPEAGQTVVIEYTGWLKDSSQADGKGADSIGRGD-FVTQIGVGRLIRGWDE
FKBP4_USTMA     MTTTPSGLVIEEKSAGSGPPCKAGQKVGMRYVGKL-TNGKVFDQCTSGK----PFYFKLGKGEVIKGWDE
FKBP4_RAT       ---------------GTGTEAMIGDRVFVHYTGWLLD----GTKFDSSLDRKDKFSFDLGKGEVIKAWDI
FKBP4_RABIT     ---------------GTGTETPMGDRVFVHYTGWLLD----GTKFDSSLDRKDKFSFDLGKGEVIKAWDI
FKBP_ASPOR      ---------------GSGPSPASGDKVSIHYTGWIYDKGFQGKQFDSSRSPGGPLVVNIGQGKVIKGWDE
FKBP4_MOUSE     ---------------GTGTETPMGDRVFVHYTGWLLD----GTKFDSSLDRKDKFSFDLGKGEVIKAWDI
FKBP4_EMENI     ------GVIIDDKKLGKGPAAASGNTVAMRYIGKL-ENGKV---FDSNK-KGKPFTFKLGKGEVIKGWDI
FKBP3_ASHGO     ------GVVIEDRVVGSGKAAKKGARVGMRYIGKL-KNGKVFDKNTSGK----PFVFKLGHGEVIKGWDI
FKB1B_ASPFU     ------GLEKQTLRMGNGDHPQPGDPVELNYTGYLYDESNPGKEFDSSK-RRGPLKATIGAGDVIRGWDE
FKB15_VICFA     -------------------QAHKGDKVKVHYRGKLTD----GTVFDSSFERNSPIDFELGGGQVIKGWDQ
FKBP5_SAIBB     --------------VGHGEETPMGDRVYVHYNGKLAN----GKKFDSSHDRNEPFVFSIGKGQVIKAWDI
FKBP5_SAGOE     --------------VGHGEETPMGDKVYVHYNGKLSN----GKKFDSSHDRNEPFVFSIGKGQVIKAWDI
FKBP4_YEAST     ------GIIIEDRVTGKGPHAKKGTRVGMRYVGKL----KNGKVFDKNT-KGKPFVFKLGQGEVIKGWDI
FKBP4_HUMAN     ---------------GTGTEMPMGDRVFVHYTGWLLD----GTKFDSSLDRKDKFSFDLGKGEVIKAWDI
FKBP3_CANGA     -RTLEGGVVIEDRTVGDGPAAKKGDRVGMRYIGKL-KNGKVFDKNTSGK----PFVFKLGRGEVIKGWDV
FKBP4_BOVIN     ---------------GTGTETPMGDRVFVHYTGWLLD----GTKFDSSLDRKDRFSFDLGKGEVIKAWDI
FKBP2_EMENI     -----------------------GDTVKMHYRGTLAEDGS---QFDASYDRGTPFKFKLGAGRVIKGWDE
FKBP5_PONAB     --------------VGNGEETPMGDKVYVHYKGKLSN----GKKFDSSHDRNEPFVFSLGKGQVIKAWDI
FKBP5_HUMAN     --------------VGNGEETPMGDKVYVHYKGKLSN----GKKFDSSHDRNEPFVFSLGKGQVIKAWDI
FKBP5_AOTNA     --------------VGHGEETPMGDKVYVHYNGKLSN----GKKFDSSHDRNEPFVFSIGKGQVIKAWDI
FKBP3_YEAST     ------GIVIEDRTIGDGPQAKRGARVGMRYIGKL-KNGKVFDKNTSGK----PFAFKLGRGEVIKGWDI
FKBP2_NEUCR     -------------------KTRKGDKINVHYRGTLQSNGQ---QFDASYDRGTPFSFKLGGGQVIKGWDE
FKBA_NEIMB      VKTTASGLQYKITKQGEGKQPTKDDIVTVEYEGRLID----GTVFDSSKANGGPVTFPLS--QVIPGWTE
FKBP2_PODAN     ---------------------KKGDKINVHYKGTLKSNGE---KFDSSYDRQSPFSFKLGAGMVIKGWDE
FKBP_CORGL      ----PEDLVISDIIVGEGAEARPGGEVEVHYVGVDFETGE---EFDSSWDRGQTSQFPLNG--LIAGWQE
FKBP3_KLULA     ------GIIIEDRVTGKGKACKKGSKVGMRYIGKL-KNGKVFDKNTSGK----PFVFNLGRGEVIKGWDI
FKBP2_ASPFU     -------------VVECNRKTTKGDTVHMHYRGTLAADGS---EFDSSYGRNQPLKFKLGAGRVIKGWDE
FKB21_ARATH     -------------------QAHKGDKIKVHYRGKLTD----GTVFDSSFERGDPIEFELGTGQVIPGWDQ
FKB10_MOUSE     -RASPAGAPLEDVVIACPREVQMGDFVRYHYNG-TFEDG---KKFDSSYDRSTLVAIVVGVGRLITGMDR
FKB10_HUMAN     ---SPAGGPLEDVVIACPREVQMGDFVRYHYNG-TFEDG---KKFDSSYDRNTLVAIVVGVGRLITGMDR
FKBP5_MOUSE     --------------VGTSDEAPMGDKVYVHYKGMLSD----GKKFDSSHDRKKPFAFSLGQGQVIKAWDI
FKBP5_CERAE     --------------VGNGEETPMGDKVYVHYKGKLSN----GKKFNSSHDRNEPFVFSLGKSQVIKAWDI
FKBB_SHIFL      VNSTESGLQFRVINQGEGAIPARTDRVRVHYTGKLID----GTVFDSSVARGEPAEFPVNG--VIPGWIE
FKBB_ECOLI      VNSTESGLQFRVINQGEGAIPARTDRVRVHYTGKLID----GTVFDSSVARGEPAEFPVNG--VIPGWIE
FKB10_BOVIN     -RASPAGGPLEDVVIERYHEVQMGDFVRYHYNG-TFEDG---KKFDSSYDRHTLVAIVVGVGRLITGMDR
FKBP3_DEBHA     -KTLLGGVVTEDRKTGKGQTAKSGNKVGIRYIGKL-KNGKVFDKNTSGK----PFVFGLGKGECIKGFDL
FKBP2_ASPOR     -----------------------GDTVQMHYKGTLQSDGS---EFDSSYKRNSPLKFKVGSGMVIKGWDE
FKBP5_DICDI     -----------------------GDRVSIKYAGWLENNQRVGSLFDSNLQSETPFRFVVGEGKVIKGWDL
MIP_TRYCR       ----PSGLVFQRIARGSGKRAPADDKCEVHYTGRLRD----GTVFDSSRERGKPTTFR--PNEVIKGWTE
FKBP4_CANGA     -QVLEGGVIIEDRKIGEGPKAKKGSKVGMRYIGKL-KNGKVFDKNTSGK----PFYFKLHRGEVIKGWDI
FKBP3_CANAL     -KTLLGGVITEDRKIGSGATAKSGAKVGIRYIGKL-KNGKVFDKNTSGK----PFSFKLGKGECIKGFDL
MIP_LEGLO       ----PSGLQYK--IIDAGTGAKPGKSVTVEYTGTLID----GTVFDSTEKAGKPATFQVS--QVIPGWTE
FKB12_VICFA     ------GVEKQIIRAGTGPNPSRGQNVTVHCTGY-GKNGDLSQKFWSTKDPGNPFTFKIGQGSVIKGWDE
FKBP2_GIBZE     -------------------KTQKGDGVHMHYRGTLKDSG---KQFDASYDRGTPLSFKVGAGQVIKGWDE
FKB59_DROME     ---------------GTGTETPSGCTVSLHYTGRLVD----GTEFDSSLSRNEPFEFSLGKGNVIKAFDM
FKBP4_ARATH     -----SGLGFCDLDVGFGDEAPRGVLVNIHYTARFAD----GTLFDSSYKRARPLTMRIGVGKVIRGLDQ
FKB12_ARATH     ---------------GNGPKPAPGQTVTVHCTGF-GKDGDLSQKFWSTKDEGQPFSFQIGKGAVIKGWDE
MIP_COXBU       VKTLANGLQYKVLQAGQGQSPTLNDEVTVNYEGRLIN----GTVFDSSYKRGQPATFPLKS--VIKGWQE
FKBP2_ARATH     MVTTESGLQYKDIKVGRGPSPPVGFQVAANYVAMV----PSGQIFDSSLEKGLPYLFRVGSGQVIKGLDE
MIP_LEGPH       ----PSGLQYK--VINSGNGVKPGKSVTVEYTGRLID----GTVFDSTEKTGKPATFQVS--QVIPGWTE
FKBPH_SCHPO     -QVLEGNVTVQDKVKGDGPAAKRKKRVSMRYIGRLTN----GKVFDKNIT-GKPFTFNLGLEEVIKGWDV
FKBP2_DEBHA     -------------------KSKPGDLISVHYEGKL----EDGTVFDSSYSRGQPISFQLGIGQVIQGWDQ
MIP_LEGPN       ----PSGLQYK--VINAGNGVKPGKSVTVEYTGRLID----GTVFDSTEKTGKPATFQVS--QVIPGWTE
MIP_LEGPC       ----PSGLQYK--VINAGNGVKPGKSVTVEYTGRLID----GTVFDSTEKTGKPATFQVS--QVIPGWTE
FKBP4_SCHPO     --------------------ATNGKKVEMRYIGKL-ENGKV---FDKNT-KGKPFAFILGRGEVIRGWDV
MIP_LEGMI       ----PSGLQYN--ILERGDGAKPTKDVTVEYTGKLID----GQVFDSTEKTGKPATFKVS--QVIPGWTE
FKBP4_ASPFU     ------GVKIDDXXXXXXXXXXXXNTVAMRYIGKL----EDGKVFDANK-KGKPFTFKLGKGEVIKGWDI
FKBP5_RHIOR     -QLTPDGGVTKRIIAGLGQRPEPTNFVSVHYDAYLLDTSE---KFDSSRDRNTEFTFQLRDSKVIEAWEL
FKBP4_ASPOR     ------GVKIDDXXXXXXXXXXXXNTVAMRYIGKL----EDGKVFDANK-KGKPFTFKLGKGEVIKGWDI
FKB14_PONAB     -------------------KTKGGDLMLVHYEGYLEKDGSL---FHSTHKHNNPIWFTLGILEALKGWDQ
FKB14_HUMAN     -------------------KTKGGDLMLVHYEGYLEKDGSL---FHSTHKHNNPIWFTLGILEALKGWDQ
FKB14_MOUSE     -------------------KTKGGDLMLVHYEGYLEKDGSL---FHSTHKHNNPVWFTLGILEVLKGWDQ
FKBP9_RAT       ---------------------RSGDFVRYHYVGTFLD----GQKFDSSYDRDSTFSVFVGKGQLIAGMDQ
FKBP9_MOUSE     ----------------------SGDFVRYHYVGTFLD----GQKFDSSYDRDSTFNVFVGKGQLIAGMDQ
FKBP7_MOUSE     --------------------SRKGDLLNAHYDGYLAKDGS---KFYCSRDEGHPKWFVLGVGHVIKGLDI
FKBP9_BOVIN     ------GISIENKVVPENCESQSGDFLRYHYNGTLLD----GTFFDSSYSRNRTFDTYIGQGYVIPGIDE
FKBP9_HUMAN     -------ISIENKVVPENCESQSGDFLRYHYNGTLLD----GTLFDSSYSRNRTFDTYIGQGYVIPGMDE
MIP_CHLPN       VEVQPSKLQYKIIKEGAGKAISGKPSALLHYKG-SFINGQV---FSSSEGNNEPILLPLG--QTIPGFAL
FKBP7_PONAB     --------------------SKKGDLLNAHYDGYLAKDGS---KFYCSRTQNEPKWFVLGVGQVIKGLDI
FKBA_ECOLI      VKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLID----GKEFDNSYTRGEPLSFRLDG--VIPGWTE
FKBA_ECOL6      VKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLID----GKEFDNSYTRGEPLSFRLDG--VIPGWTE
FKBA_ECO57      VKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLID----GKEFDNSYTRGEPLSFRLDG--VIPGWTE
FKB1B_EMENI     ---------------GNGDSPHTGDTVIIDYTGYLYDDTRGGTQFDTSQGRG-PLKTEIGVGKVILGWDK
MIP_CHLTR       IELEPNKLQYRVVKEGTGRVLSGKPTALLHYTGSFID----GKVFDSSEKNKEPILLPLTK--VIPGFSQ
MIP_CHLMU       IELEPNKLQYRIVKEGTGRVLTGKPNALLHYTGSFIN----GKVFDTSEKNKDPILLPLTK--VISGFSQ
FKBP6_ARATH     -----SGLIYRDFNVGQGDFPKDGQQVTFHYIGY----NESGRRIDSTYIQGSPARIRMGTNALVPGFEM
FKBP7_ARATH     ---TQSGLQYKDLRVGTGPIAKKGDKVVVDWDGYTI--GYYGRIFEARNDDKEFFKFTLGSNEVIPAFEE
FKB11_BOVIN     ------------------EPATFGDTLHIHYSGSLVD----GRIFDTSLTR-DPLVIELGQKQVIPGLEQ
FKB11_MOUSE     ------------------ESAAIGDTLHIHYTGSLVD----GRIIDTSLTR-DPLVIELGQKQVIPGLEQ
FKBP_CANAL      -------------IVQEGDNAKPGDTVTIHYDGKLTN----GKEFDSSRKRGKPFTCTVGVGQVIKGWDG
FKBP3_RABIT     --------KYTKSVLKKGDKTKKGDVVHCWYTGTL----QDGTVFDSKKKKNKPLSFKVGVGKVIRGWDE
FKBP3_BOVIN     --------KYTKSVLKKGDKTKKGDVVHCWYTGTL----QDGTVFDSKKKKNKPLSFKVGIGKVIRGWDE
FKB15_HUMAN     ----------QDLIVADGPAVEVGDSLEVAYTGWLFQNHVLGQVFDSTANKDKLLRLKLGSGKVIKGWED
FKBP3_HUMAN     --------KYTKSVLKKGDKTKKGDVVHCWYTGTL----QDGTVFDTNKKNAKPLSFKVGVGKVIRGWDE
FKB2A_RHIOR     -----------------GLKASSSSTVRIHYRSRVW--GQE-EYFESTYIREAPLEVKLGNGNLLKGIED
FKB11_HUMAN     -----------------------GDTLHIHYTGSLVD----GRIIDTSLTR-DPLVIELGQKQVIPGLEQ
FKBP5_ARATH     ----PNGIRYYDQRVGGGATPRAGDLVVIDLKGQVQGTGQVFVDTFGTKDKKKPLALVVGSKPYSKGLCE
FKBZ_PSEAE      ---------------GQGNGIGAATQVHVRYRGLLAD----GQVFDQSESAE---WFALDS--VIEGWRT
FKBP3_MOUSE     --------KYTKSILKKGDKTKKGDVVHCWYTGTLPD----GTVFDSKKKKNKPLSFKVGVGKVIRGWDE
FKBP6_HUMAN     ---------------GAGDLVAPDASVLVKYSGYL---EHMDRPFDSNYFRKTPRLMKLGEDITLWGMEL
FKBA_BUCBP      ---TSSGLVFFIKKKGSGKFLHDSDVITVHYKGSLIN----GNEFDNSYKRGQPLSFSLDS--VIPGWIE
FKBP6_MOUSE     ---------------GTGDTVTPDASVLVKYSGYL---EHMDKPFDSNCFRKTPRLMKLGEDITLWGMEL
FKBP7_HUMAN     --------------------SKKGDLLNAHYDGYLAKDGS---KFYCSRTQNEPKWFVLGVGQVIKGLDI
FKBA_BUCAI      VKKTSSGLLYLLERAGEGEALKDETKITVHYKGTLIN----GLEFDNSYKRGRP--VSLRLKDVILGWXX
FKB15_MOUSE     ----------QDLVAAEGPAVETGDSLEVAYTGWLLQNHVLGQVFDSTANKDKPLRLKLGSGKVVXXXXX
FKBA_BUCAP      ---TSSGLLYIIDKLGEGEEIKTNAEITVHYKGSLIN----GTEFDSSYKRGKPITLMLK--DVILGWQE
FKBP6_BOVIN     ---------------GAGELVTPDASVLVKYSGYL---EHMDKPFDSNCFRKTPRLMKLGEDITLWGMEL
FKBP6_DICDI     ---------------GYGEIPPPRSIVTVHYEGYLSNQVL----FDSSVQRNSPFTFQMGTKSVIDAIEL
FKBP3_DICDI     -----------------GKTASIGDYISLKYVG-KFEDGTV---FDSSEIHGGSFNFTIGERKVIPGLEI
FKBP1_ARATH     --TGPEGLKFYDIEEGKGPVATEGSTAQVHYRSITAISTRESKLLAGNRSIAQPYEFKVGSTPGKERKRE
FKB9L_HUMAN     --------------------------------------------------------------------DM
FKBP1_METJA     ----------------------------------------------------EPIGFIVGNGELIEGFEE
TIG_LACGA       --------QNAELVLKDGKAAK-GDTVTIDYTGTI-----DGKPFDGGSAQN--YSLELGSGTFIPGFED
FKBP_METTL      -----------------------GVKIKVDYIGKL----ESGDVFDTSPDREEPLEFVVGEGQLIQGFEE
FKBP8_HUMAN     -----NGLLRKKTLVGSSRPVK-GQVVTVHLQTSL-ENG--------TRVQEEPLVFTLGDCDVIQALDL
FKB42_ARATH     -------------IIKEGHGSKPSKYSTLHYRAWT-KNSQ--HKFEDTWHEQQPIELVLGKEKKLAGLAI
TIG_SODGM       ------------------DAAGAEDRVTVDFTGTI-----DGEAFDGGKATD--FVLAMGQGRMIPGFEE
TIG_CAMLR       ---TPEAIK-EDRALKEGDFAKFD-----------FEGFVDGKAFDGGKAQN--YVLEIGSKQFIPGFEE
TIG_OLICO       -----------------GAKAENGDRVTLAFKGTI-----DGEAFEGGSGENIPLV--LGSNSFIPGFED
TIG_HAES2       ------------TWIETQDVAKADDRVTIDFVGSV-----DGEEFEGGKSTD--FVLAMGQGRMIPGFEE
TIG_HAES1       ------------TWIETQDVAKADDRVTIDFVGSV-----DGEEFEGGKSTD--FVLAMGQGRMIPGFEE
TIG_CAMC1       -----------------------------------FEGFVDGVAFDGGKAEN--YVLEIGSNQFIPGFED
FKBP8_MOUSE     -----------------------GQVVTVHLQMSL-ENG--------TRVQEEPLAFTLGDCDVIQALDL
TIG_DICNV       -----------DKIAGNGDR------LTLDFIGTL-----NGEPFEGGK--GEDFCFNLGSGQMLPDFER
TIG_SHEPA       -----------DRAAAEGDKAK------INFVGSI-----DGEEFEGGKA--DDFELQLGSGRMIPGFES
TIG_METRJ       -----------------GAEAQSGDRVTIDFVGRI-----DGEEFQGGK--GEGIDLELGSGSFIPGFED
TIG_LACAC       -------------------KAENGDTVTIDYKGTI-----DGKEFDGGSAEN--YSLELGSGTFIPGFED
TIG_HAEIG       ----------------SQDIAKADDRVTIDFVGSV-----DGEEFEGGKATD--FVLFMGQGRMIPGFEE
TIG_LEPCP       -----------------GEYAVDGDRVTIDFEGKI-----DGETFQGGKA--EAFQFILGEGRMLEAFEK
TIG_LACH4       --------QNAELVLKKGKSAK-GDTVTIDYKGTI-----DGKEFEGGSAEN--YSLELGSGAFIPGFED
TIG_COXBU       --------------------AKADDRVIIDFEGTL-----DGKPFESAKD----FQLELGSKRMIAGFEE
TIG_COXB2       --------------------AKADDRVIIDFEGTL-----DGKPFESAKD----FQLELGSKRMIAGFEE
TIG_COXB1       --------------------AKADDRVIIDFEGTL-----DGKPFESAKD----FQLELGSKRMIAGFEE
TIG_CAMC5       -----------------------------------FEGFVDGEAFEGGKAEN--YLLEIGSGQFIPGFED
TIG_STRU0       ------------------DAAVEGDTVVIDFVGSV-----DGVEFDGGKGEN--FSLELGSGQFIPGFED
TIG_SHEHH       -----------------------------------------GEEFEGGKA--DDFELQLGSGRMIPGFES
TIG_RHIME       -------------------KAANGDRVTVDYLGKV-----DGEAFDGGKDEDAELV--LGSNRFIPGFEE
TIG_AERS4       -----------------------GMRVTMDFIGSI-----DGEEFDGGKAEG--FNLVLGAGRMIPGFED
TIG_ACTSZ       --------------------ANAEDRVTIDFSGTI-----DGEEFEGGKASD--FVLFMGQGRMIPGFEE
FKBP3_VICFA     LTVAPSGLSFCDKVVGTGPQAVKGQLIKAHYVGRL-----------------------------------
TIG_SALAR       --------------------ADAEDRVTLDFTGTV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_IDILO       -------------------KSKKGDRVTMDFVGSI-----DGEEFEGGKA--DDFALELGEGRMIPGFED
TIG_HAEIN       ----------------SQDVVKADDRVTIDFVGSV-----DGEEFEGGKATD--FVLFMGQGRMIPGFEE
TIG_HAEI8       ----------------SQDVVKADDRVTIDFVGSV-----DGEEFEGGKATD--FVLFMGQGRMIPGFEE
TIG_GEOSF       ----------------AGVAAKSGDYVTFDFKGSI-----DGVPFDGGAA--DDFQLELGSGRFIPGFED
TIG_STRS7       ------------------DAAVEGDTVVIDFVGSV-----DGVEFDGGK--GDNFSLELGSGQFIPGFEE
TIG_OCHA4       -------------------ETKKGKRVTIDYLGKL-----DGEPFEGGADNDAQLV--LGSGQFIPGFEE
TIG_HAEIE       ----------------SQDVVKADDRVTIDFVGSV-----DGEEFEGGKATD--FVLFMGQGRMIPGFEE
TIG_ENTS8       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFEE
TIG_BRUSU       -------------------ETKKGKRVTIDYLGKL-----DGEPFEGGADNDAQLV--LGSGQFIPGFEE
TIG_BRUO2       -------------------ETKKGKRVTIDYLGKL-----DGEPFEGGADNDAQLV--LGSGQFIPGFEE
TIG_BRUME       -------------------ETKKGKRVTIDYLGKL-----DGEPFEGGADNDAQLV--LGSGQFIPGFEE
TIG_BRUAB       -------------------ETKKGKRVTIDYLGKL-----DGEPFEGGADNDAQLV--LGSGQFIPGFEE
TIG_BRUA2       -------------------ETKKGKRVTIDYLGKL-----DGEPFEGGADNDAQLV--LGSGQFIPGFEE
TIG_BRUA1       -------------------ETKKGKRVTIDYLGKL-----DGEPFEGGADNDAQLV--LGSGQFIPGFEE
TIG_AZOSE       --------------------AQDGDRVVIDFAG-----RKDGELFEGGKAQDFPFV--IGAGSMLKDFES
FKBP2_METJA     -----------------------GKMVKISYDGYV-----DGKLFDTTNEEYGPVAIFAGEGQVLPGLDE
TIG_SINMW       -------------------KAANGDRVTIDYLGKV-----DGEAFDGGKDEDAELV--LGSNRFIPGFEE
TIG_JANMA       ---------------GSDLTAKNGDRVTIDFVGTI-----DGVEFQGGKAED--YAFVLGEGRMLAEFEA
TIG_ESCF3       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKASD--FVLAMGQGRMIPGFED
TIG_ALISL       ---------WSDADVAAEDGTRATINFVGSIDGELFEGGKA-----------DNFPLEMGQGRMIPGFED
TIG_AERHH       --------------------AADGMRVTMDFVGSI-----DGEEFDGGKAEG--FNLVLGAGRMIPGFED
TIG_VIBFM       --------------------AEDGTRATINFVGSI-----DGEEFEGGKAENFPL--EMGQGRMIPGFED
TIG_SYMTH       -------------VTDESGEVGQGSFAVIDFEGFI-----DGEPFEGGK--GEGYTVEIGSGTFIPGFEE
TIG_SHELP       -------------------EAAEGDKAKIDFVGSI-----DGEEFEGGKAED--FELQLGSGRMIPGFES
TIG_SHEDO       ----------------------AGDKVKMNFVGSI-----DGEEFDGGKA--DDFELEIGSNRMIPGFET
TIG_SALTY       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALTI       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALSV       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALPK       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALPC       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALPB       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALPA       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALNS       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALHS       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALG2       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALEP       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALDC       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALCH       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_SALA4       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKATD--FVLAMGQGRMIPGFED
TIG_RHISN       -------------------KAANGDRVTIDYLGKV-----DGVAFDGGKDEDAELV--LGSNRFIPGFEE
TIG_PARL1       -----------------GAKAETGDLLTIDFVGKIFEGG-------SAEDAN----LEIGSGRFIPGFEE
TIG_NITSB       --------------------AKEGDLVVIDFKGTL----EDGSEIEGGSAQN--FELRLGSGQFIPGFEE
TIG_CAMJR       -----------------------------------FEGFVDDKAFEGGKAEN--YVLEIGSKQFIPGFED
TIG_CAMJE       -----------------------------------FEGFVDDKAFEGGKAEN--YVLEIGSKQFIPGFED
TIG_CAMJ8       -----------------------------------FEGFVDDKAFEGGKAEN--YVLEIGSKQFIPGFED
TIG_ACIBY       -----------------------------------FEGSIDGEKFEGGSAED--FKLVLGSGRMIPGFED
TIG_ACIBT       -----------------------------------FEGSIDGEKFEGGSAED--FKLVLGSGRMIPGFED
TIG_ACIBS       -----------------------------------FEGSIDGEKFEGGSAED--FKLVLGSGRMIPGFED
TIG_ACIBC       -----------------------------------FEGSIDGEKFEGGSAED--FKLVLGSGRMIPGFED
TIG_ACIB5       -----------------------------------FEGSIDGEKFEGGSAED--FKLVLGSGRMIPGFED
TIG_ACIB3       -----------------------------------FEGSIDGEKFEGGSAED--FKLVLGSGRMIPGFED
PAS1_ARATH      --------------------------LSVHYKGMLL-NEEKTVFYDSKIDNNDPLEFSSGEGLVPEGFEM
Y327_RICBR      ---------FKINTIGTGNPASCGHVVTVFYQISDMSNNLISE---------DTKTFTIGSGAVMLGLDN
TIG_VIBF1       --------------------AEDGTRATINFVGSI-----DGEEFEGGKAENFPL--EMGQGRMIPGFED
TIG_TERTT       -------------------KSKKGDKVTIDFLGKI-----DGEAFDGGEAKGHQL--ELGSGSMIPGFEK
TIG_SHEAM       --------------------AEEGDKVVINFVGSV-----DGEEFQGGKAEG--FELQLGSGRMIPGFEE
TIG_RHOS4       -----SAQNFEDRRKGS--KAKDGDQVVIDFKGSV-----DGELFEGGSAEDYPLV--LGSGSFIPGFEE
TIG_RHOS1       -----SAQNFEDRRKGS--KAKDGDQVVIDFKGSV-----DGELFEGGSAEDYPLV--LGSGSFIPGFEE
TIG_NITMU       --------------------AQAGDRINIDYRGLI-----DGAEFAGGKAEN--FSLVLGEGRLLKDFEE
TIG_LACDB       -------------MVLKNDKAENGDTVTIDYVGTV-----DGVEFDGGSAQN--YSLELGSNTFIPGFED
TIG_LACDA       -------------MVLKNDKAENGDTVTIDYVGTV-----DGVEFDGGSAQN--YSLELGSNTFIPGFED
TIG_CUPTR       ---------------GADVTAQNGDRVTVDFVGKI-----DGVEFAGGKAEDFPFV--LGEGRMLPEFEQ
TIG_CITK8       --------------------ADAEDRVTIDFTGSV-----DGEEFEGGKASD--FVLAMGQGRMIPGFED
TIG_CAMFF       -----------------------------------FEGFVDGEAFEGGKAEG--YLLEIGSGQFIPGFED


                         .         .         *         .         .         .         .:140
query           GVQGMKVGGTRRLVIPADLGYGARGAGGVIPPNATLLFEVELLAV
FKBP_NEIMB      GFGGMKEGGKRKLTIPSEMGYGAHGAGGVIPPHATLIFEVELLKV
FKBP_NEIMA      GFGGMKEGGKRKLTIPSEMGYGARGAGGVIPPHATLIFEVELLKV
FKBP_NEIMC      GFGGMKEGGKRKLTIPSEMGYGAHGAGGVIPPHATLIFEVELLKV
FKB2B_RHIOR     GLLGMCVGEKRRLVIPPHLGYGERGAGGVIPGGATLVFEVELLEI
FKBP4_DICDI     GVASMKVGGKRRLTIPADLAYGRSGAPPSIPPNATLIFDVELVS-
FKBP1_DICDI     GVAKMKVGETSKLTISPDFGYGARGAGGVIPPNATLVFEVELI--
FKBP_STRCH      GVQGMKVGGRRELIIPAHLAYGDRGAGGKIAPGETLIFVCDLVAV
FKBP_SCHPO      GVPKMSLGEKAKLTITPDYGYGPRGFPGLIPPNSTLLFDVELLAI
FKB12_DROME     GVAQLSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKV
FKB39_DROME     GVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVELKAV
FKBP2_CANGA     GITGMCLGEKRTLHIPPELAYGSRGAGGVIPPNAVLDFDVELVDI
FKB1A_MOUSE     GVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVELL--
FKB1A_BOVIN     GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELL--
FKB1A_RAT       GVAQMSVGQRAKLIISPDYAYGATGHPGIIPPHATLVFDVELL--
FKB1A_NEUCR     GLLGMKIGEKRKLTIAPHLAYGNRAVGGIIPANSTLIFETELVGI
FKBP_YARLI      GVPKLSLGERSVLTISGDYGYGERGFPGLIPPNATLVFDVELLGI
FKBP_CANGA      GIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLIFDVELLKV
FKBP2_DICDI     GVLGMCVGEKRKLIIPPSLGYGQQGAGDKIPGNSHLIFDVELIGI
FKB1A_RABIT     GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL--
FKB1A_HUMAN     GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL--
FKB1A_XENLA     GVAQMSVGQRARLTCSPDFAYGATGHPGIIPPNATLTFDVELL--
FKBP_CRYNV      GVPQLSVGQKANLICTPDYAYGARGFPPVIPPNSTLKFEVELLKV
FKBP2_YEAST     GVAGMCVGEKRKLQIPSSLAYGERGVPGVIPPSADLVFDVELVDV
FKB1A_ASPFU     GVPQMSLGEKAVLTITPDYGYGARGFPPVIPGNSTLIFEVELLGI
FKBP_GIBZE      GVTQMKLGEKATLHISPDYGYGPRGFPGAIPPNSTLIFDVEL---
FKBP4_NEUCR     GVAGMAVGGERRLTIPAHLAYGSRALPG-IPPNSTLIFDVKLLEI
FKBP2_CRYNE     GLLDMCISEKRKLTIPSHLAYGERGHPPVIPPQSTLVFEVELLGI
FKBP_YEAST      GIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNSTLVFDVELLKV
FKBP_CRYNE      GVPQLSIGQKANLICTPDYAYGARGFPPVIPPNSTLKFEVELLKI
FKBP2_YARLI     GILGMCVGEKRKLTIPPHLAYGKQGAGRVIPPDSTLIFTTELVSI
FKBP_DEBHA      GIPKLSVGSRAKLSIPGHEAYGDRGFPGLIPPNATLLFDVELLNV
FKBP4_SPOFR     GIAGMKVGGKRKIVCPPAMAYGAKGSPPVIPPNSTLVFEVDL---
FKBP2_MOUSE     GLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKI
FKBP2_HUMAN     GLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKI
FKBP2_BOVIN     GLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKI
FKBP_KLULA      AIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATLVFDVELLKI
FKBP4_GIBZE     GVIGMAIGGERRLTIPAHLAYGSRGLPG-IPANSTLIFDVKLLEI
FKBA_AERHY      GVQLMPVGSKFKFFLPSKLAYGEHGAGS-IPANAVLVFDVELLAI
FKBP4_RHIOR     GIAGMKAGGERKLTIPAPLAYGKRGAPPDIPKNATLVFDVKLLSM
FKBP2_KLULA     GILGMCIGEGRTLHIPSELGYGSRGAGSVIPPDADLIFETELVDI
FKB1A_EMENI     GVLQLSVGEKAKLICTPDYAYGARGFPPVIPPNATLTFEVELLKI
FKBY_HAEIN      GLQLVKKGGKIQFVIAPELGYGEQGAGASIPPNSTLIFDVEVLDV
FKBP4_CRYNE     GLAGMAVGGERRLTIPAALAYGNQKIPG-IPKNSTLKFDVKLVSI
FKB70_WHEAT     GIKTMKKGENALFTIPPELAYGESGSPPTIPANATLQFDVELLS-
FKBP_ASHGO      AIPKLSVGEKARLTIPGAYAYGPRGFPGLIPPNATLIFEVELLKV
FKB1B_MOUSE     GTAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLSL
FKBP3_ARATH     GILGMLTGGKRTLRIPPELAYGDRGAGCLIPPASVLLFDIEYI--
FKB1B_HUMAN     GAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELL--
FKB1B_BOVIN     GAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELL--
FKB1B_RAT       GAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELL--
FKBP1_RHIOR     GVLQLSLGQKANLICTPDYAYGPRGFPPVIPPNATLNFEVELLKI
FKB1B_RABIT     GAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFGVELL--
FKB22_ARATH     GLLGACVGEKRKLKIPAKLGYGEQGSPPTIPGGATLIFDTELIAV
FKBP3_YARLI     GVQGMKVKGERRIIIPPGMAYGKQKLPG-IPPNSQLTFDVKVVNI
FKB70_ARATH     GIKTMKKGENAVFTIPAELAYGESGSPPTIPANATLQFDVELL--
FKB1B_NEUCR     AVLKMKVGEKATLDISSDYGYGERGFHGHIPPNADLIFDVYL---
FKBP4_USTMA     GVKGMRVGAERRLTCPPKLAYGNQKIPG-IPANSTLVFDVKLVEI
FKBP4_RAT       AVATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVEL---
FKBP4_RABIT     AVATMKVGELCRITCKPEYAYGSAGSPPKIPPNATLVFEVEL---
FKBP_ASPOR      GVMQMSLGEKSTLTITPDYGYGDK-AAGKIPANSTLIFEVELLKI
FKBP4_MOUSE     AVATMKVGEVCHITCKPEYAYGAAGSPPKIPPNATLVFEVEL---
FKBP4_EMENI     GVAGMAVGGERRITIPSHLAYGKKGVPG-IPGNSKLIFDVKLLEI
FKBP3_ASHGO     GVAGMAVGGERRIVIPAAYAYGKQALPG-IPANSELTFDVKLVSL
FKB1B_ASPFU     GVRQMSLGEKAILTMSGEYAYGEKGFPGLIPPNASLVFEVELLKI
FKB15_VICFA     GLLGMCLGEKRKLKIPAKLGYGEQGSPPTIPGGATLIFDTELVGV
FKBP5_SAIBB     GVATMKKGEICHLLCKPEYAYGATGSLPKIPSNATLFFEVELL--
FKBP5_SAGOE     GVSTMKKGEICHLLCKPEYAYGATGSLPKIPSNATLFFEVELL--
FKBP4_YEAST     GVAGMAVGGERRIVIPAPYAYGKQALPG-IPANSELTFDVKLVSM
FKBP4_HUMAN     AIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVEL---
FKBP3_CANGA     GVAGMSVGSERRIIIPAPYAYGKQALPG-IPANSELTFDVKLVSI
FKBP4_BOVIN     AVATMKVGEVCHITCKPEYAYGLAGSPPKIPPNATLVFEVEL---
FKBP2_EMENI     GLLDMCVGEKRTLTIPPEYGYGDRGI-GPIPGGATLIFQTELLEI
FKBP5_PONAB     GVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELL--
FKBP5_HUMAN     GVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELL--
FKBP5_AOTNA     GVATMKKGEICHLLCKPEYAYGATGSLPKIPSNATLFFEIELL--
FKBP3_YEAST     GVAGMSVGGERRIIIPAPYAYGKQALPG-IPANSELTFDVKLVSM
FKBP2_NEUCR     GLVDMCIGEKRTLTVPPSYGYGQRSI-GPIPAGSTLIFETELIGI
FKBA_NEIMB      GVQLLKEGGEATFYIPSNLAYREQGAGDKIGPNATLVFDVKLVKI
FKBP2_PODAN     GLVDMCIGEKRTLTIGPSYGYGDRNV-GPIPAGSTLVFETELVGI
FKBP_CORGL      GIPGMKVGGRRQLTIPPEAAYGPEGSGHPL-SGRTLVFIIDLIS-
FKBP3_KLULA     GVAGMAVGGERRIVIPAPYAYGKQALPG-IPANSELTFDVKLVSL
FKBP2_ASPFU     GLLDMCVGEKRTLTIPPEYGYGERGI-GPIPGGATLIFETELVQI
FKB21_ARATH     GLLGACVGEKRKLKIPSKLGYGDNGSPPKIPGGATLIFDTELVAV
FKB10_MOUSE     GLMGMCVNERRRLIVPPHLGYGSIGVAGLIPPDATLYFDVVLLDV
FKB10_HUMAN     GLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATLYFDVVLLDV
FKBP5_MOUSE     GVSTMKKGEICHLLCKPEYAYGSAGHLQKIPSNATLFFEIELL--
FKBP5_CERAE     GVATMKKGEICHLLCKPEYAYGSAGSVPKIPSNATLFFEIELL--
FKBB_SHIFL      ALTLMPVGSKWELTIPQELAYGERGAGASIPPFSTLVFEVELLEI
FKBB_ECOLI      ALTLMPVGSKWELTIPQELAYGERGAGASIPPFSTLVFEVELLEI
FKB10_BOVIN     GLMGMCVNERRRLIVPPHLGYGSIGVAGLIPPDATLYFDVVLLDV
FKBP3_DEBHA     GVAGMAVGGERRVVIPPKMGYGSQALPG-LPANSELTFDIKLVSI
FKBP2_ASPOR     GLLDMCIGEKRTLTIPPEYGYGSRGV-GPIPGGATLIFETELVGI
FKBP5_DICDI     GVIGMRKSAKRILVIPSELAYGKKG-HSTIPPNTNLIFDLEV---
MIP_TRYCR       ALQLMREGDRWRLFIPYDLAYGVTGGGGMIPPYSPLEFDVELISI
FKBP4_CANGA     GVTGMAIGGERRIVIPAPYAYGKQTLPG-IPANSELTFDVKLVSL
FKBP3_CANAL     GVTGMAVGGERRVIIPPKMGYGSQALPG-IPANSELTFDIKLVSL
MIP_LEGLO       ALQLMPAGSTWEVFVPADLAYGPRSVGGPIGPNETLIFKIHLISV
FKB12_VICFA     GVLGMQLGEVARLRCSPDYAYGAGGAWG-IQPNSVLEFEIEVL--
FKBP2_GIBZE     GLLDMCIGEKRVLTIPPEFGYGQR-AIGPIPAGSTLVFETELVGI
FKB59_DROME     GVATMKLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEML--
FKBP4_ARATH     GILGMRVGGKRKLQIPPKLAYGPEPAGCFIPGNATLLYDINFVEI
FKB12_ARATH     GVIGMQIGEVARLRCSSDYAYGAGGAWG-IQPNSVLDFEIEVLSV
MIP_COXBU       ALTRMKPGAIWEIYVPPQLAYGEQGAPGVIGPNEALIFKVNLISV
FKBP2_ARATH     GILSMKAGGKRRLYIPGPLAFGLVSAPGRVAPNSPVIFDVSL---
MIP_LEGPH       ALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISV
FKBPH_SCHPO     GIVGMQVGGERTIHIPAAMAYGSKRLPG-IPANSDLVFDVKLLAV
FKBP2_DEBHA     GLTRMCIGEKRKLTIPSHLAYGDRGV-GPIPAKATLVFVAELVDI
MIP_LEGPN       ALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISV
MIP_LEGPC       ALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISV
FKBP4_SCHPO     GVAGMQEGGERKITIPAPMAYGNQSIPG-IPKNSTLVFEVKLVRV
MIP_LEGMI       ALQLMPAGSTWEVYIPSNLAYGPRSVGGPIGPNETLIFKIHLISV
FKBP4_ASPFU     GIAGMAVGGERRITIPPHLAYGKKALPG-IPANSKLIFDVKLLEI
FKBP5_RHIOR     AIPTMQVGELAEIICTSDYGYGDQGRQYIVPPRAQLRFEVELI--
FKBP4_ASPOR     GVAGMAVGGERRISIPPHLAYGKKALPG-IPGNSKLIFDVKLLEI
FKB14_PONAB     GLKGMCVGEKRKLIIPPALGYGKEGK-GKIPPESTLIFNIDLLEI
FKB14_HUMAN     GLKGMCVGEKRKLIIPPALGYGKEGK-GKIPPESTLIFNIDLLEI
FKB14_MOUSE     GLKGMCVGEKRKLTVPPALGYGKEGK-GKIPPESTLIFNIDLLEI
FKBP9_RAT       ALVGMCVNERRFVTIPPNLAYGSEGVSGVIPPNSVLHFDVLLVDI
FKBP9_MOUSE     ALVGMCVNERRLVTIPPNLAYGSEGVSGVIPPNSVLHFDVLLVDI
FKBP7_MOUSE     AMMDMCPGEKRKVIIPPSFAYGKEGAEGKIPPNATLMFEIELYAV
FKBP9_BOVIN     GLLGVCIGEKRRIVVPPHLGYGEEGRGN-IPGSAVLVFDIHVI--
FKBP9_HUMAN     GLLGVCIGEKRRIVVPPHLGYGEEGRGN-IPGSAVLVFDIHVI--
MIP_CHLPN       GMQGMKEGETRVLYIHPDLAY---GTAGQLPPNSLLIFEINLI--
FKBP7_PONAB     AMTDMCPGEKRKVVIPPSFAYGKEGAEGKIPPDATLIFEIELYAV
FKBA_ECOLI      XXXXXXXXXXXXXVIPPELAYGKAGVPG-IPPNSTLVFDVELLDV
FKBA_ECOL6      XXXXXXXXXXXXXVIPPELAYGKAGVPG-IPPNSTLVFDVELLDV
FKBA_ECO57      XXXXXXXXXXXXXVIPPELAYGKAGVPG-IPPNSTLVFDVELLDV
FKB1B_EMENI     GVQQMTLGEKAILTISSDNGYGKRGFPGLIPPDSGLVLYV-----
MIP_CHLTR       GMQGMKEGEVRVLYIHPDLAY---GTAGQLPPNSLLIFEVKLI--
MIP_CHLMU       GMQGMREGEVRVLYIHPDLAY---GTSGQLPPNSLLIFEVKLI--
FKBP6_ARATH     GIRDMKPGGRRRIIIPPELGPPV-GPSTFFSSKQFEVFDVELLSI
FKBP7_ARATH     AVSGMALGGIRRIIVPPELGYGQRALDFVLRNDKTLLFDVELLKI
FKB11_BOVIN     SLLDMCVGEKRRVIIPSHLAYGKRGFPPSIPADAELHFDVELIAL
FKB11_MOUSE     SLLDMCVGEKRRAVIPSHLAYGKRGYPPSIPADAVVQYDVELIAL
FKBP_CANAL      GANLPKISGTKALTIPPNLAYXXXXXXXXXXXNETLVFEVELLGV
FKBP3_RABIT     ALLTMSKGEKARLEIEPEWAYGKKGPDAKIPPNAKLIFEVELVDI
FKBP3_BOVIN     ALLTMSKGEKARLEIEPEWAYGKKGPDAKIPPNAKLIFEVELVDI
FKB15_HUMAN     XXXXXXXXXXXXXIVPPACAVGSEGVGWTQATDSILVFEVEVRRV
FKBP3_HUMAN     ALLTMSKGEKARLEIEPEWAYGKKGPDAKIPPNAKLTFEVELVDI
FKB2A_RHIOR     GIHGMCTGEIRRLLIPPNQAYGAIGIPNLVPPNTAIVVDVEMVNV
FKB11_HUMAN     SLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIAL
FKBP5_ARATH     GIRSMKAGGKRRVIVPPSLGFGVDGAGLQIPPNASLEYIVEI---
FKBZ_PSEAE      ALRAMPVGARWRVVIPSAQAYGHEGAGDLIPPDAPLVFEIDLL--
FKBP3_MOUSE     ALLTMSKGEKARLEIEPEWAYGKKGPDAKIPPNTKLIFEVELVDI
FKBP6_HUMAN     GLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELL--
FKBA_BUCBP      XXXXXXXXXXXXXXXPPKLAYGETGVPG-IPGNSTLIFEIELIDI
FKBP6_MOUSE     GLLSMRKGELARFLFKPAYAYGTLGCPPLIPPNATVLFEIELI--
FKBP7_HUMAN     AMTDMCPGEKRKVVIPPSFAYGKEGYGGKIPPDATLIFEIELYAV
FKBA_BUCAI      XXXXXXXXXXXXXVIPPNLAYGTEEVNG-IPANSTLIFDIELLDV
FKB15_MOUSE     XXXXXXXXXXXXIITPSACAAGSEGVGWTQPTDSILVFEVEVRRV
FKBA_BUCAP      XXXXXXXXXXXXXXXPPNLGYGSNRINE-IPANSILIFDIELLDI
FKBP6_BOVIN     GLLSMRRGELARFLFKPTYAYGTLGCPPLIPPNTTVLFEIELL--
FKBP6_DICDI     SISTMKVGQEAEIVTTQRYAFGKLGLPPFIPPNVSV---------
FKBP3_DICDI     GTINICEGEKRSIKIPYQLAYGENGIENAIPPRTDIYFDLEVVSI
FKBP1_ARATH     FVEGMKVGGKRTVIVPPEAGYGQKGM-NEIPPGATFELNIELLRV
FKB9L_HUMAN     GLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELL--
FKBP1_METJA     AVIGMEVGEEKTVTIPPEKGYGLR---------------------
TIG_LACGA       QLIGHKAGDDVDVVVTFPEDYGAKDLAGKEAHFATKIHEVK----
FKBP_METTL      AVLDMEVGDEKTVKIPAEKAYGNR---------------------
FKBP8_HUMAN     SVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTL---
FKB42_ARATH     GVASMKSGERALVHVGWELAYGKEGNFSFVPPMADLLYEVEVI--
TIG_SODGM       GVIGHKAGESFDISVTFPEDYHAENLKGKAAKFAVELKKVE----
TIG_CAMLR       GMIGLKIGEEKDINVTFPKEYGATHLAG-----------------
TIG_OLICO       QLTGIGVGETRVIKVPFPKNYGAAHLAG-----------------
TIG_HAES2       GIIGHKAGEQFEINVTFPETYHAENLKGKAAKFSITLKKVEVM--
TIG_HAES1       GIIGHKAGEQFEINVTFPETYHAENLKGKAAKFSITLKKVEVM--
TIG_CAMC1       GMVGMKVGSEKDIEVKFPENYGAANLAG-----------------
FKBP8_MOUSE     SVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTL---
TIG_DICNV       GLQGMKAGEEKSFDVQFPEDYPSENLAGKTAQFAATLKKVEAM--
TIG_SHEPA       GVEGHKAGEEFNIEVTFPEDYHAENLKGKVATFAITLNEVQ----
TIG_METRJ       QLVGAKVGDKRLVKVTFPESYGAEHLAG-----------------
TIG_LACAC       QLVGHEAGDDVDVVVTFPKDYGAKDLAGKEAHFATKIHEVK----
TIG_HAEIG       GIVGHKAGEQFDIDVTFPAEYHAENLKGKAAKFAITLKKVE----
TIG_LEPCP       AVRGMKTGESKTLAFPADY-HGADVAG------------------
TIG_LACH4       QLIGHEAGDDVDVVVTFPKDYGAKDLAGKEAHFATKIHEVK----
TIG_COXBU       GIEGMKPGESKALDIPAD---------------------------
TIG_COXB2       GIEGMKPGESKALDIPAD---------------------------
TIG_COXB1       GIEGMKPGESKALDIPAD---------------------------
TIG_CAMC5       GMIGLKTGDSKDIEVTFPAEYGAAHLAG-----------------
TIG_STRU0       QLVGTKAGETKNVEVTFPEDYQAEDLAGKAATFVTTVHEVK----
TIG_SHEHH       GVEGHKAGEEFNIEVTFPEDYHAENLKGKVATFAITLNEVQ----
TIG_RHIME       QLVGVKAGDEKTITVTFPADYPAANLAG-----------------
TIG_AERS4       AIMGKKAGDTIEVTFPAD--YHAENLKGKAAKFASKLIKVE----
TIG_ACTSZ       GVIGHKAGEQFDIDVTFPADYHAENLKGKAAKFAITLKKVEVMVL
FKBP3_VICFA     ---------------------------------------------
TIG_SALAR       GVKGHKVG-------------------------------------
TIG_IDILO       QIKGIKAGEEKTIEVTFPEDYHAENLKG-----------------
TIG_HAEIN       GIVGHKAGEQFDIDVTFPAEYHAENLKGKAAKFAITLKKIE----
TIG_HAEI8       GIVGHKAGEQFDIDVTFPAEYHAENLKGKAAKFAITLKKIE----
TIG_GEOSF       QLVGMKSGDESEIKVTFPENYGQKDLAG-----------------
TIG_STRS7       QLVGAKAGDTVEVNVTFPENYQAEDLAGKAAKFVTTVHEVK----
TIG_OCHA4       QLVGVKAGDEKVITVTFPAEYGAAHLAG-----------------
TIG_HAEIE       GIIGHKAGEQFDIDVTFPAEYHAENLKGKAAKFAITLKKIE----
TIG_ENTS8       GIKGHKAG-------------------------------------
TIG_BRUSU       QLIGLKAGDEKVITVTFPAEYGAAHLAG-----------------
TIG_BRUO2       QLIGLKAGDEKVITVTFPAEYGAAHLAG-----------------
TIG_BRUME       QLIGLKAGDEKVITVTFPAEYGAAHLAG-----------------
TIG_BRUAB       QLIGLKAGDEKVITVTFPAEYGAAHLAG-----------------
TIG_BRUA2       QLIGLKAGDEKVITVTFPAEYGAAHLAG-----------------
TIG_BRUA1       QLIGLKAGDEKVITVTFPAEYGAAHLAG-----------------
TIG_AZOSE       AVGGLKVGETKTFEMTFPEDYHAADLAG-----------------
FKBP2_METJA     AILEMDVGEEREVVLPPEKAFGKR---------------------
TIG_SINMW       QLVGAKAGDEKTITVTFPADYPAANLAG-----------------
TIG_JANMA       GTIGLKVGESKTLAFPAD---------------------------
TIG_ESCF3       GIKGHKAGEEFTIDVTFPEDYHAENLKGKAAKFAINLKKVE----
TIG_ALISL       GIKGKKAGDELTINVNFPEDYHAENLKGKAAEFAITVVKVE----
TIG_AERHH       AIMGKKAGDTIDVTFPAD--YHAENLKGKAAKFASKLNKVE----
TIG_VIBFM       GIKGKKAGDELTIDVNFPEEYHAENLKGKAAQFAIKVVKVE----
TIG_SYMTH       GLVGAKAGETREVTVTFPEDYHAQHLAG-----------------
TIG_SHELP       GVEGHKAGEAFDIDVTFPEDYHAENLKGKVAKFAITLKEVQ----
TIG_SHEDO       GVTGHKAGETFDIEVSFPEDYHAENLKGKAAKFAITLTEVQ----
TIG_SALTY       GVKGHKAG-------------------------------------
TIG_SALTI       GVKGHKAG-------------------------------------
TIG_SALSV       GVKGHKAG-------------------------------------
TIG_SALPK       GVKGHKAG-------------------------------------
TIG_SALPC       GVKGHKAG-------------------------------------
TIG_SALPB       GVKGHKAG-------------------------------------
TIG_SALPA       GVKGHKAG-------------------------------------
TIG_SALNS       GVKGHKAG-------------------------------------
TIG_SALHS       GVKGHKAG-------------------------------------
TIG_SALG2       GVKGHKAG-------------------------------------
TIG_SALEP       GVKGHKAG-------------------------------------
TIG_SALDC       GVKGHKAG-------------------------------------
TIG_SALCH       GVKGHKAG-------------------------------------
TIG_SALA4       GVKGHKAG-------------------------------------
TIG_RHISN       QLVGVKAGDEKTITVTFPADYPAANLAG-----------------
TIG_PARL1       QLVGVKVGDETQVKVAFPADYGAEHLAG-----------------
TIG_NITSB       QVEGMKKGETKTIEV------------------------------
TIG_CAMJR       GMVGMKIGEEKDIKVTFPKEYGAAHLAGKDAVFKVKLHEIQELKI
TIG_CAMJE       GMVGMKIGEEKDIKVTFPKEYGAAHLAGKDAVFKVKLHEIQELKI
TIG_CAMJ8       GMVGMKIGEEKDIKVTFPKEYGAAHLAGKDAVFKVKLHEIQELKI
TIG_ACIBY       GIIGMKAGEEKVIDVTFPEDYQAENLAG-----------------
TIG_ACIBT       GIIGMKAGEEKVIDVTFPEDYQAENLAG-----------------
TIG_ACIBS       GIIGMKAGEEKVIDVTFPEDYQAENLAG-----------------
TIG_ACIBC       GIIGMKAGEEKVIDVTFPEDYQAENLAG-----------------
TIG_ACIB5       GIIGMKAGEEKVIDVTFPEDYQAENLAG-----------------
TIG_ACIB3       GIIGMKAGEEKVIDVTFPEDYQAENLAG-----------------
PAS1_ARATH      CTRLMLPGEIALVTCPPDYAYDKFPRPPGVSEGAHVQWEIELL--
Y327_RICBR      VIVGMNVGQAREAIIPA----------------------------
TIG_VIBF1       GIKGKKAGEELTIDVNFPEEYHAENLKGKAAQFAIKVVKVE----
TIG_TERTT       GITGMKAGETQ----------------------------------
TIG_SHEAM       GIKGHKAGEEFEIDVTFPEEYHAENLKGKAAKFAITLTEVK----
TIG_RHOS4       QLVGTKVDDEVTVKVSFPAEYGAKHLAG-----------------
TIG_RHOS1       QLVGTKVDDEVTVKVSFPAEYGAKHLAG-----------------
TIG_NITMU       PLLGMSPGQSKTFEVAFPSDYHGKEVAG-----KTAVFEVKLSGV
TIG_LACDB       QLVGHGAGEEVDVVVTFPEDYGAKDLAGKEAHFATKIHEVK----
TIG_LACDA       QLVGHGAGEEVDVVVTFPEDYGAKDLAGKEAHFATKIHEVK----
TIG_CUPTR       ATLGLKVGESKTLAFPADY-HGKEVAGKTAEFTVTL---------
TIG_CITK8       GIKGHKAG-------------------------------------
TIG_CAMFF       GMLGLKVGEQKDVNVTFPAEYGAAHLAG-----------------