[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07717.1

[Show Plain Result]


## Summary of Sequence Search
    1::884
    1::874       0.0 100%  874 aa  SYA_RALME RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  88%  874 aa  SYA_RALEJ RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  86%  874 aa  SYA_RALEH RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  76%  874 aa  SYA_BURPP RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  76%  874 aa  SYA_BURXL RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  77%  874 aa  SYA_BURP8 RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  77%  874 aa  SYA_BURM1 RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  75%  874 aa  SYA_BURVG RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  75%  874 aa  SYA_BURCC RecName: Full=Alanyl-tRNA synthetase;       
    1::884       0.0  77%  884 aa  SYA_RALSO RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  75%  874 aa  SYA_BURCH RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  75%  874 aa  SYA_BURS3 RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  75%  874 aa  SYA_BURCA RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  74%  874 aa  SYA_BURCM RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  74%  874 aa  SYA_BURA4 RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  76%  874 aa  SYA_BURPS RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  76%  874 aa  SYA_BURP6 RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  76%  874 aa  SYA_BURP1 RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  76%  874 aa  SYA_BURP0 RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  76%  874 aa  SYA_BURMS RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  76%  874 aa  SYA_BURM9 RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  76%  874 aa  SYA_BURM7 RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  76%  874 aa  SYA_BURMA RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  75%  874 aa  SYA_BURTA RecName: Full=Alanyl-tRNA synthetase;       
    1::873       0.0  70%  873 aa  SYA_AZOSE RecName: Full=Alanyl-tRNA synthetase;       
    1::873       0.0  70%  873 aa  SYA_BORA1 RecName: Full=Alanyl-tRNA synthetase;       
    1::868       0.0  67%  869 aa  SYA_JANMA RecName: Full=Alanyl-tRNA synthetase;       
    1::873       0.0  68%  874 aa  SYA_METFK RecName: Full=Alanyl-tRNA synthetase;       
    1::868       0.0  68%  869 aa  SYA_HERAR RecName: Full=Alanyl-tRNA synthetase;       
    1::871       0.0  69%  872 aa  SYA_THIDA RecName: Full=Alanyl-tRNA synthetase;       
    1::857       0.0  71%  875 aa  SYA_METPP RecName: Full=Alanyl-tRNA synthetase;       
   10::876       0.0  66%  876 aa  SYA_RHOFD RecName: Full=Alanyl-tRNA synthetase;       
    1::871       0.0  67%  871 aa  SYA_DECAR RecName: Full=Alanyl-tRNA synthetase;       
    8::874       0.0  67%  874 aa  SYA_DELAS RecName: Full=Alanyl-tRNA synthetase;       
    8::874       0.0  67%  874 aa  SYA_POLNA RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  67%  874 aa  SYA_POLSQ RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  69%  874 aa  SYA_BORBR RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  68%  874 aa  SYA_BORPA RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  69%  874 aa  SYA_BORPE RecName: Full=Alanyl-tRNA synthetase;       
    1::871       0.0  68%  885 aa  SYA_AZOSB RecName: Full=Alanyl-tRNA synthetase;       
    1::873       0.0  67%  873 aa  SYA_BORPD RecName: Full=Alanyl-tRNA synthetase;       
   12::877       0.0  66%  878 aa  SYA_POLSJ RecName: Full=Alanyl-tRNA synthetase;       
    8::874       0.0  68%  874 aa  SYA_ACISJ RecName: Full=Alanyl-tRNA synthetase;       
    1::875       0.0  68%  875 aa  SYA_LEPCP RecName: Full=Alanyl-tRNA synthetase;       
    1::858       0.0  64%  862 aa  SYA_NITMU RecName: Full=Alanyl-tRNA synthetase;       
    1::859       0.0  62%  863 aa  SYA_NITEU RecName: Full=Alanyl-tRNA synthetase;       
    1::859       0.0  62%  863 aa  SYA_NITEC RecName: Full=Alanyl-tRNA synthetase;       
    1::877       0.0  66%  877 aa  SYA_CHRVO RecName: Full=Alanyl-tRNA synthetase;       
    3::844       0.0  62%  872 aa  SYA_VEREI RecName: Full=Alanyl-tRNA synthetase;       
   10::882       0.0  62%  882 aa  SYA_STRMK RecName: Full=Alanyl-tRNA synthetase;       
    1::873       0.0  60%  874 aa  SYA_NEIMF RecName: Full=Alanyl-tRNA synthetase;       
    1::873       0.0  60%  874 aa  SYA_NEIMA RecName: Full=Alanyl-tRNA synthetase;       
    1::873       0.0  60%  874 aa  SYA_NEIMB RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  59%  875 aa  SYA_SACD2 RecName: Full=Alanyl-tRNA synthetase;       
    1::873       0.0  60%  874 aa  SYA_NEIM0 RecName: Full=Alanyl-tRNA synthetase;       
    1::873       0.0  60%  874 aa  SYA_NEIG1 RecName: Full=Alanyl-tRNA synthetase;       
    4::877       0.0  60%  882 aa  SYA_XANAC RecName: Full=Alanyl-tRNA synthetase;       
    1::872       0.0  59%  872 aa  SYA_MARMS RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  62%  875 aa  SYA_KLEP7 RecName: Full=Alanyl-tRNA synthetase;       
    3::859       0.0  59%  859 aa  SYA_VIBF1 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  62%  875 aa  SYA_ERWCT RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  63%  875 aa  SYA_CITK8 RecName: Full=Alanyl-tRNA synthetase;       
    6::856       0.0  61%  875 aa  SYA_SODGM RecName: Full=Alanyl-tRNA synthetase;       
    6::873       0.0  58%  874 aa  SYA_SHEFN RecName: Full=Alanyl-tRNA synthetase;       
    5::871       0.0  58%  874 aa  SYA_HAEIG RecName: Full=Alanyl-tRNA synthetase;       
    5::871       0.0  58%  874 aa  SYA_HAEIE RecName: Full=Alanyl-tRNA synthetase;       
    5::871       0.0  58%  874 aa  SYA_HAEI8 RecName: Full=Alanyl-tRNA synthetase;       
    1::875       0.0  59%  876 aa  SYA_MARAV RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  876 aa  SYA_ECOUT RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  876 aa  SYA_ECOK1 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  876 aa  SYA_ECOSM RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  876 aa  SYA_SHISS RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  876 aa  SYA_SHIBS RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  876 aa  SYA_ECOL5 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  876 aa  SYA_ECOHS RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  876 aa  SYA_ECO24 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  62%  876 aa  SYA_SHIFL RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  62%  876 aa  SYA_SHIF8 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  876 aa  SYA_SHIB3 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  876 aa  SYA_SHIDS RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  60%  876 aa  SYA_SALTY RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  876 aa  SYA_ECO57 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  60%  876 aa  SYA_SALTI RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  60%  876 aa  SYA_ECOLI RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  60%  876 aa  SYA_ECOLC RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  60%  876 aa  SYA_ECODH RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  60%  876 aa  SYA_SALCH RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  60%  876 aa  SYA_SALPA RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  60%  876 aa  SYA_SALPB RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  59%  875 aa  SYA_ENT38 RecName: Full=Alanyl-tRNA synthetase;       
    1::861       0.0  60%  864 aa  SYA_THICR RecName: Full=Alanyl-tRNA synthetase;       
    5::871       0.0  58%  874 aa  SYA_HAEIN RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  875 aa  SYA_ENTS8 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  61%  875 aa  SYA_SERP5 RecName: Full=Alanyl-tRNA synthetase;       
    3::860       0.0  58%  860 aa  SYA_VIBVU RecName: Full=Alanyl-tRNA synthetase;       
    8::873       0.0  58%  874 aa  SYA_SHEWM RecName: Full=Alanyl-tRNA synthetase;       
    3::860       0.0  58%  860 aa  SYA_VIBVY RecName: Full=Alanyl-tRNA synthetase;       
    8::873       0.0  56%  874 aa  SYA_SHESH RecName: Full=Alanyl-tRNA synthetase;       
    1::861       0.0  62%  867 aa  SYA_METCA RecName: Full=Alanyl-tRNA synthetase;       
    3::865       0.0  57%  865 aa  SYA_VIBHB RecName: Full=Alanyl-tRNA synthetase;       
    3::860       0.0  57%  860 aa  SYA_VIBPA RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  60%  876 aa  SYA_SALAR RecName: Full=Alanyl-tRNA synthetase;       
    5::874       0.0  58%  874 aa  SYA_ACTSZ RecName: Full=Alanyl-tRNA synthetase;       
    8::873       0.0  58%  874 aa  SYA_SHESM RecName: Full=Alanyl-tRNA synthetase;       
    3::860       0.0  59%  860 aa  SYA_VIBC3 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  58%  875 aa  SYA_YERPY RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  58%  875 aa  SYA_YERPS RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  58%  875 aa  SYA_YERPB RecName: Full=Alanyl-tRNA synthetase;       
    6::876       0.0  60%  876 aa  SYA_PHOLL RecName: Full=Alanyl-tRNA synthetase;       
    3::860       0.0  59%  860 aa  SYA_VIBCH RecName: Full=Alanyl-tRNA synthetase;       
    6::873       0.0  58%  874 aa  SYA_SHEB9 RecName: Full=Alanyl-tRNA synthetase;       
    6::873       0.0  58%  874 aa  SYA_SHEB5 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  58%  875 aa  SYA_YERPP RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  58%  875 aa  SYA_YERPN RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  58%  875 aa  SYA_YERPG RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  58%  875 aa  SYA_YERPE RecName: Full=Alanyl-tRNA synthetase;       
    6::873       0.0  58%  874 aa  SYA_SHEB8 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  58%  875 aa  SYA_YERP3 RecName: Full=Alanyl-tRNA synthetase;       
    5::870       0.0  56%  874 aa  SYA_HAES2 RecName: Full=Alanyl-tRNA synthetase;       
    5::870       0.0  57%  874 aa  SYA_HAES1 RecName: Full=Alanyl-tRNA synthetase;       
    1::853       0.0  61%  874 aa  SYA_PSEP1 RecName: Full=Alanyl-tRNA synthetase;       
    1::853       0.0  61%  874 aa  SYA_PSEPK RecName: Full=Alanyl-tRNA synthetase;       
    1::853       0.0  61%  874 aa  SYA_PSEPW RecName: Full=Alanyl-tRNA synthetase;       
    8::873       0.0  57%  874 aa  SYA_SHELP RecName: Full=Alanyl-tRNA synthetase;       
    3::873       0.0  56%  873 aa  SYA_PHOPR RecName: Full=Alanyl-tRNA synthetase;       
    1::853       0.0  60%  874 aa  SYA_PSEPG RecName: Full=Alanyl-tRNA synthetase;       
    4::877       0.0  58%  882 aa  SYA_XANOR RecName: Full=Alanyl-tRNA synthetase;       
    4::877       0.0  58%  882 aa  SYA_XANOP RecName: Full=Alanyl-tRNA synthetase;       
    4::877       0.0  58%  882 aa  SYA_XANOM RecName: Full=Alanyl-tRNA synthetase;       
    4::877       0.0  57%  882 aa  SYA_XANC8 RecName: Full=Alanyl-tRNA synthetase;       
    1::853       0.0  61%  874 aa  SYA_PSESM RecName: Full=Alanyl-tRNA synthetase;       
    8::873       0.0  57%  874 aa  SYA_SHEDO RecName: Full=Alanyl-tRNA synthetase;       
    8::873       0.0  58%  874 aa  SYA_SHESR RecName: Full=Alanyl-tRNA synthetase;       
    4::877       0.0  56%  882 aa  SYA_XANCB RecName: Full=Alanyl-tRNA synthetase;       
    8::873       0.0  58%  874 aa  SYA_SHESA RecName: Full=Alanyl-tRNA synthetase;       
    2::865       0.0  57%  865 aa  SYA_IDILO RecName: Full=Alanyl-tRNA synthetase;       
    4::877       0.0  56%  882 aa  SYA_XANCP RecName: Full=Alanyl-tRNA synthetase;       
    4::877       0.0  59%  882 aa  SYA_XANC5 RecName: Full=Alanyl-tRNA synthetase;       
    5::870       0.0  59%  874 aa  SYA_PASMU RecName: Full=Alanyl-tRNA synthetase;       
    3::874       0.0  56%  874 aa  SYA_AERHH RecName: Full=Alanyl-tRNA synthetase;       
    8::873       0.0  58%  874 aa  SYA_SHEON RecName: Full=Alanyl-tRNA synthetase;       
    3::874       0.0  58%  874 aa  SYA_AERS4 RecName: Full=Alanyl-tRNA synthetase;       
    6::873       0.0  58%  874 aa  SYA_SHESW RecName: Full=Alanyl-tRNA synthetase;       
    6::873       0.0  58%  874 aa  SYA_SHEPC RecName: Full=Alanyl-tRNA synthetase;       
    1::850       0.0  60%  874 aa  SYA_PSEU2 RecName: Full=Alanyl-tRNA synthetase;       
    8::873       0.0  56%  874 aa  SYA_SHEHH RecName: Full=Alanyl-tRNA synthetase;       
    4::879       0.0  57%  884 aa  SYA_XYLFM RecName: Full=Alanyl-tRNA synthetase;       
    4::879       0.0  58%  884 aa  SYA_XYLFA RecName: Full=Alanyl-tRNA synthetase;       
    5::874       0.0  55%  874 aa  SYA_HAEDU RecName: Full=Alanyl-tRNA synthetase;       
    4::879       0.0  57%  884 aa  SYA_XYLFT RecName: Full=Alanyl-tRNA synthetase;       
    4::879       0.0  57%  884 aa  SYA_XYLF2 RecName: Full=Alanyl-tRNA synthetase;       
    5::874       0.0  55%  874 aa  SYA_ACTP7 RecName: Full=Alanyl-tRNA synthetase;       
    1::864       0.0  60%  874 aa  SYA_PSEE4 RecName: Full=Alanyl-tRNA synthetase;       
    5::874       0.0  55%  874 aa  SYA_ACTPJ RecName: Full=Alanyl-tRNA synthetase;       
    3::865       0.0  57%  868 aa  SYA_PSEHT RecName: Full=Alanyl-tRNA synthetase;       
    5::874       0.0  55%  874 aa  SYA_ACTP2 RecName: Full=Alanyl-tRNA synthetase;       
    1::850       0.0  60%  874 aa  SYA_PSE14 RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  56%  875 aa  SYA_YERE8 RecName: Full=Alanyl-tRNA synthetase;       
    5::875       0.0  57%  875 aa  SYA_MANSM RecName: Full=Alanyl-tRNA synthetase;       
    1::853       0.0  60%  874 aa  SYA_PSEF5 RecName: Full=Alanyl-tRNA synthetase;       
    1::862       0.0  56%  863 aa  SYA_ALCBS RecName: Full=Alanyl-tRNA synthetase;       
    1::875       0.0  57%  876 aa  SYA_HAHCH RecName: Full=Alanyl-tRNA synthetase;       
    1::848       0.0  60%  874 aa  SYA_PSEPF RecName: Full=Alanyl-tRNA synthetase;       
    5::862       0.0  57%  869 aa  SYA_ALHEH RecName: Full=Alanyl-tRNA synthetase;       
    8::874       0.0  56%  875 aa  SYA_SHEPA RecName: Full=Alanyl-tRNA synthetase;       
    6::865       0.0  55%  865 aa  SYA_PSEA6 RecName: Full=Alanyl-tRNA synthetase;       
    1::854       0.0  59%  874 aa  SYA_PSEU5 RecName: Full=Alanyl-tRNA synthetase;       
    1::864       0.0  57%  874 aa  SYA_PSEMY RecName: Full=Alanyl-tRNA synthetase;       
    1::864       0.0  58%  874 aa  SYA_PSEAB RecName: Full=Alanyl-tRNA synthetase;       
    8::873       0.0  56%  873 aa  SYA_SHEAM RecName: Full=Alanyl-tRNA synthetase;       
    4::853       0.0  55%  873 aa  SYA_DICNV RecName: Full=Alanyl-tRNA synthetase;       
    6::875       0.0  54%  876 aa  SYA_COLP3 RecName: Full=Alanyl-tRNA synthetase;       
   18::902       0.0  52%  903 aa  SYA_PSYWF RecName: Full=Alanyl-tRNA synthetase;       
    5::868       0.0  56%  873 aa  SYA_NITOC RecName: Full=Alanyl-tRNA synthetase;       
    1::854       0.0  58%  874 aa  SYA_PSEAE RecName: Full=Alanyl-tRNA synthetase;       
    1::854       0.0  58%  874 aa  SYA_PSEA7 RecName: Full=Alanyl-tRNA synthetase;       
    1::878       0.0  52%  878 aa  SYA_ACIBY RecName: Full=Alanyl-tRNA synthetase;       
    1::878       0.0  52%  878 aa  SYA_ACIBT RecName: Full=Alanyl-tRNA synthetase;       
    1::878       0.0  52%  878 aa  SYA_ACIBC RecName: Full=Alanyl-tRNA synthetase;       
    1::866       0.0  57%  868 aa  SYA_CHRSD RecName: Full=Alanyl-tRNA synthetase;       
    2::863       0.0  51%  865 aa  SYA_FRAP2 RecName: Full=Alanyl-tRNA synthetase;       
    1::875       0.0  51%  878 aa  SYA_ACIAD RecName: Full=Alanyl-tRNA synthetase;       
    1::863       0.0  51%  865 aa  SYA_COXBU RecName: Full=Alanyl-tRNA synthetase;       
    1::863       0.0  51%  865 aa  SYA_COXBN RecName: Full=Alanyl-tRNA synthetase;       
    1::858       0.0  54%  863 aa  SYA_HALHL RecName: Full=Alanyl-tRNA synthetase;       
    1::863       0.0  51%  865 aa  SYA_COXBR RecName: Full=Alanyl-tRNA synthetase;       
    8::886       0.0  54%  890 aa  SYA_PSYCK RecName: Full=Alanyl-tRNA synthetase;       
    1::822       0.0  55%  860 aa  SYA_LEGPL RecName: Full=Alanyl-tRNA synthetase;       
    8::846       0.0  54%  890 aa  SYA_PSYA2 RecName: Full=Alanyl-tRNA synthetase;       
    1::822       0.0  55%  860 aa  SYA_LEGPH RecName: Full=Alanyl-tRNA synthetase;       
    1::822       0.0  55%  860 aa  SYA_LEGPC RecName: Full=Alanyl-tRNA synthetase;       
    1::861       0.0  52%  865 aa  SYA_RUTMC RecName: Full=Alanyl-tRNA synthetase;       
    6::867       0.0  52%  867 aa  SYA_PSYIN RecName: Full=Alanyl-tRNA synthetase;       
    1::822       0.0  55%  860 aa  SYA_LEGPA RecName: Full=Alanyl-tRNA synthetase;       
    1::871       0.0  50%  876 aa  SYA_GEOMG RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  51%  875 aa  SYA_GEOSL RecName: Full=Alanyl-tRNA synthetase;       
    1::868       0.0  49%  876 aa  SYA_GEOUR RecName: Full=Alanyl-tRNA synthetase;       
    3::876       0.0  49%  884 aa  SYA_BAUCH RecName: Full=Alanyl-tRNA synthetase;       
    6::687       0.0  61%  738 aa  SYA_YERPA RecName: Full=Alanyl-tRNA synthetase;       
    1::877       0.0  54%  878 aa  SYA_MAGSM RecName: Full=Alanyl-tRNA synthetase;       
    4::872       0.0  52%  891 aa  SYA_BRASO RecName: Full=Alanyl-tRNA synthetase;       
    6::859       0.0  49%  865 aa  SYA_FRATO RecName: Full=Alanyl-tRNA synthetase;       
    6::859       0.0  49%  865 aa  SYA_FRATH RecName: Full=Alanyl-tRNA synthetase;       
    6::859       0.0  49%  865 aa  SYA_FRATF RecName: Full=Alanyl-tRNA synthetase;       
    6::878       0.0  48%  878 aa  SYA_SYNAS RecName: Full=Alanyl-tRNA synthetase;       
    8::882       0.0  50%  883 aa  SYA_HELMI RecName: Full=Alanyl-tRNA synthetase;       
    4::877       0.0  51%  896 aa  SYA_BRASB RecName: Full=Alanyl-tRNA synthetase;       
    5::878       0.0  50%  878 aa  SYA_SOLUE RecName: Full=Alanyl-tRNA synthetase;       
    4::870       0.0  52%  887 aa  SYA_AGRT5 RecName: Full=Alanyl-tRNA synthetase;       
    4::878       0.0  51%  884 aa  SYA_RHIL3 RecName: Full=Alanyl-tRNA synthetase;       
    1::861       0.0  48%  878 aa  SYA_PELPD RecName: Full=Alanyl-tRNA synthetase;       
    5::871       0.0  48%  879 aa  SYA_DESVV RecName: Full=Alanyl-tRNA synthetase;       
    5::871       0.0  48%  879 aa  SYA_DESVH RecName: Full=Alanyl-tRNA synthetase;       
    1::861       0.0  49%  865 aa  SYA_VESOH RecName: Full=Alanyl-tRNA synthetase;       
    6::859       0.0  48%  865 aa  SYA_FRATW RecName: Full=Alanyl-tRNA synthetase;       
    4::874       0.0  52%  891 aa  SYA_RHOPS RecName: Full=Alanyl-tRNA synthetase;       
    6::859       0.0  48%  865 aa  SYA_FRATT RecName: Full=Alanyl-tRNA synthetase;       
    6::859       0.0  48%  865 aa  SYA_FRAT1 RecName: Full=Alanyl-tRNA synthetase;       
    6::859       0.0  48%  865 aa  SYA_FRATN RecName: Full=Alanyl-tRNA synthetase;       
    6::859       0.0  48%  865 aa  SYA_FRATM RecName: Full=Alanyl-tRNA synthetase;       
    1::876       0.0  48%  882 aa  SYA_PELCD RecName: Full=Alanyl-tRNA synthetase;       
    4::848       0.0  53%  891 aa  SYA_METEP RecName: Full=Alanyl-tRNA synthetase;       
    4::872       0.0  51%  889 aa  SYA_RHOPA RecName: Full=Alanyl-tRNA synthetase;       
    4::874       0.0  51%  883 aa  SYA_SILST RecName: Full=Alanyl-tRNA synthetase;       
    4::878       0.0  50%  884 aa  SYA_RHIEC RecName: Full=Alanyl-tRNA synthetase;       
    1::876       0.0  53%  877 aa  SYA_THIFE RecName: Full=Alanyl-tRNA synthetase;       
    4::870       0.0  52%  887 aa  SYA_RHIME RecName: Full=Alanyl-tRNA synthetase;       
    4::844       0.0  52%  885 aa  SYA_BRUSU RecName: Full=Alanyl-tRNA synthetase;       
    4::844       0.0  52%  885 aa  SYA_BRUSI RecName: Full=Alanyl-tRNA synthetase;       
    4::844       0.0  52%  885 aa  SYA_BRUME RecName: Full=Alanyl-tRNA synthetase;       
    4::844       0.0  52%  885 aa  SYA_BRUC2 RecName: Full=Alanyl-tRNA synthetase;       
    4::844       0.0  52%  885 aa  SYA_BRUAB RecName: Full=Alanyl-tRNA synthetase;       
    4::844       0.0  52%  885 aa  SYA_BRUA2 RecName: Full=Alanyl-tRNA synthetase;       
    4::844       0.0  52%  885 aa  SYA_BRUO2 RecName: Full=Alanyl-tRNA synthetase;       
    4::840       0.0  52%  885 aa  SYA_OCHA4 RecName: Full=Alanyl-tRNA synthetase;       
    4::874       0.0  53%  891 aa  SYA_RHOP2 RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  53%  890 aa  SYA_RHOPB RecName: Full=Alanyl-tRNA synthetase;       
    4::849       0.0  53%  891 aa  SYA_NITHX RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  51%  891 aa  SYA_METPB RecName: Full=Alanyl-tRNA synthetase;       
    4::868       0.0  52%  892 aa  SYA_PARL1 RecName: Full=Alanyl-tRNA synthetase;       
    5::880       0.0  46%  880 aa  SYA_DESDG RecName: Full=Alanyl-tRNA synthetase;       
    4::840       0.0  51%  898 aa  SYA_BEII9 RecName: Full=Alanyl-tRNA synthetase;       
    1::880       0.0  46%  881 aa  SYA_MOOTA RecName: Full=Alanyl-tRNA synthetase;       
    4::870       0.0  51%  887 aa  SYA_SINMW RecName: Full=Alanyl-tRNA synthetase;       
    5::897       0.0  51%  904 aa  SYA_ANADF RecName: Full=Alanyl-tRNA synthetase;       
    4::874       0.0  53%  891 aa  SYA_RHOP5 RecName: Full=Alanyl-tRNA synthetase;       
    4::849       0.0  51%  891 aa  SYA_NITWN RecName: Full=Alanyl-tRNA synthetase;       
    9::902       0.0  48%  905 aa  SYA_ROSS1 RecName: Full=Alanyl-tRNA synthetase;       
    4::879       0.0  49%  887 aa  SYA_BARHE RecName: Full=Alanyl-tRNA synthetase;       
    4::874       0.0  52%  880 aa  SYA_CAUCR RecName: Full=Alanyl-tRNA synthetase;       
    1::880       0.0  47%  882 aa  SYA_DESPS RecName: Full=Alanyl-tRNA synthetase;       
    2::892       0.0  48%  898 aa  SYA_MYXXD RecName: Full=Alanyl-tRNA synthetase;       
    4::868       0.0  51%  888 aa  SYA_RHILO RecName: Full=Alanyl-tRNA synthetase;       
    5::860       0.0  48%  879 aa  SYA_GLUOX RecName: Full=Alanyl-tRNA synthetase;       
    4::885       0.0  50%  892 aa  SYA_BRAJA RecName: Full=Alanyl-tRNA synthetase;       
    7::886       0.0  52%  905 aa  SYA_ANADE RecName: Full=Alanyl-tRNA synthetase;       
    4::864       0.0  44%  876 aa  SYA_SULSY RecName: Full=Alanyl-tRNA synthetase;       
    4::867       0.0  52%  884 aa  SYA_XANP2 RecName: Full=Alanyl-tRNA synthetase;       
    4::885       0.0  47%  888 aa  SYA_BART1 RecName: Full=Alanyl-tRNA synthetase;       
    4::866       0.0  48%  884 aa  SYA_JANSC RecName: Full=Alanyl-tRNA synthetase;       
    5::842       0.0  53%  887 aa  SYA_SPHWW RecName: Full=Alanyl-tRNA synthetase;       
    9::895       0.0  47%  905 aa  SYA_ROSCS RecName: Full=Alanyl-tRNA synthetase;       
    5::824       0.0  48%  880 aa  SYA_SYNWW RecName: Full=Alanyl-tRNA synthetase;       
    4::841       0.0  49%  885 aa  SYA_PARDP RecName: Full=Alanyl-tRNA synthetase;       
    1::901       0.0  47%  907 aa  SYA_BDEBA RecName: Full=Alanyl-tRNA synthetase;       
    4::841       0.0  52%  892 aa  SYA_METRJ RecName: Full=Alanyl-tRNA synthetase;       
    5::854       0.0  51%  878 aa  SYA_MAGSA RecName: Full=Alanyl-tRNA synthetase;       
    5::841       0.0  50%  883 aa  SYA_RHORT RecName: Full=Alanyl-tRNA synthetase;       
    4::875       0.0  51%  881 aa  SYA_HYPNA RecName: Full=Alanyl-tRNA synthetase;       
    1::854       0.0  45%  877 aa  SYA_WOLPM RecName: Full=Alanyl-tRNA synthetase;       
    4::874       0.0  52%  883 aa  SYA_CAUSK RecName: Full=Alanyl-tRNA synthetase;       
    4::881       0.0  46%  888 aa  SYA_BARQU RecName: Full=Alanyl-tRNA synthetase;       
    8::831       0.0  46%  878 aa  SYA_RICM5 RecName: Full=Alanyl-tRNA synthetase;       
    2::870       0.0  44%  884 aa  SYA_LAWIP RecName: Full=Alanyl-tRNA synthetase;       
    5::866       0.0  45%  879 aa  SYA_BLOPB RecName: Full=Alanyl-tRNA synthetase;       
    5::834       0.0  53%  884 aa  SYA_SPHAL RecName: Full=Alanyl-tRNA synthetase;       
    6::889       0.0  45%  889 aa  SYA_PELUB RecName: Full=Alanyl-tRNA synthetase;       
    4::843       0.0  51%  886 aa  SYA_METS4 RecName: Full=Alanyl-tRNA synthetase;       
    4::848       0.0  47%  886 aa  SYA_BARBK RecName: Full=Alanyl-tRNA synthetase;       
    8::831       0.0  45%  878 aa  SYA_RICCK RecName: Full=Alanyl-tRNA synthetase;       
    5::838       0.0  49%  880 aa  SYA_GRABC RecName: Full=Alanyl-tRNA synthetase;       
    6::878       0.0  51%  884 aa  SYA_MARMM RecName: Full=Alanyl-tRNA synthetase;       
    4::848       0.0  47%  886 aa  SYA_BARBA RecName: Full=Alanyl-tRNA synthetase;       
    2::845       0.0  48%  845 aa  SYA_CAMFF RecName: Full=Alanyl-tRNA synthetase;       
    1::870       0.0  47%  872 aa  SYA_SYMTH RecName: Full=Alanyl-tRNA synthetase;       
    8::831       0.0  47%  877 aa  SYA_RICRS RecName: Full=Alanyl-tRNA synthetase;       
    8::831       0.0  47%  877 aa  SYA_RICRO RecName: Full=Alanyl-tRNA synthetase;       
    5::880       0.0  48%  887 aa  SYA_ERYLH RecName: Full=Alanyl-tRNA synthetase;       
    4::740       0.0  53%  887 aa  SYA_MESSB RecName: Full=Alanyl-tRNA synthetase;       
    1::866       0.0  45%  876 aa  SYA_DESOH RecName: Full=Alanyl-tRNA synthetase;       
    4::863       0.0  48%  887 aa  SYA_DINSH RecName: Full=Alanyl-tRNA synthetase;       
    8::831       0.0  46%  878 aa  SYA_RICCN RecName: Full=Alanyl-tRNA synthetase;       
    1::859       0.0  45%  875 aa  SYA_WOLTR RecName: Full=Alanyl-tRNA synthetase;       
    1::874       0.0  45%  885 aa  SYA_SYNFM RecName: Full=Alanyl-tRNA synthetase;       
    8::832       0.0  46%  878 aa  SYA_RICFE RecName: Full=Alanyl-tRNA synthetase;       
    4::835       0.0  47%  883 aa  SYA_RHOS5 RecName: Full=Alanyl-tRNA synthetase;       
    4::844       0.0  49%  890 aa  SYA_SILPO RecName: Full=Alanyl-tRNA synthetase;       
    4::846       0.0  48%  883 aa  SYA_RHOS1 RecName: Full=Alanyl-tRNA synthetase;       
    2::695       0.0  52%  867 aa  SYA_AQUAE RecName: Full=Alanyl-tRNA synthetase;       
    5::874       0.0  44%  875 aa  SYA_DESHY RecName: Full=Alanyl-tRNA synthetase;       
    5::872       0.0  48%  878 aa  SYA_ACICJ RecName: Full=Alanyl-tRNA synthetase;       
    1::888       0.0  45%  888 aa  SYA_CHLPD RecName: Full=Alanyl-tRNA synthetase;       
    4::857       0.0  48%  881 aa  SYA_AZOC5 RecName: Full=Alanyl-tRNA synthetase;       
    8::831       0.0  46%  878 aa  SYA_RICAH RecName: Full=Alanyl-tRNA synthetase;       
    6::877       0.0  44%  878 aa  SYA_DESRM RecName: Full=Alanyl-tRNA synthetase;       
    4::846       0.0  48%  883 aa  SYA_RHOS4 RecName: Full=Alanyl-tRNA synthetase;       
    8::838       0.0  46%  877 aa  SYA_RICBR RecName: Full=Alanyl-tRNA synthetase;       
    4::878       0.0  43%  879 aa  SYA_CLOD6 RecName: Full=Alanyl-tRNA synthetase;       
    6::876       0.0  42%  878 aa  SYA_THETN RecName: Full=Alanyl-tRNA synthetase;       
    4::861       0.0  49%  885 aa  SYA_ROSDO RecName: Full=Alanyl-tRNA synthetase;       
    6::867       0.0  44%  879 aa  SYA1_CLOPH RecName: Full=Alanyl-tRNA synthetase 1;       
    5::870       0.0  48%  890 aa  SYA_ZYMMO RecName: Full=Alanyl-tRNA synthetase;       
    2::835       0.0  49%  850 aa  SYA_NITSB RecName: Full=Alanyl-tRNA synthetase;       
   12::907       0.0  46%  917 aa  SYA_SORC5 RecName: Full=Alanyl-tRNA synthetase;       
    1::865       0.0  43%  877 aa  SYA_PELTS RecName: Full=Alanyl-tRNA synthetase;       
    1::845       0.0  48%  852 aa  SYA_CAMC1 RecName: Full=Alanyl-tRNA synthetase;       
    7::866       0.0  48%  871 aa  SYA_AQUPY RecName: Full=Alanyl-tRNA synthetase;       
    2::850       0.0  48%  857 aa  SYA_SULNB RecName: Full=Alanyl-tRNA synthetase;       
    1::843       0.0  45%  889 aa  SYA_HERA2 RecName: Full=Alanyl-tRNA synthetase;       
    1::849       0.0  46%  852 aa  SYA_CAMC5 RecName: Full=Alanyl-tRNA synthetase;       
    3::873       0.0  43%  876 aa  SYA_STAHJ RecName: Full=Alanyl-tRNA synthetase;       
    6::849       0.0  45%  876 aa  SYA_ANAPZ RecName: Full=Alanyl-tRNA synthetase;       
    2::831       0.0  46%  842 aa  SYA_CAMJJ RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAAW RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAAS RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAAR RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAAN RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAAM RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAA9 RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAA2 RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAA1 RecName: Full=Alanyl-tRNA synthetase;       
    5::874       0.0  43%  877 aa  SYA_STAAT RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAAE RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAAC RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAA8 RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAA3 RecName: Full=Alanyl-tRNA synthetase;       
    2::831       0.0  46%  842 aa  SYA_CAMJ8 RecName: Full=Alanyl-tRNA synthetase;       
    3::875       0.0  44%  876 aa  SYA_STAS1 RecName: Full=Alanyl-tRNA synthetase;       
    2::831       0.0  46%  842 aa  SYA_CAMJR RecName: Full=Alanyl-tRNA synthetase;       
    2::831       0.0  46%  842 aa  SYA_CAMJE RecName: Full=Alanyl-tRNA synthetase;       
   10::877       0.0  44%  883 aa  SYA_SYNJA RecName: Full=Alanyl-tRNA synthetase;       
    3::871       0.0  43%  873 aa  SYA_FINM2 RecName: Full=Alanyl-tRNA synthetase;       
    2::831       0.0  45%  842 aa  SYA_CAMJD RecName: Full=Alanyl-tRNA synthetase;       
    1::867       0.0  42%  878 aa  SYA_NATTJ RecName: Full=Alanyl-tRNA synthetase;       
    4::873       0.0  43%  876 aa  SYA_STAAB RecName: Full=Alanyl-tRNA synthetase;       
    7::874       0.0  44%  879 aa  SYA_LISIN RecName: Full=Alanyl-tRNA synthetase;       
    8::832       0.0  44%  877 aa  SYA_RICTY RecName: Full=Alanyl-tRNA synthetase;       
    7::874       0.0  45%  879 aa  SYA_LISW6 RecName: Full=Alanyl-tRNA synthetase;       
    7::838       0.0  43%  878 aa  SYA_BACLD RecName: Full=Alanyl-tRNA synthetase;       
    5::864       0.0  48%  881 aa  SYA_NOVAD RecName: Full=Alanyl-tRNA synthetase;       
    6::864       0.0  43%  877 aa  SYA_THEPX RecName: Full=Alanyl-tRNA synthetase;       
    6::864       0.0  43%  877 aa  SYA_THEP3 RecName: Full=Alanyl-tRNA synthetase;       
    1::854       0.0  44%  859 aa  SYA_THEM4 RecName: Full=Alanyl-tRNA synthetase;       
    8::832       0.0  44%  877 aa  SYA_RICPR RecName: Full=Alanyl-tRNA synthetase;       
    3::877       0.0  43%  881 aa  SYA_CALS8 RecName: Full=Alanyl-tRNA synthetase;       
    4::862       0.0  44%  863 aa  SYA_THEMA RecName: Full=Alanyl-tRNA synthetase;       
    4::838       0.0  44%  894 aa  SYA_CHLAA RecName: Full=Alanyl-tRNA synthetase;       
    7::874       0.0  42%  879 aa  SYA_OCEIH RecName: Full=Alanyl-tRNA synthetase;       
    7::874       0.0  44%  879 aa  SYA_LISMO RecName: Full=Alanyl-tRNA synthetase;       
    2::843       0.0  48%  855 aa  SYA_WOLSU RecName: Full=Alanyl-tRNA synthetase;       
    2::826       0.0  45%  847 aa  SYA_HELAH RecName: Full=Alanyl-tRNA synthetase;       
    7::876       0.0  42%  878 aa  SYA_BACA2 RecName: Full=Alanyl-tRNA synthetase;       
    7::874       0.0  44%  879 aa  SYA_LISMF RecName: Full=Alanyl-tRNA synthetase;       
    4::872       0.0  42%  881 aa  SYA_CLOAB RecName: Full=Alanyl-tRNA synthetase;       
    6::878       0.0  45%  882 aa  SYA_ANAMM RecName: Full=Alanyl-tRNA synthetase;       
    1::874     e-180  42%  874 aa  SYA_CARHZ RecName: Full=Alanyl-tRNA synthetase;       
    1::844     e-180  44%  858 aa  SYA_THELT RecName: Full=Alanyl-tRNA synthetase;       
    7::879     e-180  42%  881 aa  SYA_PEDPA RecName: Full=Alanyl-tRNA synthetase;       
    4::862     e-180  44%  863 aa  SYA_THESQ RecName: Full=Alanyl-tRNA synthetase;       
    7::876     e-180  42%  878 aa  SYA_BACSU RecName: Full=Alanyl-tRNA synthetase;       
    1::885     e-180  46%  886 aa  SYA_CHLCH RecName: Full=Alanyl-tRNA synthetase;       
    2::809     e-179  48%  849 aa  SYA_SULDN RecName: Full=Alanyl-tRNA synthetase;       
    5::866     e-179  45%  867 aa  SYA_FUSNN RecName: Full=Alanyl-tRNA synthetase;       
    7::874     e-179  42%  876 aa  SYA_BACSK RecName: Full=Alanyl-tRNA synthetase;       
    5::880     e-179  47%  892 aa  SYA_HELHP RecName: Full=Alanyl-tRNA synthetase;       
    4::862     e-178  43%  863 aa  SYA_THEP1 RecName: Full=Alanyl-tRNA synthetase;       
    2::845     e-178  45%  845 aa  SYA_CAMHC RecName: Full=Alanyl-tRNA synthetase;       
    6::835     e-178  43%  880 aa  SYA_CLOTH RecName: Full=Alanyl-tRNA synthetase;       
    1::873     e-178  45%  885 aa  SYA_CHLTE RecName: Full=Alanyl-tRNA synthetase;       
    4::873     e-177  43%  876 aa  SYA_STAES RecName: Full=Alanyl-tRNA synthetase;       
    4::873     e-177  43%  876 aa  SYA_STAEQ RecName: Full=Alanyl-tRNA synthetase;       
    2::839     e-177  46%  851 aa  SYA_ARCB4 RecName: Full=Alanyl-tRNA synthetase;       
    7::877     e-177  42%  880 aa  SYA_BACAN RecName: Full=Alanyl-tRNA synthetase;       
    6::867     e-177  42%  871 aa  SYA_DEHE1 RecName: Full=Alanyl-tRNA synthetase;       
    1::840     e-176  46%  885 aa  SYA_PROVI RecName: Full=Alanyl-tRNA synthetase;       
    7::876     e-176  44%  878 aa  SYA_GEOTN RecName: Full=Alanyl-tRNA synthetase;       
    7::877     e-176  42%  880 aa  SYA_BACC1 RecName: Full=Alanyl-tRNA synthetase;       
    7::877     e-176  42%  880 aa  SYA_BACAH RecName: Full=Alanyl-tRNA synthetase;       
    7::879     e-176  44%  880 aa  SYA_LACS1 RecName: Full=Alanyl-tRNA synthetase;       
    7::877     e-176  42%  880 aa  SYA_BACCR RecName: Full=Alanyl-tRNA synthetase;       
    7::877     e-176  42%  880 aa  SYA_BACCZ RecName: Full=Alanyl-tRNA synthetase;       
    7::877     e-175  42%  880 aa  SYA_BACHK RecName: Full=Alanyl-tRNA synthetase;       
    7::877     e-175  42%  879 aa  SYA_BACHD RecName: Full=Alanyl-tRNA synthetase;       
    7::885     e-175  43%  887 aa  SYA_GEOKA RecName: Full=Alanyl-tRNA synthetase;       
    7::877     e-175  42%  880 aa  SYA_BACWK RecName: Full=Alanyl-tRNA synthetase;       
    7::876     e-175  41%  878 aa  SYA_BACP2 RecName: Full=Alanyl-tRNA synthetase;       
    2::699     e-174  46%  848 aa  SYA_NEOSM RecName: Full=Alanyl-tRNA synthetase;       
    2::826     e-174  44%  847 aa  SYA_HELPH RecName: Full=Alanyl-tRNA synthetase;       
    7::878     e-174  43%  880 aa  SYA_ENTFA RecName: Full=Alanyl-tRNA synthetase;       
    8::860     e-174  41%  891 aa  SYA_BLOFL RecName: Full=Alanyl-tRNA synthetase;       
   10::878     e-173  42%  880 aa  SYA_EXIS2 RecName: Full=Alanyl-tRNA synthetase;       
    7::865     e-173  41%  887 aa  SYA_EHRCJ RecName: Full=Alanyl-tRNA synthetase;       
    1::867     e-173  43%  871 aa  SYA_BACV8 RecName: Full=Alanyl-tRNA synthetase;       
    9::822     e-173  43%  874 aa  SYA_TRIEI RecName: Full=Alanyl-tRNA synthetase;       
   14::869     e-173  42%  886 aa  SYA_PROMS RecName: Full=Alanyl-tRNA synthetase;       
   14::869     e-173  42%  886 aa  SYA_PROM0 RecName: Full=Alanyl-tRNA synthetase;       
    6::867     e-173  40%  871 aa  SYA_DEHSC RecName: Full=Alanyl-tRNA synthetase;       
    6::865     e-173  42%  876 aa  SYA_PORGI RecName: Full=Alanyl-tRNA synthetase;       
    1::886     e-173  44%  887 aa  SYA_FLAPJ RecName: Full=Alanyl-tRNA synthetase;       
   14::869     e-173  42%  886 aa  SYA_PROM9 RecName: Full=Alanyl-tRNA synthetase;       
    2::873     e-173  43%  873 aa  SYA_PARD8 RecName: Full=Alanyl-tRNA synthetase;       
    6::867     e-173  40%  871 aa  SYA_DEHSB RecName: Full=Alanyl-tRNA synthetase;       
    6::835     e-173  43%  880 aa  SYA_ALKOO RecName: Full=Alanyl-tRNA synthetase;       
    2::826     e-173  43%  847 aa  SYA_HELPJ RecName: Full=Alanyl-tRNA synthetase;       
    1::875     e-172  41%  878 aa  SYA_PARUW RecName: Full=Alanyl-tRNA synthetase;       
    6::709     e-172  45%  883 aa  SYA_BUCAP RecName: Full=Alanyl-tRNA synthetase;       
    7::876     e-172  42%  879 aa  SYA_LACBA RecName: Full=Alanyl-tRNA synthetase;       
   12::876     e-172  45%  877 aa  SYA_SYNY3 RecName: Full=Alanyl-tRNA synthetase;       
    4::867     e-172  40%  879 aa  SYA_CLOB8 RecName: Full=Alanyl-tRNA synthetase;       
    7::877     e-172  42%  880 aa  SYA_BACCN RecName: Full=Alanyl-tRNA synthetase;       
   10::881     e-172  45%  884 aa  SYA_SYNJB RecName: Full=Alanyl-tRNA synthetase;       
   11::872     e-171  39%  879 aa  SYA_CYAA5 RecName: Full=Alanyl-tRNA synthetase;       
    1::841     e-171  45%  887 aa  SYA_PELLD RecName: Full=Alanyl-tRNA synthetase;       
    8::857     e-171  41%  876 aa  SYA_PETMO RecName: Full=Alanyl-tRNA synthetase;       
    7::878     e-169  42%  878 aa  SYA_LACSS RecName: Full=Alanyl-tRNA synthetase;       
   14::869     e-169  41%  886 aa  SYA_PROMP RecName: Full=Alanyl-tRNA synthetase;       
   14::869     e-168  41%  886 aa  SYA_PROM2 RecName: Full=Alanyl-tRNA synthetase;       
    5::828     e-168  41%  880 aa  SYA_ANAVT RecName: Full=Alanyl-tRNA synthetase;       
   10::385     e-168  77%  948 aa  SYA_ACIAC RecName: Full=Alanyl-tRNA synthetase;       
    1::874     e-168  38%  875 aa  SYA_CHLMU RecName: Full=Alanyl-tRNA synthetase;       
    5::865     e-167  40%  877 aa  SYA_SYNP2 RecName: Full=Alanyl-tRNA synthetase;       
   22::895     e-167  46%  966 aa  SYA_SALRD RecName: Full=Alanyl-tRNA synthetase;       
    4::865     e-167  41%  887 aa  SYA_EHRCR RecName: Full=Alanyl-tRNA synthetase;       
    9::869     e-167  45%  882 aa  SYA_THEEB RecName: Full=Alanyl-tRNA synthetase;       
    8::875     e-167  39%  878 aa  SYA_BUCAI RecName: Full=Alanyl-tRNA synthetase;       
    2::868     e-167  42%  872 aa  SYA_BACTN RecName: Full=Alanyl-tRNA synthetase;       
   10::866     e-167  43%  871 aa  SYA_GLOVI RecName: Full=Alanyl-tRNA synthetase;       
    2::868     e-167  42%  872 aa  SYA_BACFR RecName: Full=Alanyl-tRNA synthetase;       
    2::868     e-167  42%  872 aa  SYA_BACFN RecName: Full=Alanyl-tRNA synthetase;       
    4::878     e-166  41%  879 aa  SYA_CLOBK RecName: Full=Alanyl-tRNA synthetase;       
    7::871     e-166  41%  891 aa  SYA_ORITB RecName: Full=Alanyl-tRNA synthetase;       
    4::878     e-166  41%  879 aa  SYA_CLOBL RecName: Full=Alanyl-tRNA synthetase;       
    1::871     e-166  39%  872 aa  SYA_CHLPN RecName: Full=Alanyl-tRNA synthetase;       
    6::925     e-166  44%  940 aa  SYA_LEPBL RecName: Full=Alanyl-tRNA synthetase;       
    6::925     e-166  44%  940 aa  SYA_LEPBJ RecName: Full=Alanyl-tRNA synthetase;       
    4::845     e-166  44%  867 aa  SYA_FERNB RecName: Full=Alanyl-tRNA synthetase;       
    3::878     e-166  39%  879 aa  SYA_CLOTE RecName: Full=Alanyl-tRNA synthetase;       
    1::824     e-166  41%  880 aa  SYA_DESAP RecName: Full=Alanyl-tRNA synthetase;       
    2::807     e-166  44%  847 aa  SYA_HELPS RecName: Full=Alanyl-tRNA synthetase;       
    4::880     e-166  42%  881 aa  SYA_LACC3 RecName: Full=Alanyl-tRNA synthetase;       
    1::879     e-165  42%  890 aa  SYA_SACEN RecName: Full=Alanyl-tRNA synthetase;       
    7::878     e-165  41%  880 aa  SYA_LACPL RecName: Full=Alanyl-tRNA synthetase;       
    4::835     e-165  40%  879 aa  SYA_CLONN RecName: Full=Alanyl-tRNA synthetase;       
    2::690     e-165  47%  847 aa  SYA_HELPY RecName: Full=Alanyl-tRNA synthetase;       
    4::862     e-164  39%  887 aa  SYA_EHRRG RecName: Full=Alanyl-tRNA synthetase;       
    1::874     e-164  39%  875 aa  SYA_CHLTR RecName: Full=Alanyl-tRNA synthetase;       
    1::874     e-164  39%  875 aa  SYA_CHLTA RecName: Full=Alanyl-tRNA synthetase;       
    7::880     e-164  41%  882 aa  SYA_LACGA RecName: Full=Alanyl-tRNA synthetase;       
    1::874     e-164  38%  875 aa  SYA_CHLTB RecName: Full=Alanyl-tRNA synthetase;       
    1::874     e-164  38%  875 aa  SYA_CHLT2 RecName: Full=Alanyl-tRNA synthetase;       
    4::838     e-164  41%  880 aa  SYA_ALKMQ RecName: Full=Alanyl-tRNA synthetase;       
    1::851     e-164  44%  890 aa  SYA_STRCO RecName: Full=Alanyl-tRNA synthetase;       
    5::878     e-164  40%  879 aa  SYA_CLOBB RecName: Full=Alanyl-tRNA synthetase;       
    4::862     e-164  39%  887 aa  SYA_EHRRW RecName: Full=Alanyl-tRNA synthetase;       
    1::874     e-164  39%  875 aa  SYA_CHLCV RecName: Full=Alanyl-tRNA synthetase;       
    7::881     e-163  39%  885 aa  SYA_OENOB RecName: Full=Alanyl-tRNA synthetase;       
    4::824     e-163  41%  879 aa  SYA_CLOPE RecName: Full=Alanyl-tRNA synthetase;       
    4::824     e-163  41%  879 aa  SYA_CLOP1 RecName: Full=Alanyl-tRNA synthetase;       
   11::874     e-163  42%  876 aa  SYA_SYNE7 RecName: Full=Alanyl-tRNA synthetase;       
    4::824     e-163  40%  879 aa  SYA_CLOPS RecName: Full=Alanyl-tRNA synthetase;       
    1::846     e-163  44%  879 aa  SYA_FLAJ1 RecName: Full=Alanyl-tRNA synthetase;       
   11::874     e-163  42%  876 aa  SYA_SYNP6 RecName: Full=Alanyl-tRNA synthetase;       
    6::838     e-162  41%  879 aa  SYA_CLOK5 RecName: Full=Alanyl-tRNA synthetase;       
    7::890     e-162  40%  894 aa  SYA_LEUCK RecName: Full=Alanyl-tRNA synthetase;       
    1::886     e-162  41%  890 aa  SYA_STRAW RecName: Full=Alanyl-tRNA synthetase;       
   18::864     e-162  45%  892 aa  SYA_PROM3 RecName: Full=Alanyl-tRNA synthetase;       
    1::888     e-162  40%  888 aa  SYA_CORDI RecName: Full=Alanyl-tRNA synthetase;       
    7::880     e-162  41%  882 aa  SYA_LACJO RecName: Full=Alanyl-tRNA synthetase;       
    5::828     e-161  40%  880 aa  SYA_ANASP RecName: Full=Alanyl-tRNA synthetase;       
    1::874     e-161  38%  875 aa  SYA_CHLFF RecName: Full=Alanyl-tRNA synthetase;       
    6::875     e-161  39%  877 aa  SYA_UNCTG RecName: Full=Alanyl-tRNA synthetase;       
    5::869     e-161  40%  889 aa  SYA_ORITI RecName: Full=Alanyl-tRNA synthetase;       
    1::863     e-160  41%  871 aa  SYA_GRAFK RecName: Full=Alanyl-tRNA synthetase;       
   11::878     e-160  40%  890 aa  SYA_PROM4 RecName: Full=Alanyl-tRNA synthetase;       
    5::878     e-160  40%  879 aa  SYA_CLOBA RecName: Full=Alanyl-tRNA synthetase;       
    1::867     e-160  41%  877 aa  SYA_CYTH3 RecName: Full=Alanyl-tRNA synthetase;       
   18::864     e-159  44%  892 aa  SYA_PROMM RecName: Full=Alanyl-tRNA synthetase;       
   19::843     e-159  46%  889 aa  SYA_SYNPX RecName: Full=Alanyl-tRNA synthetase;       
    1::874     e-159  38%  875 aa  SYA_CHLAB RecName: Full=Alanyl-tRNA synthetase;       
    8::829     e-159  41%  873 aa  SYA_ACAM1 RecName: Full=Alanyl-tRNA synthetase;       
    5::868     e-158  38%  880 aa  SYA_NOSP7 RecName: Full=Alanyl-tRNA synthetase;       
    4::878     e-157  40%  879 aa  SYA_CLOBH RecName: Full=Alanyl-tRNA synthetase;       
    4::878     e-157  40%  879 aa  SYA_CLOB1 RecName: Full=Alanyl-tRNA synthetase;       
   19::751     e-157  47%  893 aa  SYA_SYNS3 RecName: Full=Alanyl-tRNA synthetase;       
    3::893     e-157  40%  893 aa  SYA_LEUMM RecName: Full=Alanyl-tRNA synthetase;       
    4::878     e-157  40%  879 aa  SYA_CLOBM RecName: Full=Alanyl-tRNA synthetase;       
    1::883     e-155  40%  890 aa  SYA_COREF RecName: Full=Alanyl-tRNA synthetase;       
    7::870     e-154  40%  872 aa  SYA_STRT2 RecName: Full=Alanyl-tRNA synthetase;       
    7::870     e-154  40%  872 aa  SYA_STRT1 RecName: Full=Alanyl-tRNA synthetase;       
    7::870     e-153  40%  872 aa  SYA_STRTD RecName: Full=Alanyl-tRNA synthetase;       
    6::907     e-153  43%  919 aa  SYA_LEPBP RecName: Full=Alanyl-tRNA synthetase;       
    6::907     e-153  43%  919 aa  SYA_LEPBA RecName: Full=Alanyl-tRNA synthetase;       
    3::854     e-153  38%  874 aa  SYA_MICAN RecName: Full=Alanyl-tRNA synthetase;       
    7::870     e-152  41%  872 aa  SYA_STRMU RecName: Full=Alanyl-tRNA synthetase;       
    4::869     e-152  40%  872 aa  SYA_LACLA RecName: Full=Alanyl-tRNA synthetase;       
   18::806     e-152  46%  891 aa  SYA_SYNPW RecName: Full=Alanyl-tRNA synthetase;       
   12::739     e-152  45%  882 aa  SYA_SYNR3 RecName: Full=Alanyl-tRNA synthetase;       
    7::870     e-152  40%  872 aa  SYA_STRA1 RecName: Full=Alanyl-tRNA synthetase;       
    6::964     e-152  43%  977 aa  SYA_LEPIN RecName: Full=Alanyl-tRNA synthetase;       
    1::842     e-151  42%  889 aa  SYA_THEFY RecName: Full=Alanyl-tRNA synthetase;       
    7::870     e-151  40%  872 aa  SYA_STRA5 RecName: Full=Alanyl-tRNA synthetase;       
    7::872     e-151  41%  872 aa  SYA_STRPG RecName: Full=Alanyl-tRNA synthetase;       
    7::870     e-151  40%  872 aa  SYA_STRA3 RecName: Full=Alanyl-tRNA synthetase;       
   18::859     e-151  43%  890 aa  SYA_SYNS9 RecName: Full=Alanyl-tRNA synthetase;       
    6::964     e-151  43%  977 aa  SYA_LEPIC RecName: Full=Alanyl-tRNA synthetase;       
    5::874     e-151  44%  885 aa  SYA_DEIGD RecName: Full=Alanyl-tRNA synthetase;       
    7::872     e-151  41%  872 aa  SYA_STRPM RecName: Full=Alanyl-tRNA synthetase;       
    4::869     e-151  39%  872 aa  SYA_LACLS RecName: Full=Alanyl-tRNA synthetase;       
    7::872     e-151  41%  872 aa  SYA_STRPC RecName: Full=Alanyl-tRNA synthetase;       
    7::872     e-151  41%  872 aa  SYA_STRPB RecName: Full=Alanyl-tRNA synthetase;       
    7::872     e-151  41%  872 aa  SYA_STRP3 RecName: Full=Alanyl-tRNA synthetase;       
    7::872     e-151  41%  872 aa  SYA_STRP1 RecName: Full=Alanyl-tRNA synthetase;       
    7::872     e-151  41%  872 aa  SYA_STRPF RecName: Full=Alanyl-tRNA synthetase;       
    7::872     e-151  41%  872 aa  SYA_STRPD RecName: Full=Alanyl-tRNA synthetase;       
    3::850     e-150  40%  873 aa  SYA_WIGBR RecName: Full=Alanyl-tRNA synthetase;       
    7::872     e-150  41%  872 aa  SYA_STRP6 RecName: Full=Alanyl-tRNA synthetase;       
   18::842     e-150  39%  886 aa  SYA_PROMT RecName: Full=Alanyl-tRNA synthetase;       
    4::869     e-150  39%  872 aa  SYA_LACLM RecName: Full=Alanyl-tRNA synthetase;       
    3::870     e-150  40%  872 aa  SYA_STRSY RecName: Full=Alanyl-tRNA synthetase;       
    7::872     e-150  41%  872 aa  SYA_STRP8 RecName: Full=Alanyl-tRNA synthetase;       
    7::868     e-149  41%  872 aa  SYA_STRPI RecName: Full=Alanyl-tRNA synthetase;       
    7::868     e-148  40%  872 aa  SYA_STRPS RecName: Full=Alanyl-tRNA synthetase;       
    1::887     e-148  39%  890 aa  SYA_RHOSR RecName: Full=Alanyl-tRNA synthetase;       
   18::842     e-148  39%  886 aa  SYA_PROM1 RecName: Full=Alanyl-tRNA synthetase;       
    1::895     e-148  41%  900 aa  SYA_MYCPA RecName: Full=Alanyl-tRNA synthetase;       
    1::895     e-148  41%  900 aa  SYA_MYCA1 RecName: Full=Alanyl-tRNA synthetase;       
    6::709     e-148  42%  880 aa  SYA_BUCBP RecName: Full=Alanyl-tRNA synthetase;       
    7::868     e-148  40%  872 aa  SYA_STRPN RecName: Full=Alanyl-tRNA synthetase;       
    1::878     e-148  40%  898 aa  SYA_MYCGI RecName: Full=Alanyl-tRNA synthetase;       
    7::868     e-147  40%  872 aa  SYA_STRR6 RecName: Full=Alanyl-tRNA synthetase;       
    7::868     e-147  40%  872 aa  SYA_STRP2 RecName: Full=Alanyl-tRNA synthetase;       
    1::879     e-147  40%  888 aa  SYA_NOCFA RecName: Full=Alanyl-tRNA synthetase;       
    1::878     e-147  40%  898 aa  SYA_MYCVP RecName: Full=Alanyl-tRNA synthetase;       
    1::926     e-147  41%  937 aa  SYA_OPITP RecName: Full=Alanyl-tRNA synthetase;       
    7::877     e-147  39%  879 aa  SYA_LACAC RecName: Full=Alanyl-tRNA synthetase;       
   14::869     e-147  38%  886 aa  SYA_PROM5 RecName: Full=Alanyl-tRNA synthetase;       
    4::868     e-146  40%  872 aa  SYA_STRGC RecName: Full=Alanyl-tRNA synthetase;       
    1::893     e-146  41%  904 aa  SYA_MYCTU RecName: Full=Alanyl-tRNA synthetase;       
    1::893     e-146  41%  904 aa  SYA_MYCTA RecName: Full=Alanyl-tRNA synthetase;       
    1::869     e-146  42%  881 aa  SYA_FRASC RecName: Full=Alanyl-tRNA synthetase;       
   19::843     e-146  44%  889 aa  SYA_SYNSC RecName: Full=Alanyl-tRNA synthetase;       
    1::893     e-146  41%  904 aa  SYA_MYCBP RecName: Full=Alanyl-tRNA synthetase;       
    1::893     e-146  41%  904 aa  SYA_MYCBO RecName: Full=Alanyl-tRNA synthetase;       
    1::713     e-146  44%  886 aa  SYA_ACIC1 RecName: Full=Alanyl-tRNA synthetase;       
    5::875     e-146  41%  890 aa  SYA_DEIRA RecName: Full=Alanyl-tRNA synthetase;       
    1::877     e-146  41%  897 aa  SYA_MYCSS RecName: Full=Alanyl-tRNA synthetase;       
    1::877     e-146  41%  897 aa  SYA_MYCSK RecName: Full=Alanyl-tRNA synthetase;       
    1::877     e-146  41%  897 aa  SYA_MYCSJ RecName: Full=Alanyl-tRNA synthetase;       
    1::869     e-146  41%  881 aa  SYA_FRAAA RecName: Full=Alanyl-tRNA synthetase;       
   22::732     e-146  44%  842 aa  SYA_LYSSC RecName: Full=Alanyl-tRNA synthetase;       
    1::887     e-145  39%  888 aa  SYA_CORGB RecName: Full=Alanyl-tRNA synthetase;       
    1::887     e-145  39%  888 aa  SYA_CORGL RecName: Full=Alanyl-tRNA synthetase;       
    7::877     e-145  39%  879 aa  SYA_LACH4 RecName: Full=Alanyl-tRNA synthetase;       
    1::863     e-145  40%  887 aa  SYA_CORJK RecName: Full=Alanyl-tRNA synthetase;       
    1::863     e-144  40%  892 aa  SYA_SALAI RecName: Full=Alanyl-tRNA synthetase;       
    1::886     e-144  40%  889 aa  SYA_STRGG RecName: Full=Alanyl-tRNA synthetase;       
   12::756     e-144  44%  958 aa  SYAC_YEAST RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;      
    4::870     e-144  41%  872 aa  SYA_STRSV RecName: Full=Alanyl-tRNA synthetase;       
    2::895     e-143  40%  926 aa  SYA_METI4 RecName: Full=Alanyl-tRNA synthetase;       
    1::851     e-143  37%  868 aa  SYA_ELUMP RecName: Full=Alanyl-tRNA synthetase;       
    1::863     e-143  40%  892 aa  SYA_SALTO RecName: Full=Alanyl-tRNA synthetase;       
    1::863     e-142  41%  888 aa  SYA_CORU7 RecName: Full=Alanyl-tRNA synthetase;       
    1::897     e-142  40%  908 aa  SYA_MYCLE RecName: Full=Alanyl-tRNA synthetase;       
   19::880     e-141  39%  892 aa  SYA_PROMA RecName: Full=Alanyl-tRNA synthetase;       
    1::876     e-141  39%  880 aa  SYA_FRASN RecName: Full=Alanyl-tRNA synthetase;       
   64::838     e-140  42% 1003 aa  SYA_ARATH RecName: Full=Alanyl-tRNA synthetase, mitochondrial;     
    1::833     e-140  40%  885 aa  SYA_CLAM3 RecName: Full=Alanyl-tRNA synthetase;       
    1::833     e-139  39%  885 aa  SYA_CLAMS RecName: Full=Alanyl-tRNA synthetase;       
    1::884     e-139  43%  901 aa  SYA_MYCMM RecName: Full=Alanyl-tRNA synthetase;       
    3::817     e-138  40%  830 aa  SYA_STRS2 RecName: Full=Alanyl-tRNA synthetase;       
    1::876     e-138  39%  896 aa  SYA_MYCS2 RecName: Full=Alanyl-tRNA synthetase;       
    1::834     e-138  42%  885 aa  SYA_LEIXX RecName: Full=Alanyl-tRNA synthetase;       
    1::884     e-138  43%  901 aa  SYA_MYCUA RecName: Full=Alanyl-tRNA synthetase;       
    1::889     e-138  40%  893 aa  SYA_KINRD RecName: Full=Alanyl-tRNA synthetase;       
    1::891     e-138  38%  892 aa  SYA_PROAC RecName: Full=Alanyl-tRNA synthetase;       
    5::721     e-138  43%  895 aa  SYA_KOCRD RecName: Full=Alanyl-tRNA synthetase;       
    1::721     e-138  43%  892 aa  SYA_ARTS2 RecName: Full=Alanyl-tRNA synthetase;       
    1::804     e-137  41%  896 aa  SYA_NOCSJ RecName: Full=Alanyl-tRNA synthetase;       
    7::840     e-136  38%  877 aa  SYA_LACDB RecName: Full=Alanyl-tRNA synthetase;       
    7::840     e-136  38%  877 aa  SYA_LACDA RecName: Full=Alanyl-tRNA synthetase;       
    3::834     e-136  41%  882 aa  SYA_RUBXD RecName: Full=Alanyl-tRNA synthetase;       
   23::963     e-136  41%  968 aa  SYAC_MESAU RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;      
    1::789     e-135  40%  892 aa  SYA_ARTAT RecName: Full=Alanyl-tRNA synthetase;       
    9::957     e-135  38%  959 aa  SYAC_SCHPO RecName: Full=Probable alanyl-tRNA synthetase,
    2::737     e-134  45%  942 aa  SYA_AKKM8 RecName: Full=Alanyl-tRNA synthetase;       
    1::828     e-134  40%  896 aa  SYA_RENSM RecName: Full=Alanyl-tRNA synthetase;       
    1::722     e-134  45%  882 aa  SYA_THET8 RecName: Full=Alanyl-tRNA synthetase;       
    1::722     e-134  45%  882 aa  SYA_THET2 RecName: Full=Alanyl-tRNA synthetase;       
    5::963     e-133  40%  968 aa  SYAC_HUMAN RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;      
    9::760     e-133  44%  968 aa  SYAC_RAT RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;        
    5::963     e-132  40%  968 aa  SYAC_PONAB RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;      
    4::966     e-132  37%  967 aa  SYAC_BOMMO RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;      
   23::760     e-132  45%  968 aa  SYAC_MOUSE RecName: Full=Alanyl-tRNA synthetase, cytoplasmic;      
    1::836     e-132  39%  851 aa  SYA_ACHLI RecName: Full=Alanyl-tRNA synthetase;       
    1::851     e-129  38%  893 aa  SYA_BIFLO RecName: Full=Alanyl-tRNA synthetase;       
    1::850     e-129  38%  892 aa  SYA_BIFAA RecName: Full=Alanyl-tRNA synthetase;       
    1::877     e-129  36%  880 aa  SYA_TROWT RecName: Full=Alanyl-tRNA synthetase;       
    1::877     e-129  36%  880 aa  SYA_TROW8 RecName: Full=Alanyl-tRNA synthetase;       
    4::889     e-128  39%  892 aa  SYA_MESFL RecName: Full=Alanyl-tRNA synthetase;       
    4::890     e-126  36%  896 aa  SYA_MYCMS RecName: Full=Alanyl-tRNA synthetase;       
    1::944     e-123  39%  945 aa  SYA_RHOBA RecName: Full=Alanyl-tRNA synthetase;       
    4::710     e-123  39%  896 aa  SYA_MYCCT RecName: Full=Alanyl-tRNA synthetase;       
    4::903     e-123  37%  906 aa  SYA_UREPA RecName: Full=Alanyl-tRNA synthetase;       
    4::903     e-123  37%  906 aa  SYA_UREP2 RecName: Full=Alanyl-tRNA synthetase;       
    1::747     e-122  42%  946 aa  SYA_DICDI RecName: Full=Alanyl-tRNA synthetase;       
    5::682     e-115  39%  864 aa  SYA_ONYPE RecName: Full=Alanyl-tRNA synthetase;       
    5::682     e-114  39%  864 aa  SYA_AYWBP RecName: Full=Alanyl-tRNA synthetase;       
    7::859     e-112  37%  880 aa  SYA_MYCAP RecName: Full=Alanyl-tRNA synthetase;       
   15::412     e-111  58% 1098 aa  SYA_ACIBL RecName: Full=Alanyl-tRNA synthetase;       
    1::713     e-106  35%  881 aa  SYA_BUCCC RecName: Full=Alanyl-tRNA synthetase;       
    4::701     e-104  36%  883 aa  SYA_MYCH7 RecName: Full=Alanyl-tRNA synthetase;       
    4::701     e-104  36%  883 aa  SYA_MYCH2 RecName: Full=Alanyl-tRNA synthetase;       
   46::786     e-104  38%  985 aa  SYAM_HUMAN RecName: Full=Probable alanyl-tRNA synthetase,
    4::701     e-104  36%  883 aa  SYA_MYCHJ RecName: Full=Alanyl-tRNA synthetase;       
    8::894     e-103  32%  902 aa  SYA_MYCGA RecName: Full=Alanyl-tRNA synthetase;       
   37::781     e-102  38%  980 aa  SYAM_MOUSE RecName: Full=Probable alanyl-tRNA synthetase,
    5::735     8e-98  36%  930 aa  SYA_MYCPE RecName: Full=Alanyl-tRNA synthetase;       
    1::707     2e-96  35%  878 aa  SYA_MYCS5 RecName: Full=Alanyl-tRNA synthetase;       
    2::683     5e-94  34%  900 aa  SYA_MYCGE RecName: Full=Alanyl-tRNA synthetase;       
    8::709     2e-91  33%  900 aa  SYA_MYCPN RecName: Full=Alanyl-tRNA synthetase;       
    6::868     4e-91  35%  873 aa  SYA_MYCPU RecName: Full=Alanyl-tRNA synthetase;       
    4::597     4e-87  44%  600 aa  SYA_TREDE RecName: Full=Alanyl-tRNA synthetase;       
    1::720     5e-84  35%  905 aa  SYA_MYCMO RecName: Full=Alanyl-tRNA synthetase;       
    5::597     4e-76  42%  605 aa  SYA_TREPA RecName: Full=Alanyl-tRNA synthetase;       
    1::593     1e-75  40%  594 aa  SYA_BORAP RecName: Full=Alanyl-tRNA synthetase;       
    1::593     5e-75  41%  594 aa  SYA_BORGA RecName: Full=Alanyl-tRNA synthetase;       
    1::593     1e-71  40%  593 aa  SYA_BORHD RecName: Full=Alanyl-tRNA synthetase;       
    1::591     9e-70  37%  591 aa  SYA2_CLOPH RecName: Full=Alanyl-tRNA synthetase 2;       
    4::200     1e-69  68%  201 aa  SYA_RHILV RecName: Full=Alanyl-tRNA synthetase;       
    1::593     3e-67  39%  594 aa  SYA_BORBU RecName: Full=Alanyl-tRNA synthetase;       
   61::896     3e-64  31%  907 aa  SYA_THEPD RecName: Full=Alanyl-tRNA synthetase;       
   60::918     6e-61  30%  925 aa  SYA_METAC RecName: Full=Alanyl-tRNA synthetase;       
   60::918     8e-61  33%  926 aa  SYA_METMA RecName: Full=Alanyl-tRNA synthetase;       
   60::918     3e-57  32%  923 aa  SYA_METBF RecName: Full=Alanyl-tRNA synthetase;       
   55::871     1e-56  30%  892 aa  SYA_METJA RecName: Full=Alanyl-tRNA synthetase;       
  118::873     7e-54  30%  892 aa  SYA_PYRAR RecName: Full=Alanyl-tRNA synthetase;       
   55::860     1e-52  28%  897 aa  SYA_METS3 RecName: Full=Alanyl-tRNA synthetase;       
   50::871     1e-52  30%  901 aa  SYA_IGNH4 RecName: Full=Alanyl-tRNA synthetase;       
   55::781     2e-52  30%  900 aa  SYA_SULIM RecName: Full=Alanyl-tRNA synthetase;       
   55::781     2e-52  30%  900 aa  SYA_SULIK RecName: Full=Alanyl-tRNA synthetase;       
   55::781     5e-52  30%  900 aa  SYA_SULSO RecName: Full=Alanyl-tRNA synthetase;       
   55::748     5e-52  32%  899 aa  SYA_CALMQ RecName: Full=Alanyl-tRNA synthetase;       
   62::872     7e-51  30%  892 aa  SYA_METMP RecName: Full=Alanyl-tRNA synthetase;       
   58::856     1e-50  29%  898 aa  SYA_METTH RecName: Full=Alanyl-tRNA synthetase;       
   62::734     3e-50  32%  892 aa  SYA_METM6 RecName: Full=Alanyl-tRNA synthetase;       
   62::745     3e-50  31%  892 aa  SYA_METM5 RecName: Full=Alanyl-tRNA synthetase;       
   59::910     3e-50  28%  913 aa  SYA_METLZ RecName: Full=Alanyl-tRNA synthetase;       
   67::745     6e-50  32%  892 aa  SYA_METM7 RecName: Full=Alanyl-tRNA synthetase;       
  122::899     5e-49  29%  903 aa  SYA_METST RecName: Full=Alanyl-tRNA synthetase;       
   55::781     9e-49  29%  900 aa  SYA_SULIA RecName: Full=Alanyl-tRNA synthetase;       
   57::888     1e-48  32%  926 aa  SYA_HALLT RecName: Full=Alanyl-tRNA synthetase;       
   55::781     1e-47  29%  900 aa  SYA_SULIY RecName: Full=Alanyl-tRNA synthetase;       
   55::781     1e-47  29%  900 aa  SYA_SULIN RecName: Full=Alanyl-tRNA synthetase;       
   55::781     1e-47  29%  900 aa  SYA_SULIL RecName: Full=Alanyl-tRNA synthetase;       
   64::749     1e-47  30%  896 aa  SYA_PYRCJ RecName: Full=Alanyl-tRNA synthetase;       
   61::881     2e-47  27%  906 aa  SYA_ARCFU RecName: Full=Alanyl-tRNA synthetase;       
   62::885     3e-47  30%  923 aa  SYA_HALWD RecName: Full=Alanyl-tRNA synthetase;       
   58::875     5e-47  28%  913 aa  SYA_METTP RecName: Full=Alanyl-tRNA synthetase;       
   61::763     6e-47  32%  927 aa  SYA_HALMA RecName: Full=Alanyl-tRNA synthetase;       
  118::873     2e-46  30%  892 aa  SYA_PYRIL RecName: Full=Alanyl-tRNA synthetase;       
  118::747     3e-46  31%  892 aa  SYA_PYRAE RecName: Full=Alanyl-tRNA synthetase;       
  118::747     1e-45  32%  892 aa  SYA_THENV RecName: Full=Alanyl-tRNA synthetase;       
   58::187     2e-45  30%  923 aa  SYA_METBU RecName: Full=Alanyl-tRNA synthetase;       
   52::724     3e-45  30%  895 aa  SYA_KORCO RecName: Full=Alanyl-tRNA synthetase;       
   62::745     2e-44  30%  892 aa  SYA_METVS RecName: Full=Alanyl-tRNA synthetase;       
   55::755     9e-44  30%  907 aa  SYA_SULAC RecName: Full=Alanyl-tRNA synthetase;       
   62::897     1e-43  28%  910 aa  SYA_META3 RecName: Full=Alanyl-tRNA synthetase;       
   44::856     2e-42  27%  900 aa  SYA_AERPE RecName: Full=Alanyl-tRNA synthetase;       
   61::747     6e-42  30%  904 aa  SYA_SULTO RecName: Full=Alanyl-tRNA synthetase;       
   59::912     6e-42  26%  916 aa  SYA_METHJ RecName: Full=Alanyl-tRNA synthetase;       
   62::788     2e-41  28%  932 aa  SYA_NATPD RecName: Full=Alanyl-tRNA synthetase;       
   62::784     3e-41  28%  929 aa  SYA_HALSA RecName: Full=Alanyl-tRNA synthetase;       
   62::784     3e-41  28%  929 aa  SYA_HALS3 RecName: Full=Alanyl-tRNA synthetase;       
   54::912     4e-40  26%  917 aa  SYA_PYRKO RecName: Full=Alanyl-tRNA synthetase;       
   56::868     6e-40  27%  914 aa  SYA_METB6 RecName: Full=Alanyl-tRNA synthetase;       
  129::747     7e-40  28%  915 aa  SYA_METKA RecName: Full=Alanyl-tRNA synthetase;       
   55::886     2e-39  27%  921 aa  SYA_HYPBU RecName: Full=Alanyl-tRNA synthetase;       
   80::731     6e-39  30%  894 aa  SYA_CENSY RecName: Full=Alanyl-tRNA synthetase;       
   59::866     4e-38  27%  904 aa  SYA_METS5 RecName: Full=Alanyl-tRNA synthetase;       
   54::894     6e-37  26%  915 aa  SYA_PYRHO RecName: Full=Alanyl-tRNA synthetase;       
   62::898     1e-36  25%  909 aa  SYA_STAMF RecName: Full=Alanyl-tRNA synthetase;       
   54::755     2e-36  27%  914 aa  SYA_PYRAB RecName: Full=Alanyl-tRNA synthetase;       
   54::759     1e-35  27%  914 aa  SYA_PYRFU RecName: Full=Alanyl-tRNA synthetase;       
   57::736     9e-35  29%  876 aa  SYA_THEVO RecName: Full=Alanyl-tRNA synthetase;       
   55::179     2e-32  28%  915 aa  SYA_METMJ RecName: Full=Alanyl-tRNA synthetase;       
   83::742     2e-32  31%  875 aa  SYA_UNCMA RecName: Full=Alanyl-tRNA synthetase;       
   57::736     6e-29  29%  871 aa  SYA_THEAC RecName: Full=Alanyl-tRNA synthetase;       
   57::183     2e-28  29%  870 aa  SYA_PICTO RecName: Full=Alanyl-tRNA synthetase;       
   81::420     3e-25  35%  889 aa  SYA_NITMS RecName: Full=Alanyl-tRNA synthetase;       
   73::202     2e-11  32%  635 aa  SYT_BURS3 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     6e-11  32%  635 aa  SYT_BURCJ RecName: Full=Threonyl-tRNA synthetase;       
   73::202     6e-11  32%  635 aa  SYT_BURCC RecName: Full=Threonyl-tRNA synthetase;       
   73::202     7e-11  32%  635 aa  SYT_BURCM RecName: Full=Threonyl-tRNA synthetase;       
   73::202     7e-11  32%  635 aa  SYT_BURA4 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     1e-10  32%  635 aa  SYT_BURVG RecName: Full=Threonyl-tRNA synthetase;       
   73::202     6e-10  32%  635 aa  SYT_BURPP RecName: Full=Threonyl-tRNA synthetase;       
   73::202     8e-10  32%  635 aa  SYT_BURPS RecName: Full=Threonyl-tRNA synthetase;       
   73::202     8e-10  32%  635 aa  SYT_BURP6 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     8e-10  32%  635 aa  SYT_BURP1 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     8e-10  32%  635 aa  SYT_BURP0 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     8e-10  32%  635 aa  SYT_BURMS RecName: Full=Threonyl-tRNA synthetase;       
   73::202     8e-10  32%  635 aa  SYT_BURMA RecName: Full=Threonyl-tRNA synthetase;       
   73::202     8e-10  32%  635 aa  SYT_BURM9 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     8e-10  32%  635 aa  SYT_BURM7 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     1e-09  31%  635 aa  SYT_BURP8 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-09  31%  635 aa  SYT_POLSJ RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-09  31%  635 aa  SYT_BURXL RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-09  32%  635 aa  SYT_BURTA RecName: Full=Threonyl-tRNA synthetase;       
   73::202     4e-09  32%  635 aa  SYT_POLNA RecName: Full=Threonyl-tRNA synthetase;       
   73::202     5e-09  32%  640 aa  SYT_POLSQ RecName: Full=Threonyl-tRNA synthetase;       
   73::202     9e-09  32%  639 aa  SYT_DIAST RecName: Full=Threonyl-tRNA synthetase;       
   73::202     9e-09  32%  639 aa  SYT_ACISJ RecName: Full=Threonyl-tRNA synthetase;       
   73::202     1e-08  32%  635 aa  SYT_JANMA RecName: Full=Threonyl-tRNA synthetase;       
   77::206     1e-08  31%  643 aa  SYT_DELAS RecName: Full=Threonyl-tRNA synthetase;       
   74::203     2e-08  32%  648 aa  SYT_MAGSM RecName: Full=Threonyl-tRNA synthetase;       
   73::202     3e-08  31%  640 aa  SYT_POLNS RecName: Full=Threonyl-tRNA synthetase;       
   73::202     3e-08  32%  635 aa  SYT_HERAR RecName: Full=Threonyl-tRNA synthetase;       
   73::202     3e-08  30%  635 aa  SYT_BURM1 RecName: Full=Threonyl-tRNA synthetase;       
   77::206     4e-08  32%  637 aa  SYT_LEPCP RecName: Full=Threonyl-tRNA synthetase;       
   73::202     6e-08  31%  635 aa  SYT_METFK RecName: Full=Threonyl-tRNA synthetase;       
   75::205     8e-08  34%  668 aa  SYT_RHILW RecName: Full=Threonyl-tRNA synthetase;       
   75::205     1e-07  34%  668 aa  SYT_RHIEC RecName: Full=Threonyl-tRNA synthetase;       
   75::205     1e-07  34%  668 aa  SYT_RHIE6 RecName: Full=Threonyl-tRNA synthetase;       
   75::205     1e-07  35%  660 aa  SYT_SINMW RecName: Full=Threonyl-tRNA synthetase;       
   73::202     1e-07  33%  647 aa  SYT_DESMR RecName: Full=Threonyl-tRNA synthetase;       
   73::202     1e-07  31%  638 aa  SYT_AZOSB RecName: Full=Threonyl-tRNA synthetase;       
   73::203     2e-07  34%  642 aa  SYT_GRABC RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-07  31%  638 aa  SYT_AZOSE RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-07  32%  637 aa  SYT_TERTT RecName: Full=Threonyl-tRNA synthetase;       
   71::199     2e-07  31%  642 aa  SYT_DESAD RecName: Full=Threonyl-tRNA synthetase;       
   76::206     3e-07  35%  661 aa  SYT_RHIME RecName: Full=Threonyl-tRNA synthetase;       
   73::202     4e-07  28%  639 aa  SYT_VEREI RecName: Full=Threonyl-tRNA synthetase;       
   73::202     4e-07  29%  641 aa  SYT_MARAV RecName: Full=Threonyl-tRNA synthetase;       
   75::205     5e-07  35%  661 aa  SYT_RHISN RecName: Full=Threonyl-tRNA synthetase;       
   75::203     5e-07  31%  636 aa  SYT_PELPD RecName: Full=Threonyl-tRNA synthetase;       
   73::202     6e-07  31%  635 aa  SYT_RALPJ RecName: Full=Threonyl-tRNA synthetase;       
   73::202     6e-07  30%  635 aa  SYT_METPP RecName: Full=Threonyl-tRNA synthetase;       
   43::226     6e-07  28%  412 aa  AASD1_RAT RecName: Full=Alanyl-tRNA synthetase domain-containing
   43::226     6e-07  28%  412 aa  AASD1_MOUSE RecName: Full=Alanyl-tRNA synthetase domain-containing
   73::203     8e-07  33%  643 aa  SYT_RHORT RecName: Full=Threonyl-tRNA synthetase;       
   72::201     8e-07  28%  640 aa  SYT_LISW6 RecName: Full=Threonyl-tRNA synthetase;       
   72::201     8e-07  28%  640 aa  SYT_LISMO RecName: Full=Threonyl-tRNA synthetase;       
   72::201     8e-07  28%  640 aa  SYT_LISMH RecName: Full=Threonyl-tRNA synthetase;       
   72::201     8e-07  28%  640 aa  SYT_LISMF RecName: Full=Threonyl-tRNA synthetase;       
   72::201     8e-07  28%  640 aa  SYT_LISMC RecName: Full=Threonyl-tRNA synthetase;       
   72::201     8e-07  28%  640 aa  SYT_LISIN RecName: Full=Threonyl-tRNA synthetase;       
   42::282     8e-07  23%  412 aa  AASDB_XENLA RecName: Full=Alanyl-tRNA synthetase domain-containing
   42::282     8e-07  23%  412 aa  AASDA_XENLA RecName: Full=Alanyl-tRNA synthetase domain-containing
   73::202     1e-06  34%  635 aa  SYT_RALEH RecName: Full=Threonyl-tRNA synthetase;       
   73::202     1e-06  29%  638 aa  SYT_METCA RecName: Full=Threonyl-tRNA synthetase;       
   75::205     1e-06  33%  667 aa  SYT_AGRT5 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     1e-06  28%  636 aa  SYT_SACD2 RecName: Full=Threonyl-tRNA synthetase;       
   76::206     1e-06  34%  658 aa  SYT_RHILO RecName: Full=Threonyl-tRNA synthetase;       
   75::205     1e-06  35%  661 aa  SYT_RHIL3 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     1e-06  30%  637 aa  SYT_HAHCH RecName: Full=Threonyl-tRNA synthetase;       
   43::226     1e-06  27%  412 aa  AASD1_HUMAN RecName: Full=Alanyl-tRNA synthetase domain-containing
   73::202     2e-06  31%  635 aa  SYT_RALSO RecName: Full=Threonyl-tRNA synthetase;       
   73::203     2e-06  32%  645 aa  SYT_GLUOX RecName: Full=Threonyl-tRNA synthetase;       
   75::205     2e-06  34%  662 aa  SYT_AGRRK RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-06  33%  644 aa  SYT_ACIF5 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-06  33%  644 aa  SYT_ACIF2 RecName: Full=Threonyl-tRNA synthetase;       
   73::203     2e-06  30%  651 aa  SYT_RHOCS RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-06  30%  633 aa  SYT_LARHH RecName: Full=Threonyl-tRNA synthetase;       
   73::201     2e-06  32%  644 aa  SYT_DESDG RecName: Full=Threonyl-tRNA synthetase;       
   73::203     2e-06  32%  640 aa  SYT_ACICJ RecName: Full=Threonyl-tRNA synthetase;       
   73::202     3e-06  30%  638 aa  SYT_NITMU RecName: Full=Threonyl-tRNA synthetase;       
   75::203     3e-06  30%  636 aa  SYT_GEOSL RecName: Full=Threonyl-tRNA synthetase;       
   73::202     3e-06  29%  633 aa  SYT_CHRVO RecName: Full=Threonyl-tRNA synthetase;       
   78::207     3e-06  30%  650 aa  SYT_BORPD RecName: Full=Threonyl-tRNA synthetase;       
   42::250     3e-06  24%  412 aa  AASD1_DANRE RecName: Full=Alanyl-tRNA synthetase domain-containing
   19::145     4e-06  30%  582 aa  SYT_DEHSC RecName: Full=Threonyl-tRNA synthetase;       
   19::145     4e-06  30%  582 aa  SYT_DEHSB RecName: Full=Threonyl-tRNA synthetase;       
   19::145     4e-06  30%  582 aa  SYT_DEHE1 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     4e-06  30%  638 aa  SYT_DECAR RecName: Full=Threonyl-tRNA synthetase;       
   73::202     4e-06  30%  651 aa  SYT_COXBU RecName: Full=Threonyl-tRNA synthetase;       
   43::226     4e-06  27%  444 aa  AASD1_BOVIN RecName: Full=Alanyl-tRNA synthetase domain-containing
   73::202     5e-06  33%  635 aa  SYT_RALEJ RecName: Full=Threonyl-tRNA synthetase;       
   73::202     5e-06  31%  635 aa  SYT_CUPTR RecName: Full=Threonyl-tRNA synthetase;       
   73::202     7e-06  28%  641 aa  SYT_ALHEH RecName: Full=Threonyl-tRNA synthetase;       
   73::202     9e-06  31%  647 aa  SYT_STRR6 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     9e-06  31%  647 aa  SYT_STRP2 RecName: Full=Threonyl-tRNA synthetase;       
   73::201     9e-06  28%  634 aa  SYT_FRATN RecName: Full=Threonyl-tRNA synthetase;       
   61::182     1e-05  27%  660 aa  SYT_THEVO RecName: Full=Threonyl-tRNA synthetase;       
   73::203     1e-05  29%  638 aa  SYT_PELUB RecName: Full=Threonyl-tRNA synthetase;       
   73::202     1e-05  30%  635 aa  SYT_NITEC RecName: Full=Threonyl-tRNA synthetase;       
   73::201     1e-05  32%  644 aa  SYT_DESVM RecName: Full=Threonyl-tRNA synthetase;       
   76::205     2e-05  27%  651 aa  SYT_SYMTH RecName: Full=Threonyl-tRNA synthetase;       
   76::206     2e-05  34%  656 aa  SYT_MESSB RecName: Full=Threonyl-tRNA synthetase;       
   77::208     2e-05  33%  650 aa  SYT_ANASK RecName: Full=Threonyl-tRNA synthetase;       
   77::208     2e-05  33%  650 aa  SYT_ANADE RecName: Full=Threonyl-tRNA synthetase;       
   77::208     2e-05  33%  650 aa  SYT_ANAD2 RecName: Full=Threonyl-tRNA synthetase;       
   24::153     2e-05  32%  592 aa  SYT_TREPS RecName: Full=Threonyl-tRNA synthetase;       
   24::153     2e-05  32%  592 aa  SYT_TREPA RecName: Full=Threonyl-tRNA synthetase;       
   73::201     2e-05  27%  634 aa  SYT_FRATO RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-05  31%  635 aa  SYT_FRAP2 RecName: Full=Threonyl-tRNA synthetase;       
   78::207     2e-05  28%  649 aa  SYT_BORPE RecName: Full=Threonyl-tRNA synthetase;       
   78::207     2e-05  28%  649 aa  SYT_BORPA RecName: Full=Threonyl-tRNA synthetase;       
   78::207     2e-05  28%  649 aa  SYT_BORBR RecName: Full=Threonyl-tRNA synthetase;       
   73::202     3e-05  28%  643 aa  SYT_THISH RecName: Full=Threonyl-tRNA synthetase;       
   73::201     3e-05  27%  634 aa  SYT_FRATW RecName: Full=Threonyl-tRNA synthetase;       
   73::201     3e-05  27%  634 aa  SYT_FRATM RecName: Full=Threonyl-tRNA synthetase;       
   73::201     3e-05  27%  634 aa  SYT_FRATH RecName: Full=Threonyl-tRNA synthetase;       
   73::201     3e-05  27%  634 aa  SYT_FRATF RecName: Full=Threonyl-tRNA synthetase;       
   54::184     3e-05  27%  620 aa  SYT_FUSNN RecName: Full=Threonyl-tRNA synthetase;       
   73::201     3e-05  27%  634 aa  SYT_FRATT RecName: Full=Threonyl-tRNA synthetase;       
   73::201     3e-05  27%  634 aa  SYT_FRAT1 RecName: Full=Threonyl-tRNA synthetase;       
   78::207     3e-05  31%  650 aa  SYT_BORA1 RecName: Full=Threonyl-tRNA synthetase;       
   73::204     5e-05  28%  657 aa  SYT_HYPNA RecName: Full=Threonyl-tRNA synthetase;       
   75::203     5e-05  35%  636 aa  SYT_GEOBB RecName: Full=Threonyl-tRNA synthetase;       
   75::203     6e-05  35%  636 aa  SYT_GEOSM RecName: Full=Threonyl-tRNA synthetase;       
   79::211     8e-05  27%  656 aa  SYT_BDEBA RecName: Full=Threonyl-tRNA synthetase;       
   75::205     8e-05  31%  666 aa  SYT_AGRVS RecName: Full=Threonyl-tRNA synthetase;       
   71::200     1e-04  29%  633 aa  SYT_WOLWR RecName: Full=Threonyl-tRNA synthetase;       
   73::204     1e-04  29%  637 aa  SYT_THIDA RecName: Full=Threonyl-tRNA synthetase;       
   75::205     1e-04  31%  638 aa  SYT_PELCD RecName: Full=Threonyl-tRNA synthetase;       
   74::202     1e-04  28%  645 aa  SYT_ENTFA RecName: Full=Threonyl-tRNA synthetase;       
   76::206     1e-04  31%  658 aa  SYT_BRUSU RecName: Full=Threonyl-tRNA synthetase;       
   76::206     1e-04  31%  658 aa  SYT_BRUSI RecName: Full=Threonyl-tRNA synthetase;       
   76::206     1e-04  31%  658 aa  SYT_BRUME RecName: Full=Threonyl-tRNA synthetase;       
   76::206     1e-04  31%  658 aa  SYT_BRUMB RecName: Full=Threonyl-tRNA synthetase;       
   76::206     1e-04  31%  658 aa  SYT_BRUC2 RecName: Full=Threonyl-tRNA synthetase;       
   76::206     1e-04  31%  658 aa  SYT_BRUAB RecName: Full=Threonyl-tRNA synthetase;       
   76::206     1e-04  31%  658 aa  SYT_BRUA2 RecName: Full=Threonyl-tRNA synthetase;       
   76::206     1e-04  31%  658 aa  SYT_BRUA1 RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAAW RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAAT RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAAS RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAAR RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAAN RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAAM RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAAE RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAAC RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAAB RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAA9 RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAA3 RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAA2 RecName: Full=Threonyl-tRNA synthetase;       
   75::202     1e-04  26%  645 aa  SYT_STAA1 RecName: Full=Threonyl-tRNA synthetase;       
   73::203     1e-04  29%  641 aa  SYT_GLUDA RecName: Full=Threonyl-tRNA synthetase;       
   73::201     1e-04  31%  644 aa  SYT_DESVV RecName: Full=Threonyl-tRNA synthetase;       
   73::201     1e-04  31%  644 aa  SYT_DESVH RecName: Full=Threonyl-tRNA synthetase;       
   73::202     1e-04  30%  635 aa  SYT_DESRM RecName: Full=Threonyl-tRNA synthetase;       
   75::205     2e-04  30%  658 aa  SYT_RHOPA RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  27%  637 aa  SYT_LEGPC RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  30%  647 aa  SYT_STRZT RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  30%  647 aa  SYT_STRZP RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  30%  647 aa  SYT_STRZJ RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  30%  647 aa  SYT_STRPN RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  30%  647 aa  SYT_STRPJ RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  30%  647 aa  SYT_STRPI RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  30%  647 aa  SYT_STRP7 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  30%  647 aa  SYT_STRP4 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  30%  649 aa  SYT_STRMU RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  30%  647 aa  SYT_STRGC RecName: Full=Threonyl-tRNA synthetase;       
   73::202     2e-04  26%  637 aa  SYT_LEGPA RecName: Full=Threonyl-tRNA synthetase;       
   73::202     3e-04  30%  648 aa  SYT_STRTD RecName: Full=Threonyl-tRNA synthetase;       
   73::202     3e-04  30%  648 aa  SYT_STRT2 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     3e-04  30%  648 aa  SYT_STRT1 RecName: Full=Threonyl-tRNA synthetase;       
   75::202     3e-04  28%  647 aa  SYT_STACT RecName: Full=Threonyl-tRNA synthetase;       
   73::199     3e-04  27%  639 aa  SYT_RUBXD RecName: Full=Threonyl-tRNA synthetase;       
   73::202     3e-04  27%  637 aa  SYT_LEGPH RecName: Full=Threonyl-tRNA synthetase;       
   75::202     4e-04  25%  645 aa  SYT_STAS1 RecName: Full=Threonyl-tRNA synthetase;       
   75::202     4e-04  25%  645 aa  SYT_STAA8 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     4e-04  32%  635 aa  SYT_NITEU RecName: Full=Threonyl-tRNA synthetase;       
   73::202     4e-04  29%  640 aa  SYT_HALHL RecName: Full=Threonyl-tRNA synthetase;       
   68::199     5e-04  28%  638 aa  SYT_THELT RecName: Full=Threonyl-tRNA synthetase;       
   73::203     5e-04  28%  644 aa  SYT_MARMM RecName: Full=Threonyl-tRNA synthetase;       
   73::202     5e-04  25%  637 aa  SYT_LEGPL RecName: Full=Threonyl-tRNA synthetase;       
   76::205     5e-04  29%  652 aa  SYT_GEOKA RecName: Full=Threonyl-tRNA synthetase;       
   71::210     5e-04  31%  677 aa  SYT_BIFLI RecName: Full=Threonyl-tRNA synthetase;       
   71::200     7e-04  26%  640 aa  SYT_THENN RecName: Full=Threonyl-tRNA synthetase;       
   73::202     7e-04  30%  647 aa  SYT_STRSV RecName: Full=Threonyl-tRNA synthetase;       
   73::200     7e-04  24%  647 aa  SYT_STRA5 RecName: Full=Threonyl-tRNA synthetase;       
   73::200     7e-04  24%  647 aa  SYT_STRA1 RecName: Full=Threonyl-tRNA synthetase;       
   74::206     7e-04  26%  638 aa  SYT_LEPIN RecName: Full=Threonyl-tRNA synthetase;       
   74::206     7e-04  26%  638 aa  SYT_LEPIC RecName: Full=Threonyl-tRNA synthetase;       
   76::206     7e-04  28%  658 aa  SYT_BARBK RecName: Full=Threonyl-tRNA synthetase;       
   72::200     7e-04  29%  642 aa  SYT_ACHLI RecName: Full=Threonyl-tRNA synthetase;       
   76::205     7e-04  26%  643 aa  SYT1_BACSU RecName: Full=Threonyl-tRNA synthetase 1;       
   95::171     7e-04  38%  544 aa  CH601_CHLAA RecName: Full=60 kDa chaperonin 1;AltName: Full=Protein
   73::200     9e-04  23%  647 aa  SYT_STRA3 RecName: Full=Threonyl-tRNA synthetase;       
   73::202     9e-04  24%  639 aa  SYT_ACIAC RecName: Full=Threonyl-tRNA synthetase;       
    1::884

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xPRRRLRPHNMKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYVRA
SYA_RALME       ----------MKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYVRA
SYA_RALEJ       ----------MKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYSRA
SYA_RALEH       ----------MKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYTRA
SYA_BURPP       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA
SYA_BURXL       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA
SYA_BURP8       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAESRPYSRA
SYA_BURM1       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDRRPYTRA
SYA_BURVG       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDQRPYTRA
SYA_BURCC       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA
SYA_RALSO       ----------MKASDIRQKFLTFFETKGHTVVRSSPLVPGNDPTLLFTNSGMVQFKDVFLGTDKRPYVRA
SYA_BURCH       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA
SYA_BURS3       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA
SYA_BURCA       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA
SYA_BURCM       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA
SYA_BURA4       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDPRPYSRA
SYA_BURPS       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA
SYA_BURP6       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA
SYA_BURP1       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA
SYA_BURP0       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA
SYA_BURMS       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA
SYA_BURM9       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA
SYA_BURM7       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA
SYA_BURMA       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA
SYA_BURTA       ----------MKAAEIREKFLKFFESKGHTIVRSSSLVPGNDPTLLFTNSGMVQFKDVFLGAETRPYSRA
SYA_AZOSE       ----------MKSAEIREKFLKFFESKGHQIVASSSLVPHDDPTLLFTNAGMNQFKDVFLGFDKRPYSRA
SYA_BORA1       ----------MKSSEIRQKFLQFFQSKGHSIVPSSSLVPGNDPTLLFTNSGMVQFKDVFTGKEKRPYTRA
SYA_JANMA       ----------MNSSEIREKFLKFFESKGHTIVASSPLVPGNDPTLMFTNSGMVQFKDVFLGEDKRPYTRA
SYA_METFK       ----------MKSNQIRQAFLDYFASKGHQIVSSSSLVPAGDPTLLFTNAGMNQFKDVFLGFDKRPYTRA
SYA_HERAR       ----------MKSSEIREKFLKFFESKGHTIVASSPLVPGNDPTLMFTNSGMVQFKDVFLGEDKRPYVRA
SYA_THIDA       ----------MKSSAIRQSFLDFFASKGHTVVPSSSLVPGNDPTLLFTNAGMVQFKDVFTGQDTRPYSRA
SYA_METPP       ----------MKASEIRSAFLKFFESKGHQIVASSPVVPGDDPTLLFTNAGMNQFKDVFLGFDKRPYSRA
SYA_RHOFD       ------------VADIRKIFLDFFASKGHTVVPSSPLVPGNDPTLMFTNSGMVQFKDVFLGTDKRSYVRA
SYA_DECAR       ----------MKSSEIRQQFLDFFASKGHQIVSSSSLVPHEDPTLLFTNAGMNQFKDVFLGFDKRPYSRA
SYA_DELAS       ------------VADIRKSFLDFFASKGHTIVESSPLVPGNDPTLMFTNSGMVQFKDVFLGTDKRPYKRA
SYA_POLNA       ------------VADIRKTFLDFFAAKGHTVVPSSSLVPGNDPTLMFTNSGMVQFKDVFLGVDKRPYVRA
SYA_POLSQ       ----------MKVTQIRQAYLDFFAQKGHQIXXXXXXXXGDDPTLLFTNAGMNQFKDVFLGFDKRSYTRA
SYA_BORBR       ----------MKSSEIRQKFLQFFQSKGHTIVPSSSLVPANDPTLLFTNSGMVQFKDVFTGKEARAYKRA
SYA_BORPA       ----------MKSSEIRQKFLQFFQSKGHTIVPSSSLVPANDPTLLFTNSGMVQFKDVFTGKEARAYKRA
SYA_BORPE       ----------MKSSEIRQKFLQFFQSKGHTIVPSSSLVPANDPTLLFTNSGMVQFKDVFTGKEARAYKRA
SYA_AZOSB       ----------MKSAEIRAKFLKFFESKGHQIVASSSLVPHEDPTLLFTNAGMNQFKDVFLGFDKRPYSRA
SYA_BORPD       ----------MKSSEIRQKFLQFFQSKGHTIVPSASLVPGNDPTLLFTNSGMVQFKDVFTGKETRSYTRA
SYA_POLSJ       ------------VADIRKSFLDFFASKGHTVVPSSSLVPGNDPTLMFTNSGMVQFKDVFLGTDKRSYVRA
SYA_ACISJ       ------------VADIRKTFLDFFAAKGHTVVASSPLVPGNDPTLMFTNSGMVQFKDVFLGTDKRPYVRA
SYA_LEPCP       ----------MKASEIRSTFLKFFESKGHQIVGSSPVVPGDDPTLLFTNAGMNQFKDVFLGFDKRPYSRA
SYA_NITMU       ----------MKSSEVRQKFLEFFETHGHTIVPSSPLVPGNDPTLLFTNAGMVQFKDVFLGQDKRPYVRA
SYA_NITEU       ----------MKSSEIRQKFLEFFEARGHVIVPSSPLVPGNDPTLLFTNAGMVQFKDVFLGQDKRPYVRA
SYA_NITEC       ----------MKSSEIRQKFLDFFETHGHVVVPSSPLVPGNDPTLLFTNAGMVQFKDVFLGQDKRPYVRA
SYA_CHRVO       ----------MKTSEIRKKFLDFFASKGHQVVPSSSLIPGNDPTLMFTVAGMVQFKDVFLGFEKRDYTRA
SYA_VEREI       ---------SISVADIRKSFLDFFVAKGHTIVASSPLVPGNDPTLMFTNSGMVQFKDVFLGTDKRPYSRA
SYA_STRMK       -------------SQIRSDFLEFFKGKGHTIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEKRSYVRA
SYA_NEIMF       ----------MKTSELRQKFLKFFETKGHTVVRSSSLVPHDDPTLLFTNAGMNQFKDVFLGFDKRPYSRA
SYA_NEIMA       ----------MKTSELRQKFLKFFETKGHTVVRSSSLVPHDDPTLLFTNAGMNQFKDVFLGFDKRPYSRA
SYA_NEIMB       ----------MKTSELRQKFLKFFETKGHTVVRSSSLVPHDDPTLLFTNAGMNQFKDVFLGFDKRPYSRA
SYA_SACD2       ----------MKSAEIREAFLQYFESKGHSRVASSSLVPGNDPTLLFTNAGMVQFKDVFLGQDNRSYSRA
SYA_NEIM0       ----------MKTSELRQKFLKFFETKGHTVVRSSSLVPHDDPTLLFTNAGMNQFKDVFLGFDKRPYSRA
SYA_NEIG1       ----------MKTSELRQKFLKFFETKGHTVVRSSSLVPHDDPTLLFTNAGMNQFKDVFLGFDKRPYSRA
SYA_XANAC       -------PAKFSTSQIRSDFLAFFEGKGHTIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEKRSYVRA
SYA_MARMS       ----------MKSSELRQSFLSYFESKQHQIVESSSLVPGNDPTLLFTNAGMVQFKDVFLGEDIRPYSRA
SYA_KLEP7       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_VIBF1       ----------MSTDEIRRAFLAFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDCFLGSEKRNYTRA
SYA_ERWCT       -------------AEIRQAFLDFFHSKGHQVVDSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRSYVRA
SYA_CITK8       -------------AEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SODGM       -------------AEIRQAFLDFFHSKGHQVVASSSLVPDNDPTLLFTNAGMNQFKDVFLGLDNRFYRRA
SYA_SHEFN       -------------AELRSAFLKYFEDNGHQVVDSSSLVPTNDPTLLFTNAGMNQFKDVFLGMDKRNYTRA
SYA_HAEIG       -------------AEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSRA
SYA_HAEIE       -------------AEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSRA
SYA_HAEI8       -------------AEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSRA
SYA_MARAV       ----------MKTAELRQAFLEYFQQQGHAIVPSSSLVPHDDPTLLFTNAGMNQFKDLFLGREERDYTRA
SYA_ECOUT       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_ECOK1       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_ECOSM       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SHISS       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SHIBS       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_ECOL5       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_ECOHS       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_ECO24       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SHIFL       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SHIF8       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SHIB3       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SHIDS       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SALTY       -------------AEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_ECO57       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SALTI       -------------AEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_ECOLI       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_ECOLC       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_ECODH       -------------AEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SALCH       -------------AEIRQAFLDFFHSKGHQVVSSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SALPA       -------------AEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SALPB       -------------AEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_ENT38       -------------AEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_THICR       ----------MTSAELRKAFLDFFVKQGHTAVHSSPVVPGNDPTLLFTNAGMVQFKETFLGQETREYKRA
SYA_HAEIN       -------------AEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSRA
SYA_ENTS8       -------------AEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_SERP5       -------------AEIRQAFLDFFHSKGHQVVASSSLVPDNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA
SYA_VIBVU       ----------MSTDEVRNAFLKFFESKGHQIVDSSSLVPHNDPTLLFTNAGMNQFKDCFLGAEKRAYTRA
SYA_SHEWM       ---------------LRSAFLEYFRTNGHQVVDSSSLVPVNDPTLLFTNAGMNQFKDVFLGEDKRSYTRA
SYA_VIBVY       ----------MSTDEVRNAFLKFFESKGHQIVDSSSLVPHNDPTLLFTNAGMNQFKDCFLGAEKRAYTRA
SYA_SHESH       ---------------LRSAFLEYFRTNGHQVVDSSSLVPVNDPTLLFTNAGMNQFKDVFLGEDKRSYTRA
SYA_METCA       ----------MTSAELRARFLKFFADRGHTVVASSSLVPVNDPTLLFTNAGMVQFKDVFLGREHRPYVRA
SYA_VIBHB       ----------MSTDEVRNAFLKFFESKGHQIVESSSLVPHNDPTLLFTNAGMNQFKDCFLGLEKRAYTRA
SYA_VIBPA       ----------MSTDEVRNAFLKFFESKGHQIVESSSLVPHNDPTLLFTNAGMNQFKDCFLGLEKRAYTRA
SYA_SALAR       -------------AEIRQAFLDFFHSKGHQVVASSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRNYSRA
SYA_ACTSZ       -------------AEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSRA
SYA_SHESM       ---------------LRSAFLEFFRSNGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDVFLGMDKRSYTRA
SYA_VIBC3       ----------MSTDEVRRAFLSFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA
SYA_YERPY       -------------AEIRQAFLDFFHSKGHQVVSSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA
SYA_YERPS       -------------AEIRQAFLDFFHSKGHQVVSSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA
SYA_YERPB       -------------AEIRQAFLDFFHSKGHQVVSSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA
SYA_PHOLL       -------------AEIRQAFLDFFHTKGHQVVPSSSLVPNNDPTLLFTNAGMNQFKDVFLGQDKRSYSRA
SYA_VIBCH       ----------MSTDEVRRAFLSFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA
SYA_SHEB9       -------------AELRSAFLEFFRSNGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDVFLGMDKRNYTRA
SYA_SHEB5       -------------AELRSAFLEFFRSNGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDVFLGMDKRNYTRA
SYA_YERPP       -------------AEIRQAFLDFFHSKGHQVVSSSTLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA
SYA_YERPN       -------------AEIRQAFLDFFHSKGHQVVSSSTLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA
SYA_YERPG       -------------AEIRQAFLDFFHSKGHQVVSSSTLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA
SYA_YERPE       -------------AEIRQAFLDFFHSKGHQVVSSSTLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA
SYA_SHEB8       -------------AELRSAFLEFFRSNGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDVFLGMDKRNYTRA
SYA_YERP3       -------------AEIRQAFLDFFHSKGHQVVSSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA
SYA_HAES2       -------------AEIRQAFLDFFHSKGHQIVDSSSLVPENDPTLLFTNAGMNQFKDVFLGLDTRSYTRA
SYA_HAES1       -------------AEIRQAFLDFFHSKGHQIVDSSSLVPENDPTLLFTNAGMNQFKDVFLGLDTRSYTRA
SYA_PSEP1       ----------MKSAEIREAFLRFFEEQGHTRVASSSLIPNNDPTLLFTNAGMNQFKDCFLGAEKRAYTRA
SYA_PSEPK       ----------MKSAEIREAFLRFFEEQGHTRVASSSLIPNNDPTLLFTNAGMNQFKDCFLGAEKRAYTRA
SYA_PSEPW       ----------MKSAEIREAFLRFFEEQGHTRVASSSLIPNNDPTLLFTNAGMNQFKDCFLGAEKRAYTRA
SYA_SHELP       ---------------LRSAFLEFFRRNGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDVFLGEDKRDYSRA
SYA_PHOPR       ----------MSTDEIRRAFLAFFESKGHQIVESSSLVPANDPTLLFTNAGMNQFKDTFLGIEKRSYTRA
SYA_PSEPG       ----------MKSAEIREAFLRFFEEQGHTRVASSSLIPNNDPTLLFTNAGMNQFKDCFLGAEKRAYTRA
SYA_XANOR       -------PAKFSTSQIRSDFLAFFEGRGHTIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEKRSYVRA
SYA_XANOP       -------PAKFSTSQIRSDFLAFFEGRGHTIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEKRSYVRA
SYA_XANOM       -------PAKFSTSQIRSDFLAFFEGRGHTIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEKRSYVRA
SYA_XANC8       -------PAKFSTSQIRSDFLAFFEGKGHTIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEKRSYVRA
SYA_PSESM       ----------MKSAEIREAFLGFFEEQGHTRVPSSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA
SYA_SHEDO       ---------------LRSAFLAYFETQGHQVVDSSSLVPHNDPTLLFTNAGMNQFKDVFLGMDKRSYSRA
SYA_SHESR       ---------------LRSAFLEFFRSNGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDVFLGMDKRSYTRA
SYA_XANCB       -------PAKFSTSQIRSDFLAFFEGKGHTIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEKRSYVRA
SYA_SHESA       ---------------LRSAFLEFFRSNGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDVFLGMDKRSYTRA
SYA_IDILO       ---------SMNSAQIRDAFLNYFAERGHEKVPSASMIPGNDPTLLFTNAGMVPFKDVFLGTDKRRYDKA
SYA_XANCP       -------PAKFSTSQIRSDFLAFFEGKGHTIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEKRSYVRA
SYA_XANC5       -------PAKFSTSQIRSDFLAFFEGKGHTIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEKRSYVRA
SYA_PASMU       -------------AEIRQSFLDFFHTKGHQIVASSALVPENDPTLLFTNAGMNQFKDVFLGMDKRPYSRA
SYA_AERHH       ----------MSTSEIRTAFLEYFRSQGHQVVSSSSLVPHNDPTLLFTNAGMNQFKDVFLGADKRAYNRA
SYA_SHEON       ---------------LRSAFLEFFRSNGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDVFLGMDKRSYTRA
SYA_AERS4       ----------MSTSEIRAAFLEYFRSQGHQVVSSSSLVPHNDPTLLFTNAGMNQFKDVFLGADKRAYNRA
SYA_SHESW       -------------AELRSAFLEFFRSHGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDVFLGMDKRNYTRA
SYA_SHEPC       -------------AELRSAFLEFFRSHGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDVFLGMDKRNYTRA
SYA_PSEU2       ----------MKSAEIREAFLGFFEEQGHTRVASSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA
SYA_SHEHH       ---------------LRSAFLEYFRTNGHQVVDSSSLVPANDPTLLFTNAGMNQFKDVFLGADKRSYSRA
SYA_XYLFM       -------PTKFTTSKIRSDFLEFFKNKGHKIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEKRSEVRV
SYA_XYLFA       -------PTKFTTSKIRSDFLEFFKNKGHKIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEKRSEVRV
SYA_HAEDU       -------------SEIRQSFLDFFNSKGHTVVPSSALVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTRA
SYA_XYLFT       -------PTKFTTSKIRSDFLEFFKNKGHKIVPSAPLVPSNDPTLLFTNSGMVQFKDVFLGAEKRSEVRV
SYA_XYLF2       -------PTKFTTSKIRSDFLEFFKNKGHKIVPSAPLVPSNDPTLLFTNSGMVQFKDVFLGAEKRSEVRV
SYA_ACTP7       -------------SEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTRA
SYA_PSEE4       ----------MKSAEIREAFLRFFEEQGHTRVASSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA
SYA_ACTPJ       -------------SEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTRA
SYA_PSEHT       ---------HMTTAQIRQQFLDFFASKQHQVVPSSSLIPGNDATLLFNNAGMVQFKDVFLGAESRPYTRA
SYA_ACTP2       -------------SEIRQSFLDFFHSKGHTVVPSSSLVPENDPTLLFTNAGMNQFKDVFLGLEKRPYTRA
SYA_PSE14       ----------MKSAEIREAFLGFFEEQGHTRVASSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA
SYA_YERE8       -------------AEIRQAFLDFFHSKGHQVVSSSSLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA
SYA_MANSM       -------------AQIRQSYLDFFHSKGHQVVESSSLVPHNDPTLLFTNAGMNQFKDVFLGMDKRPYTRA
SYA_PSEF5       ----------MKSAEIREAFLRFFEEQGHTRVASSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA
SYA_ALCBS       ----------MKSAELRQAFLDYFASQGHTKVSSSSLVPANDPTLLFTNAGMNQFKDVFLGRESRDYTRA
SYA_HAHCH       ----------MKSSEIRSAFLKYFQRNGHEVVASSSLVPADDPTLLFTNAGMNQFKDVFLGKDKRNYDRA
SYA_PSEPF       ----------MKSAEIREAFLRFFEEQGHTRVASSSLIPGNDPTLLFTNAGMNQFKDCFLGQEKRAYTRA
SYA_ALHEH       -------------AEIRNAFLEFFEHRGHTVVPSSPLVPANDPTLLFTNAGMVPFKDVFLGKEQRGYTRA
SYA_SHEPA       ---------------LRSAFLEYFRTNGHQVVDSSSLVPANDPTLLFTNAGMNQFKDVFLGADKRSYSRA
SYA_PSEA6       -------------AQIRQAFLNFFADKGHQKXXXXXXXXXXXXXXLFTNAGMNQFKDVFLGTEQRKYTRA
SYA_PSEU5       ----------MKSAEIREAFLRFFEEKGHTRVASSSLIPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA
SYA_PSEMY       ----------MKSAEIREAFLSFFEEKGHTRVASSSLIPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA
SYA_PSEAB       ----------MKSAEIREAFLRFFEEKGHTRVASSSLIPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA
SYA_SHEAM       ---------------LRSAFLEYFRQQGHQVVDSSSLVPGNDPTLLFTNAGMNQFKDCFLGMEKRSYVRA
SYA_DICNV       ----------MTTAEIRRAFLNYFSENGHKIVHSASLVPGNDPTLLFTNAGMVPFKELFIGTETRDYRRA
SYA_COLP3       -------------AEVRQAFLDFFATKQHQIVKSSSLVPGNDATLLFTNAGMVPFKDVFLGAETRSYTRA
SYA_PSYWF       ----------LRTADVRKAFIDFFVSKQHTHVPSSSLVPYNDPTLLFTNAGMNQFKDCFLGIDKRDYTRA
SYA_NITOC       -------------AELRKIFLDYFRHQSHEIVPSGPLVPANDPTLLFTNAGMVQFKEVFLGREVRAYHRA
SYA_PSEAE       ----------MKSAEIREAFLRFFEEKGHTRVASSSLIPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA
SYA_PSEA7       ----------MKSAEIREAFLRFFEEKGHTRVASSSLIPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA
SYA_ACIBY       ----------MTSAEIREAFLRYFETQGHTRVASSSLVPANDPTLLFTNAGMNQFKDCFLGLEKRDYVRA
SYA_ACIBT       ----------MTSAEIREAFLRYFETQGHTRVASSSLVPANDPTLLFTNAGMNQFKDCFLGLEKRDYVRA
SYA_ACIBC       ----------MTSAEIREAFLRYFETQGHTRVASSSLVPANDPTLLFTNAGMNQFKDCFLGLEKRDYVRA
SYA_CHRSD       ----------MKSADIRQAFLTFFEEHGHTIVPSSSLVPANDPTLLFTNAGMVPFKDVFLGRDPRPYVRA
SYA_FRAP2       ----------ISTKELRNKFISYFESKNHSHQPSSSLIPFGDDTLLFTNAGMVQFKDVFLGLEKRDFSRA
SYA_ACIAD       ----------MTSAEIREAFLRYFESQGHTRVASSSLVPANDPTLLFTNAGMNQFKDCFLGLEKRDYVRA
SYA_COXBU       ----------MNSNQLRETFLNYFKQLDHEVVPGSSLIPENDPTLLFTNAGMVQFKDVFLGVETRPYQRA
SYA_COXBN       ----------MNSNQLRETFLNYFKQLDHEVVPGSSLIPENDPTLLFTNAGMVQFKDVFLGVETRPYQRA
SYA_HALHL       ----------MTSAQLRAAFLDFFRERGHEVVPSSPLVPANDPTLLFTNAGMVPFKEVFLGREQRGYQRA
SYA_COXBR       ----------MNSNQLRETFLNYFKQLDHEVVPGSSLIPENDPTLLFTNAGMVQFKDVFLGVETRPYQRA
SYA_PSYCK       -------------ADIRQAFIDFFISKQHTPVASSSLIPHNDPTLLFTNAGMNQFKETFLGMEPRDYTRA
SYA_LEGPL       ----------MKSSEIRQAFLNYFVQRGHQLVASSSLIPSNDPTLLFTNAGMVQFKDLFLGLETRPYQRA
SYA_PSYA2       -------------ADIRQAFIDFFISKQHTPVASSSLIPHNDPTLLFTNAGMNQFKETFLGMEPRDYTRA
SYA_LEGPH       ----------MKSSEIRQAFLNYFVQRGHQIVASSSLVPSNDPTLLFTNAGMVQFKDLFLGLETRSYQRA
SYA_LEGPC       ----------MKSSEIRQAFLNYFVQRGHQIVASSSLVPSNDPTLLFTNAGMVQFKDLFLGLETRSYQRA
SYA_RUTMC       ----------MKTAQIRQKFLDYFESKGHTIESSASLIPHNDKTLLFVNAGMVLFKDVFSGVEKRPYMRA
SYA_PSYIN       -------------NEIRQGFRDFFVNKGHQSVSTGSLVPHDDPTLLFTNAGMNQFKDTYLGTEKRAYTRA
SYA_LEGPA       ----------MKSSEIRQAFLNYFVQRGHQIVASSSLVPSNDPTLLFTNAGMVQFKDLFLGLETRSYQRA
SYA_GEOMG       ----------MTGNELRARFLKFFEDRGHTVVPSSLLIPHNDPTLLFANAGMNQFKDCFLGMEDRGYTRA
SYA_GEOSL       ----------MTGKEIRARFLKFFADRGHAVVPSSPLIPHNDPTLLFANAGMNQFKDCFLGLEKRDYVRA
SYA_GEOUR       ----------MTGKEIRAQFFKFFEERGHTVVESSNLIPRNDPTLLFTNAGMNQFKDVFLGLEKRDYVRA
SYA_BAUCH       ---------NNSTAELRQEFLNFFHQKGHKIVASSSLVSHNDPTLLFTNAGMNQFKDVFLGLDKRLYQSA
SYA_YERPA       -------------AEIRQAFLDFFHSKGHQVVSSSTLVPNNDPTLLFTNAGMNQFKDVFLGLDKRAYSRA
SYA_MAGSM       ----------MNGNEIRKRFVAFFQQHGHTHVESSSLVPRNDPTLLFTNAGMVQFKSLFLGEERRDYSRA
SYA_BRASO       ------------VNEIRSTFLNFFAANGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYHRA
SYA_FRATO       --------------ELRNKFINYFESKNHSHQPSSSLIPFGDDTLLFTNAGMVQFKDVFLGIEKKDFSRA
SYA_FRATH       --------------ELRNKFINYFESKNHSHQPSSSLIPFGDDTLLFTNAGMVQFKDVFLGIEKKDFSRA
SYA_FRATF       --------------ELRNKFINYFESKNHSHQPSSSLIPFGDDTLLFTNAGMVQFKDVFLGIEKKDFSRA
SYA_SYNAS       -------------SEIRESFLRFFEGKGHTRVSSSSLIPKDDPTLLFTNAGMVQFKNAFLGLEDRGYSRA
SYA_HELMI       ---------------VRQLFLEYFEQKGHTIVASSSLVPHNDPTLLFSNAGMNQFKDVFLGFEKRPYLRA
SYA_BRASB       ------------VNEIRSTFLNFFAANGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYHRA
SYA_SOLUE       --------------EIRQRFLDFFAERGHRVVRSSSLVPANDPTLLFTNAGMNQFKDVFLGQEKRDYVRA
SYA_AGRT5       ------------VNEIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLESRPYSTA
SYA_RHIL3       ------------VNDIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYSTA
SYA_PELPD       ----------MTGSEIRRRFLTFFAERGHTIVPSSGIIPKNDPTLMFANAGMNQFKDCFLGMEKRDYTRA
SYA_DESVV       -------------NEIRRRFLEFYKAHGHEAVRSSSLVPKDDPSLLFTNAGMVQFKKIFLGQEKRAYSRA
SYA_DESVH       -------------NEIRRRFLEFYKAHGHEAVRSSSLVPKDDPSLLFTNAGMVQFKKIFLGQEKRAYSRA
SYA_VESOH       ----------MKTAQIRQKFLDYFESKGHIIESSASLIPHNDKTLLFVNAGMVPFKDVFSGIEKRPYTRA
SYA_FRATW       --------------ELRNKFINYFESKNHSHQPSSSLIPFGDDTLLFTNAGMVQFKDVFLGIEKKDFSRA
SYA_RHOPS       ------------VNEIRSAFLNYFAKNGHDIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYHRA
SYA_FRATT       --------------ELRNKFINYFESKNHSHQPSSSLIPFGDDTLLFTNAGMVQFKDVFLGIEKKDFSRA
SYA_FRAT1       --------------ELRNKFINYFESKNHSHQPSSSLIPFGDDTLLFTNAGMVQFKDVFLGIEKKDFSRA
SYA_FRATN       --------------ELRNKFINYFESKNHSHQPSSSLIPFGDDTLLFTNAGMVQFKDVFLGIEKKDFSRA
SYA_FRATM       --------------ELRNKFINYFESKNHSHQPSSSLIPFGDDTLLFTNAGMVQFKDVFLGIEKKDFSRA
SYA_PELCD       ----------MTGNEIRSRFLKFFQDHGHTVVPSSALIPHNDPTLLFINAGMNQFKDVFLGREKRDYVRA
SYA_METEP       ------------VNEIRSTFLDYFRDAGHAVVPSSSLVPKNDPTLMFTNAGMVQFKNVFTGVEKRPYVKA
SYA_RHOPA       ------------VNEIRSTFLNYFAKNGHEIVSSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRSYQRA
SYA_SILST       ------------LNDIRSTFLNYFAKQGHEVVDSSPLVPRNDPTLMFTNSGMVQFKNCFTGVDRRDYVRA
SYA_RHIEC       ------------VNDIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYATA
SYA_THIFE       ----------MQAQAIRQAFLEYFVEQGHQIVPSSPLIPRNDPTLLFTNAGMVPFKDVFLGLETRPYRRA
SYA_RHIME       ------------VNEIRSMFLDYFRKNGHEIVSSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEQRPYSTA
SYA_BRUSU       ------------VNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNRA
SYA_BRUSI       ------------VNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNRA
SYA_BRUME       ------------VNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNRA
SYA_BRUC2       ------------VNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNRA
SYA_BRUAB       ------------VNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNRA
SYA_BRUA2       ------------VNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNRA
SYA_BRUO2       ------------VNEIRSTFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNRA
SYA_OCHA4       ------------VNEIRSTFLDYYRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRSYNRA
SYA_RHOP2       ------------VNDIRSAFLNYFAKNGHDIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRPYQRA
SYA_RHOPB       ------------VNEIRSAFLNYFGKDGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRANHRA
SYA_NITHX       ------------VNDIRSAFLNYFAANGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYQRA
SYA_METPB       ------------VNEIRSTFLDYFRDAGHAVVPSSSLVPKNDPTLMFTNAGMVQFKNVFTGVEKRPYVKA
SYA_PARL1       ------------VNEIRSKYLEFFRAQGHEVVASGPLVPNNDPTLLFTNAGMVPFKNVFTGQETRPYKRA
SYA_DESDG       -------------NEIRHRFLEFFRKNGHEVVDSSSLVPNDDPTLLFTNAGMVQFKKIFLGQEKRAYSRA
SYA_BEII9       ------------VNEIRAAFLDFFRKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNLFTGVEKRPYTRA
SYA_MOOTA       ----------MTGNELRERFLKFFASKGHTIVHSSSLVPANDPTLLFTNAGMVQFKDVYLGLDRRPFTRA
SYA_SINMW       ------------VNEIRSMFLDYFRKNGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEQRPYSTA
SYA_ANADF       -------------AQIRELFLRFFEEKAHRRVPSSSLVPQNDPTLLFTNAGMNQFKDVFTGREKRDYSRA
SYA_RHOP5       ------------VNEIRSAFLNYFGKNGHEIVASSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRANPRA
SYA_NITWN       ------------VNDIRSAFLNYFAANGHQIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYQRA
SYA_ROSS1       ---------------IREQFLRFFEERGHVRVPSSSLIPGNDPTLLFTNSGMVQFKDTFLGLEQRPYTRA
SYA_BARHE       ------------VNSIRSTFLDYFQLNGHKIVSSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEQRPYKQA
SYA_CAUCR       ------------LNEIRSTFLDYFGKADHAVTPSAPLVPQNDPTLLFVNAGMVPFKNVFTGAETPAHPRA
SYA_DESPS       ----------MKGNEIRSRFLEYFKGNGHTVAESSSLVPKDDPTLLFTNAGMVQFKRVFMGDDKRGYVRA
SYA_MYXXD       -------PSALTASEIREAFLKFFEERGHRRVASSSLVPANDPTLMFTNAGMVQFKDVFTGRETRDYRRA
SYA_RHILO       ------------VNEIRSTFLDYFRKEGHEVVASSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRSYSRA
SYA_GLUOX       -------------NDIRSAFLEYFGSQGHRIVPSASLVPQNDPTLLFTNAGMVPFKNVFTGQETRPYSRA
SYA_BRAJA       ------------VNEIRSTFLNFFAENGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYQRA
SYA_ANADE       -------------AEIRELFQRYFEEHGHRRVASSSLVPQNDPTLLFTNAGMVQFKDVFTGRERRDYSRA
SYA_SULSY       ----------MTADEIRQSFLKYFESKGHTIVKSASIIPENDPTLLFVNAGMVPFKNVFLGLEERPYKRA
SYA_XANP2       ------------VNEIRSSFIDYFVKEGHEAVASSPLVPQNDPTLMFTNAGMVQFKNVFTGVEKRPYSRA
SYA_BART1       ------------VNNIRSTFLDYFHRNGHQVLSSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEQHLYKKA
SYA_JANSC       ------------LNDIRSTFLDYFGRQGHAVVPSSPLVPRNDPTLMFVNSGMVQFKNLFTGVEKRDYVRA
SYA_SPHWW       -------------NDIRRSFLDHFAKEGHELVPSAPLVPHNDPTLMFVNAGMVPFKNVFTGLEKRPYSTA
SYA_ROSCS       ---------------IREQFLRFFEERGHVRVPSSSLIPGNDPTLLFTNSGMVQFKDTFLGLEQRPYTRA
SYA_SYNWW       -------------AEIRKTFLEYFEERGHSVVESSSLVPVNDPTLLFTNAGMNQFKDVFLGLDKRKYVRA
SYA_PARDP       ------------LNDVRSTFLNYFERNGHRVVESSPLVPRNDPTLMFTNSGMVQFKNLFTGVETRDYKRA
SYA_BDEBA       ----------MKSSEIRNAFIKYFEKNGHKVVPSSSLIPENDPTLLFANAGMNQFKNTFLGLEKRDYSRA
SYA_METRJ       ------------VNEIRSTFLDYFAKAGHEVVPSSSLVPKNDPTLMFTNAGMVQFKNVFTGMEKRAYDRA
SYA_MAGSA       -------------NEIRRTFLDFFEKNGHTVVNSSPLVPRNDPTLMFTNAGMVQFKNVFTGIEKRDYVRA
SYA_RHORT       -------------SEIRRTFLDFFVKNGHQEVASSPLVPLNDPTLMFTNAGMVQFKNVFTGAETRPYHRA
SYA_HYPNA       ------------VNDIRETFLGFFEKNGHARRPSAPLVPQNDPTLLFVNAGMVPFKNIFTGAEKPFAPRA
SYA_WOLPM       ----------MKLNEIRERFIKFFVNNDHEQVSSSPLIPEHDPTLMFTNAGMVQFKNIFTGAQKTEMKRA
SYA_CAUSK       ------------LNEIRSTFLNYFGAADHAIVPSAPLVPQNDPTLLFVNAGMVPFKNVFTGAETPPHPRA
SYA_BARQU       ------------VNSIRSTFLDYFHLNGHKVLSSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEQRPCKQA
SYA_RICM5       --------------EVRSKFITYFKANNHTHVPTSSLIPHNDPSLMFVNSGMVQFKNVFTGQEKRPYNKA
SYA_LAWIP       ----------LTVNDIRQKFLGYFKNYNHQEIPSSSLIPRDDPSLLFTNAGMVQFKKVFTGQETRNYLRA
SYA_BLOPB       ------------IDDIRQEFLNFFKKKGHKIISSSTLIPNSDQTLLFTNSGMNQFKNIFLGIDKPLFKRV
SYA_SPHAL       -------------NDIRRSFLDYFGGAGHHIEPSAPLVPYNDPTLMFVNAGMVPFKNVFTGLEKRPYSTA
SYA_PELUB       ------------LNQIRTTFLDYFEKNDHKIVESSNLVPNNDPTLMFANSGMVQFKNIFTGLEKRDYVRA
SYA_METS4       ------------VNEIRSTFLDYFAKHGHEVVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYHRA
SYA_BARBK       ------------VNNIRSTFLDYFHRNGHEVLSSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKHSYNRA
SYA_RICCK       --------------EVRSKFITYFKTNNHTHVPASSLIPQNDPSLMFVNSGMVQFKNVFTGQEKRPYNKA
SYA_GRABC       -------------NDIRATFLNYFARNGHEVVDSSPLVPRNDPTLLFVNSGMVQFKNVFTGQERRPYSRA
SYA_MARMM       --------------DIRATFLDYFAKHEHEVVPSAPLVPQDDPTLLFVNAGMVPFKNSFTGQEKRASLRA
SYA_BARBA       ------------VNNIRSTFLDYFHRNGHEVLSSSPLVPRNDPTLMFTNAGMVDFKNVFTGLEKHSYNRA
SYA_CAMFF       --------------DIRKEYLDFFKSKGHEIITSAPLVP-DDATLLFTNAGMVPFKSIFTGDVPRPNPPI
SYA_SYMTH       ----------MTSAEIRQKFIDFFKSKGHVHVPSSSLVPHNDPTLLFTNAGMNQFKDTFLGLEKREYTRA
SYA_RICRS       --------------EVRSKFITYFKANNHTHVPASSLIPHNDPSLMFVNSGMVQFKNVFTGQGKRPYNKA
SYA_RICRO       --------------EVRSKFITYFKANNHTHVPASSLIPHNDPSLMFVNSGMVQFKNVFTGQGKRPYNKA
SYA_ERYLH       -------------NDIRRSFLDYFTGAGHAEIASAPLVPYNDPTLMFVNAGMVPFKNVFTGLETPPAPTA
SYA_MESSB       ------------VNDIRSAFLDFFKKNGHEVVASGPLVPRNDPTLMFTNAGMVQFKNVFTGMETRPYNRA
SYA_DESOH       ----------MTGNEARKTFLDYFENQGHRVVRSSSLVPQADPTLLFVNAGMVQFKRVFMGEEKRDYTTA
SYA_DINSH       ------------LNEIRSTFLNFFGGHGHEIVDSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEHRDYNRA
SYA_RICCN       --------------EVRSKFITYFKANNHTHVPASSLIPHNDPSLMFVNSGMVQFKNVFTGQGKRPYNKA
SYA_WOLTR       ----------MKLNEIRERFIKFFVRNNHKQVFSSPLIPEHDPTLMFTNAGMVQFKNIFTGIQKTDIKRA
SYA_SYNFM       ----------MKASEIRKAFLDFFAQRGHSVVKSSSVIPHDDPSLLFTNAGMVQFKRTFLGEEKRPYNRA
SYA_RICFE       --------------EVRSKFITYFKANNHTHVPASSLIPHNDPSLMFVNSGMVQFKNVFTGQEKRPYNKA
SYA_RHOS5       ------------LNDIRSTFLDYFRRNGHRVVESSPLVPRNDPTLMFTNSGMVQFKNCFTGLEHRDYTRA
SYA_SILPO       ------------LNDIRSTFLNYFAKQGHTIVPSSPLVPRNDPTLMFTNSGMVQFKNCFTGVDKRDYVRA
SYA_RHOS1       ------------LNDIRSTFLDYFRRNGHRVVESSPLVPRNDPTLMFTNSGMVQFKNCFTGLEHRDYTRA
SYA_AQUAE       ---------SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRA
SYA_DESHY       -------------NQLRDMFLNFFASKGHRILPSASLIPKDDPTLLLTVAGMVPFKPYFMRKVEPPFPRA
SYA_ACICJ       -------------NDIRATFLDFFARNGHEVVPSAPLVPRNDPTLMFVNAGMVPFKNVFTGHEHRPYVRA
SYA_CHLPD       ----------MNSREIRQSFLDFFDRKGHTIVRSAPVIPLDDPTLLFTNAGMNQFKDVFLDKGTRPYVRA
SYA_AZOC5       ------------VNEIRSSFIDYFVKNGHEAVASSPLVPRNDPTLMFTNAGMVQFKNVFTGVEKRPYSRA
SYA_RICAH       --------------EVRSKFITYFKTNNHTHVPASSLIPHNDPSLMFVNSGMVQFKNVFTGQTKRPYHTA
SYA_DESRM       --------------EIREKYLRFFEQRGHQILPSASLIPHNDPSILWTAAGMVPFKPFFTGQAVPEYQRV
SYA_RHOS4       ------------LNDIRSTFLDYFRRNGHRVVESSPLVPRNDPTLMFTNSGMVQFKNCFTGLEHRDYTRA
SYA_RICBR       --------------EIRSKFISYFKANNHTHVSSSPLIPHNDPSLMFVNSGMVQFKNVFTGQEKRPYDKA
SYA_CLOD6       ----------MGLNEIRSKFLEFFESKGHYVANSYSLVPNNDKSLLLINSGMAPLKNYFSGVEVPPSVRM
SYA_THETN       ------------MNEIREKFLSFFESKGHLRLPSFSLVPKNDKSLLLINSGMAPLKPYFTGKETPPSRRV
SYA_ROSDO       ------------LNDIRSTFLSYFEKQGHSVVASSPLVPRNDPTLMFANSGMVQFKNLFTGVETRAYKRA
SYA1_CLOPH      ------------VNELRKMYLDFFESKGHLKLNSFSLVPQNDKSLLLINSGMAPLKPYFTGQEIPPKKRV
SYA_ZYMMO       -------------NEIRRSFLEYFEKNGHRIVPSAPLVPQNDPTLMFVNAGMVPFKNTFTGLESRPYKTA
SYA_NITSB       --------------DIRKEFLNYFASKAHTIYPSAPLVP-EDPTLLFTNAGMVPFKKIFTGEMPAEVPRA
SYA_SORC5       ---------------LRRTFLEFFAQRGHEIVPSAPLVPQNDPTLMFVNAGMVQFKDVFTGKDRRPYQRA
SYA_PELTS       ----------MTGNEIRESYLKFFEKKGHKILPSASLIPLNDPSILWTAAGMVPFKPFFTGAAKPEYTRV
SYA_CAMC1       ----------MQNLDIRKAYLDFFKSKGHEVVASAPLVP-NDATLLFTNAGMVPFKSIFTGEVPRPTPPI
SYA_AQUPY       --------------EIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRA
SYA_SULNB       --------------DIRKTFLDYFQSKGHKLVPSSPLVP-DDPTLMFTNAGMVQFKNIFTGEAPIPNPRA
SYA_HERA2       ----------MKGSELRQRFLDYFARQGHAVVPSSSLIPADNPTLLFTVAGMVQFNDVFLGRESRPYSRA
SYA_CAMC5       ----------MQNLDVREAYLNFFKSKGHEITPSAPLVP-NDATLLFTNAGMVPFKSIFTGEVPRPTPPI
SYA_STAHJ       ---------NLKASEIRQKYIDFFVEKGHMVEPSAPLVPIDDDSLLWINSGVATLKKYFDGRETPRKPRI
SYA_ANAPZ       ------------VSGIREAFLDFFEKQGHTRYPSAPLIAEGDASLLFTNAGMVPFKQRFI-TGVSDVKTA
SYA_CAMJJ       --------------DIRKAYLDFFASKGHEITPSSPLVP-DDATLLFANAGMVPFKSIFTGEIPRPNPRK
SYA_STAAW       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAAS       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAAR       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAAN       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAAM       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAA9       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAA2       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAA1       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAAT       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAAE       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAAC       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAA8       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAA3       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_CAMJ8       --------------DIRKAYLDFFASKGHEITPSSPLVP-DDATLLFTNAGMVPFKSIFTGEIPRPNPRK
SYA_STAS1       ---------NLKASEIRQNFIDYFVEKGHMVEPSAPLVPIDDDSLLWINSGVATLKKYFDGRETPRKPRI
SYA_CAMJR       --------------DIRKAYLDFFASKGHEITPSSPLVP-DDATLLFTNAGMVPFKSIFTGEIPRPNPRK
SYA_CAMJE       --------------DIRKAYLDFFASKGHEITPSSPLVP-DDATLLFTNAGMVPFKSIFTGEIPRPNPRK
SYA_SYNJA       ---------------IRQAFLDFYAQRGHQVLPSASLVP-EDPTVLLTIAGMLPFKPIFLGHQDPQYPRV
SYA_FINM2       ---------NYGLNEIRKKFLDYFGERGHLVIKSFPLIPQDDKSLLLINAGMAPLKKYFTGEKKLKKDRA
SYA_CAMJD       --------------DIRKAYLDFFASKRHEITPSSPLVP-DDATLLFTNAGMVPFKSIFTGEIPRPNPRK
SYA_NATTJ       ----------MRTHEIRKKFLEFFETKDHYVRKSYSIIPENDPSILLIGAGMAPLKPYFTGEKTPPSPRM
SYA_STAAB       ----------LKASEIRQKYLDFFVEKGHMVEPSAPLVPIDDDTLLWINSGVATLKKYFDGRETPKKPRI
SYA_LISIN       -------------AEVRQLFLDFFKEKGHTIEPSAPLVPNNDPTILWINSGVATMKKYFDGSVIPDNPRM
SYA_RICTY       --------------EVRSKFITYFKANNHTHVPASSLIPDNDPSLMFVNSGMVQFKNVFTGQEKRSYNKA
SYA_LISW6       -------------AEVRQLFLDFFKEKGHTIEPSAPLVPNNDPTILWINSGVATMKKYFDGSVIPDNPRM
SYA_BACLD       -------------AQVRQMFLDFFKEKGHAVEPSASLIPHEDPSLLWINSGVATLKKYFDGRVVPENPRI
SYA_NOVAD       -------------NEIRRSFLEYFGSNGHDVVPSAPLVPYNDPTLMFTNAGMVPFKNVFTGLETRAVPRA
SYA_THEPX       ------------MNEIREKFLSFFESKGHLRLPSFSLIPKNDKSLLLINSGMAPLKPYFTGKETPPSKRV
SYA_THEP3       ------------MNEIREKFLSFFESKGHLRLPSFSLIPKNDKSLLLINSGMAPLKPYFTGKETPPSKRV
SYA_THEM4       ----------MLSEEIRQLFLEFFEKKGHKILPSASLIP-DDPQLMFTVAGMVPFKPIFWGKVDPVYPRV
SYA_RICPR       --------------EVRSKFITYFKANNHTHVPASSLIPDNDPSLMFVNSGMVQFKNVFTGQEKRSYNKA
SYA_CALS8       ----------MSTDEIREKFLQFFESKGHLRLPSFSLIPKNDKSLLLINAGMAPLKPYFLGIEEPPRRRI
SYA_THEMA       ----------MTSEEIREAFLKFFEKKGHKILPSASLIP-DDPQLLFTVAGMVPFKPIFWGKVEPVYTRV
SYA_CHLAA       ----------LTAAQIRETFLSFFIRHGHTHVPSSSLVVADDPTLLFANSGMVQFKDVFLGREQRPYSRA
SYA_OCEIH       -------------AEIRQMFIDFFKEKSHSVEPSASLVPHEDPTLLWINSGVATLKKYFDGRVIPDNPRI
SYA_LISMO       -------------AEVRQLFLDFFKEKGHTIEPSAPLVPNNDPTILWINSGVATMKKYFDGSVIPDNPRM
SYA_WOLSU       --------------DIRKLFLDYFASKGHAVYESMPLVP-DDPTLLFTNAGMVQFKDIFTGKVPAPTPRA
SYA_HELAH       --------------DIRNEFLQFFKNKGHEIYPSMPLVP-NDSTLLFTNAGMVQFKDIFTGMVPHPSIRA
SYA_BACA2       -------------AEVRQMFLDFFKEKGHAVEPSASLVPHEDPSLLWINSGVATLKKYFDGRVVPENPRI
SYA_LISMF       -------------AEVRQLFLDFFKEKGHTIEPSAPLVPNNDPTILWINSGVATMKKYFDGSVIPDNPRM
SYA_CLOAB       ----------MGLNDIRESYLSFFEKKEHLRLPSFSLIPKNDKSLLLINAGMAPLKPYFTGLQTPPKTRV
SYA_ANAMM       ------------LSSIRKKFLEFFVKNGHKLYASAPLVATGDASLLFTSAGMVPFKQAFTGSSVDGAKTA
SYA_CARHZ       ----------MLAREIREKFLKFFESKGHKILPSASLIPANDPSLLWTAAGMVPFKPYFTGAAVPEVRRV
SYA_THELT       ----------MTGDELRSAFLRFFEKKGHKILPSASLIP-DDPQLLFTVAGMVPFKPIFWGKVEPVYTRV
SYA_PEDPA       -------------SEIRRMYLDFFKSKGHIIEPSASLVPQDDPTLLWINSGVATMKKYFDGSVVPEVPRL
SYA_THESQ       ----------MTSEEIREAFLKFFEKKGHKILPSASLIP-DDPQLLFTVAGMVPFKPIFWGKVEPVYTRV
SYA_BACSU       -------------AEVRQMFLDFFKEKGHAVEPSASLVPHEDPSLLWINSGVATLKKYFDGRVVPENPRI
SYA_CHLCH       ----------MKSHEIRQSFLDFFAQKGHTIVRSAPVIPADDPTLLFTNAGMNQFKDVFLDKGSRPYVRA
SYA_SULDN       --------------DIREEFLRFFESKNHDRVESAPLVP-DDATLLFNNAGMVPFKSIFTGEVPSPAPRA
SYA_FUSNN       -------------NEIREKFIEFFMQKQHKHFESASLIP-DDPTLLLTVAGMVPFKPYFLGQKEAPCPRV
SYA_BACSK       -------------ASVRQMFIDFFKEKGHSVEPSASLVPFEDPSLLWINSGVATLKKYFDGRVIPENPRI
SYA_HELHP       --------------DIRKQYLDFFASKSHKVYDSMPLVP-DDASLLFTNAGMVQFKDIFTGKIPIPAPRA
SYA_THEP1       ----------MTSEEIREAFLKFFEKKGHKILPSASLIP-DDPQLLFTVAGMVPFKPIFWGKVEPVYTRV
SYA_CAMHC       --------------DIRKEFLDFFASKGHEIIASAPLVP-DDASLLFTNAGMVPFKNIFTGAVPRPTPPI
SYA_CLOTH       ------------LNELRERFLKFFESKGHLRLPSFSLIPQNDPSLLLINSGMAPLKPYFTGQEEPPRRRV
SYA_CHLTE       ----------MNSREIRQSFLDFFAGKEHRIVRSAPVIPAEDPTLLFTNAGMNQFKDVFLGKGTREYTRA
SYA_STAES       ----------MKASEIRQKYLDFFVEKGHMIEPSAPLVPIDDDSLLWINSGVATLKKYFDGRETPKKPRI
SYA_STAEQ       ----------MKASEIRQKYLDFFVEKGHMIEPSAPLVPIDDDSLLWINSGVATLKKYFDGRETPKKPRI
SYA_ARCB4       --------------DIRKEYLEFFRSKGHEVISSMPLVP-DDPTLMFTNAGMVQFKDIFTGAVPTPKKRA
SYA_BACAN       -------------AQIRQMFLDFFQEKGHAVEPSASLVPHEDPSLLWINSGVATLKKYFDGRVIPQNPRI
SYA_DEHE1       --------------ELRENYLKFFEEKGHKRIASSSLIPHNDPTLLLTTAGMVQFKPYYLGVAKPENSRM
SYA_PROVI       ----------MKSSDIRQSFLDFFVGKSHAIVRSAPVIPADDPTLLFTNAGMNQFKDVFLAKGTRSYSRA
SYA_GEOTN       -------------AEVRRMFLQFFQEKGHAVEPSASLIPVDDPSLLWINSGVATLKKYFDGRIIPDNPRI
SYA_BACC1       -------------AQIRQMFLDFFQEKGHAVEPSASLVPHEDPSLLWINSGVATLKKYFDGRVIPQNPRI
SYA_BACAH       -------------AQIRQMFLDFFQEKGHAVEPSASLVPHEDPSLLWINSGVATLKKYFDGRVIPQNPRI
SYA_LACS1       -------------AQIRQMYLDFFKSKGHDVMKSAPLIPHDDPTLLWINSGVATMKKYFDGSVVPKNHRI
SYA_BACCR       -------------AQIRQMFLDFFQEKGHAVEPSASLVPHEDPSLLWINSGVATLKKYFDGRVIPQNPRI
SYA_BACCZ       -------------AQIRQMFLDFFQEKGHAVEPSASLVPHEDPSLLWINSGVATLKKYFDGRVIPQNPRI
SYA_BACHK       -------------AQIRQMFLDFFQEKGHAVEPSASLVPHEDPSLLWINSGVATLKKYFDGRVIPQNPRI
SYA_BACHD       -------------AQVRQMFLDFFKEKGHDVEPSASLVPHDDPSLLWINSGVATLKKYFDGRVIPENPRI
SYA_GEOKA       -------------AQVRRMFLEFFQEKGHAVEPSASLIPVDDPSLLWINSGVATLKKYFDGVPENPRIRI
SYA_BACWK       -------------AQIRQMFLDFFQEKGHAVEPSASLVPHEDPSLLWINSGVATLKKYFDGRVIPQNPRI
SYA_BACP2       -------------AQVRQMFLDFFKEKGHAVEPSASLVPHDDPTLLWINSGVATLKKYFDGRVVPDNPRI
SYA_NEOSM       ------------IDGLRKKFIDFFVKNGHTYLPSASLVPKDDPSLMFVNAGMVPFKEYFVDVRRAPFSSI
SYA_HELPH       --------------DIRNEFLQFFQNKGHAVYPSMPLVP-NDATLLFTNAGMVQFKDIFTGIVPHPSIRA
SYA_ENTFA       -------------SQVRQMYLDFFKSKGHSVEPSASLVPVNDPTLLWINSGVATLKKYFDGSVVPENPRI
SYA_BLOFL       ---------------VRQEFLDFFHKQEHQVVPSSSLVPKNDQTLLFTNSGMNQFKDIFLGLVKPSYKRV
SYA_EXIS2       -------------AQIRQMYLDFFQSKGHAIEPSASLVPIEDPTLLWINSGVATLKKYFDGRVIPQNPRI
SYA_EHRCJ       ------------VGDIRKLFVDFFIKNGHQLFPSSPLIVKDDPSLLFTNAGMVQFKHVFTDASNANVGTA
SYA_BACV8       ----------MTAKEIRDSFKSFFESKGHQIVPSAPMVIKDDPTLMFTNAGMNQFKDIILGNHPAKYKRV
SYA_TRIEI       -------------NEIRKKFLSFYAQREHTILPSASLVP-EDPTVLLTIAGMLPFKPIFLGQQPRQYPRA
SYA_PROMS       --------------EIRNAFLKFYSEKLHKIIPSASLIP-DDPTVMLTIAGMLPFKPVFLGLKERPSKRA
SYA_PROM0       --------------EIRNAFLKFYSEKLHKIIPSASLIP-DDPTVMLTIAGMLPFKPVFLGLKERPSKRA
SYA_DEHSC       --------------ELRENYLKFFEEKGHKRIVSSSLIPHNDPTLLLTTAGMVQFKPYYMGVAKPENPRM
SYA_PORGI       --------------EIRESFKTFFASKGHKIVPSAPMVIKGDPTLMFTNAGMNQFKDIILGNTEAKYTRV
SYA_FLAPJ       ----------MTSKEIRQQYLKFFESKGHLIVPSAPIVLKDDPTLMFNNSGMAQFKEYFLGNGTPKSPRI
SYA_PROM9       --------------EIRNAFLKFYSEKLHKIIPSASLIP-DDPTVMLTIAGMLPFKPVFLGLKERPSKRA
SYA_PARD8       ----------LTAKEIRESFKQFFASKEHQIVPSAPMVVKGDPTLMFTNAGMNQFKDIILGNVPRKYPRV
SYA_DEHSB       --------------ELRENYLKFFEEKGHKRIASSSLIPHNDPTLLLTTAGMVQFKPYYLGVAKPENPRM
SYA_ALKOO       ------------VNEIRKEFLEFFRSKEHIIHPSAPLVPQKDKSLLLINSGMAPLKPYFAGLEEPPGKRM
SYA_HELPJ       --------------DIRNEFLQFFQNKGHEIYPSMPLVP-NDATLLFTNAGMVQFKDIFTGIVPRPSIRA
SYA_PARUW       ----------MLTQSIRRQFLEYFKKHQHQIVSSSSVLPHDDPTLLFNNAGMNQFKDVFLGKSYRDYNRA
SYA_BUCAP       -------------NEIRQSFLNFFKEKEHVIVPSSSLIPENDSTLLFTNAGMNQFKEYFLGQKKKFYPRV
SYA_LACBA       -------------SQIRQMYLDFFKSKGHTIEPSASLVPKDDPSLLWINSGVATMKKYFSGQVVPENPRL
SYA_SYNY3       --------------EIRQQFLNFFADRQHQILPSASLVP-EDPTVLLTIAGMLPFKPIFLGQKSAEFPRA
SYA_CLOB8       ----------MKTNDLREAYLKFFESKDHLRMDSFSLVPKNDKSLLLINAGMAPLKPYFTGLQEPPKRRI
SYA_BACCN       -------------AQIRQMFLDFFKEKGHAIEPSASLVPHEDPSLLWINSGVATLKKYFDGRVIPQNPRI
SYA_SYNJB       ---------------IRQTFLDFYAQRGHQVLPSASLVP-EDPTVLLTIAGMLPFKPIFLGQRDPEYPRV
SYA_CYAA5       -------------NQIRDRFLQFYAQHNHQILPSASLVP-EDPTVLLTIAGMLPFKPIFLGQKQPDFPRA
SYA_PELLD       ----------MHSREIRQSFLDFFAAKSHTIVRSAPVIPADDPTLLFTNAGMNQFKDVFLAKGTRPYTRA
SYA_PETMO       --------------EIRENFLYFFEKKGHKKLPSSSLIP-NDPQLLFTVAGMVPFKPIFWGKVEPTYTRI
SYA_LACSS       -------------AQVRQMFLDFFKEKGHDVEPSASLIPDEDPTLLWINSGVATLKKYFDGRVVPNNPRI
SYA_PROMP       --------------EIRKEFLNFYHEKLHKIIPSASLIP-DDPTVMLTIAGMLPFKPVFLGLKERPSKRA
SYA_PROM2       --------------EIRNAFLKFYSEKFHKIIPSASLVP-DDPTVMLTIAGMLPFKPVFLGLKERPSKRA
SYA_ANAVT       -------PQHLSGNEIRTRFLDFYAQRGHQILASASLVP-EDPTVLLTIAGMLPFKPIFLGQRTPEFKRA
SYA_ACIAC       ------------VADIRKSFLDFFASKGHTVVPSSPLVPGNDPTLMFTNSGMVQFKDVFLGTDKRPYVRA
SYA_CHLMU       ----------MLSNTLRSNFLKFYTNRNHTPVASSPVFPYNDPSILFTNAGMNQFKNIFLGKEQTSYTRA
SYA_SYNP2       -------PPVLSGSEIRSKFLEFFNQRQHPILPSASLVP-EDPTVLLTIAGMLPFKPIFLGQQDAPSPRA
SYA_SALRD       --------------EIRQDFLQFFQAKGHEVVPSASLVPDGDGTLLFTNAGMNQFKDVFLGTGQRPYSRA
SYA_EHRCR       ---------NNLVSNLRKSFIDFFAKNGHQVFPSSPLILKDDPSLLFTNAGMVQFKQMFXXXXXXXXXXX
SYA_THEEB       ---------------IRQKFLDFYAAKGHTILPSASLIP-DDPTVLLTIAGMLPFKPIFLGQEAPKVPRA
SYA_BUCAI       ---------------IRQDFLKFFKEKGHMIIPSSSLVPYNDSTLLFTNAGMNQFKEIFLGEKKSNYPRV
SYA_BACTN       ----------LTAKEIRDSFKNFFESKGHHIVPSAPMVIKDDPTLMFTNAGMNQFKDIILGNHPAKYHRV
SYA_GLOVI       ---------------IREKFLQFFESKQHRRLPSASLVP-DDPTVLLTIAGMLPFKPVFMGKRERPAPRV
SYA_BACFR       ----------LTAKETRDSFKNFFESKGHQIVPSAPMVIKDDPTLMFTNAGMNQFKDIILGNHPAKYHRV
SYA_BACFN       ----------LTAKETRDSFKNFFESKGHQIVPSAPMVIKDDPTLMFTNAGMNQFKDIILGNHPAKYHRV
SYA_CLOBK       ----------MGLNEIREEYLKFFESKAHLRLPSFSLVPKNDKSLLLINAGMAPLKPYFTGLQVPPNKRV
SYA_ORITB       ----------LNINQIRTTFIEFFKKYGHHYASSSSLVPGNDPSLFFVNAGIVQFKDYVRAPETSKYSRV
SYA_CLOBL       ----------MGLNEIREEYLKFFESKAHLRLPSFSLVPKNDKSLLLINAGMAPLKPYFTGLQVPPNKRV
SYA_CHLPN       ----------MLSNTIRSNFLKFYANRHHTILPSSPVFPHNDPSILFTNAGMNQFKDIFLNKEKVSYSRA
SYA_LEPBL       ------------VSEIREIFLNYFKDKAHAVVPSSSLLPAGDPTLLFTTAGMVQFKPLFTGAVELPYTRA
SYA_LEPBJ       ------------VSEIREIFLNYFKDKAHAVVPSSSLLPAGDPTLLFTTAGMVQFKPLFTGAVELPYTRA
SYA_FERNB       ----------MTSDEIREAYLSFFEKKGHKRLPSASLIP-DDPQLMFTVAGMVPFKPIFWGKVDPVYPRV
SYA_CLOTE       ---------NMGLNEIREAYLNFFEGKGHLRMESFSLVPKNDKSLLLINAGMAPLKPYFTGVQTPPKSRV
SYA_DESAP       ----------MNSSEIRKRYLEFFAARGHRVIPSASLIPGNDPTLLWTSAGMVPFKPYFTGVATPEFRRV
SYA_HELPS       --------------DIRNEFLQFFHNKGHAVYPSMPLVP-NDATLLFTNAGMVQFKDIFTGIVPRPSIRA
SYA_LACC3       ----------MSSGEIRQMFLDFFKSKGHAVEPSASLIPVDDPTLLWINSGVATLKKYFDGSVVPDNPRI
SYA_SACEN       ----------MQTHEINQRFTEHFRKAGHTVVPSASLI-LDDPTLLFVNAGMVQFKPYFLGDAPAPYPRA
SYA_LACPL       -------------SEIRQMYLDFFHEKGHTIVPSASLVPVDDPTLLWINSGVATMKKYFDGSVVPDNPRM
SYA_CLONN       ----------MGLNQVREAYLKFFESKGHLRLPSFSVVPKNDKSLLLINAGMAPLKPYFTGLQTPPRKRV
SYA_HELPY       --------------DIRNEFLQFFQNKGHAVYPSMPLVP-NDATLLFTNAGMVQFKDIFTGIVPRPSIRA
SYA_EHRRG       --------HNL-VSDLRRLFIDFFVKNGHQFFPSSPLIIKDDPSLLFTNAGMVQFKQIFTSVDGRSINTA
SYA_CHLTR       ----------MLSNTLRSNFLKFYANRNHTPVASSPVFPHNDPSILFTNAGMNQFKNIFLGKEQTSYTRA
SYA_CHLTA       ----------MLSNTLRSNFLKFYANRNHTPVASSPVFPHNDPSILFTNAGMNQFKNIFLGKEQTSYTRA
SYA_LACGA       -------------SQVRQMFLDFFKEHGHMVMPSASLIPQDDPTLLWINSGVATMKKYFDGSVVPKNHRI
SYA_CHLTB       ----------MLSNTLRSNFLKFYANRNHTPVASSPVFPHNDPSILFTNAGMNQFKNIFLGKEQTSYTRA
SYA_CHLT2       ----------MLSNTLRSNFLKFYANRNHTPVASSPVFPHNDPSILFTNAGMNQFKNIFLGKEQTSYTRA
SYA_ALKMQ       ----------MGLNEIRKLFLDFYEEKEHYVQSSYPLVPHNDKSLLLINAGMAPLKNYFSGVETPPSKRM
SYA_STRCO       ----------MESAEIRRRWLSFFEERGHTVVPSASLI-ADDPTLLLVPAGMVPFKPYFLGEVKPPFDRA
SYA_CLOBB       -----------KTNDLRDAYLNFFESKDHLKLESFSLVPQNDKSLLLINAGMAPLKPYFTGLQEPPKKRI
SYA_EHRRW       --------HNL-VSDLRRLFIDFFVKNGHQFFPSSQLVIKDDPSLLFTNAGMVQFKQRFTSVDDRSINTA
SYA_CHLCV       ----------MLSNTLRSNFLKFYANRHHTIVPSSPVFPHNDPSILFTNAGMNQFKDIFLNKETVSYSRA
SYA_OENOB       -------------AQIRQMFLDFFQSKGHKIEPSQSLIPQDDPSLLWINSGVATLKKYFDGSVIPDNPRI
SYA_CLOPE       ----------MGANELREKYLSFFESKDHLRLQSFPLVPKNDKSLLLINAGMAPLKPYFTGLEEPPKRRI
SYA_CLOP1       ----------MGANELREKYLSFFESKDHLRLQSFPLVPKNDKSLLLINAGMAPLKPYFTGLEEPPKRRI
SYA_SYNE7       ---------------IRETFLKFFEGKGHRRLPSASLIP-EDPTVLLTIAGMLPFKPIFLGQQVAEVPRA
SYA_CLOPS       ----------MGANELREKYLSFFESKDHLRLQSFPLVPKNDKSLLLINAGMAPLKPYFTGLEEPPKRRI
SYA_FLAJ1       ----------MKSQDVRKQFLDFFESKGHTIVPSAPIVLKDDPTLMFNNSGMAQFKEFFLGNGTPKSPRI
SYA_SYNP6       ---------------IRETFLKFFEGKGHRRLPSASLIP-EDPTVLLTIAGMLPFKPIFLGQQVAEVPRA
SYA_CLOK5       ------------LNQIREMYLSFFEKKAHLRLPSFSLVPQNDKSLLLINAGMTPLKPYFTGLKVPPSKRV
SYA_LEUCK       -------------SEVRQMFLDFFASKGHEIVPSKNLIPQDDPTLLWINSGVATLKKYFDGSVIPKNPRI
SYA_STRAW       ----------MESAEIRRRWLSFYEERGHTVVPSASLI-ADDPTLLLVPAGMVPFKPYFLGEVKPPWPRA
SYA_PROM3       -------------SEIRTAFLTFFAERAHQVIPSASLVP-EDPTVLLTIAGMLPFKPVFMGQAERPAPRA
SYA_CORDI       ----------MQTHEIRERFTNHFVKAGHEAVPSASLI-LDDPNLLFVNAGMVPFKPYFLGQQNPPFPNA
SYA_LACJO       -------------SQVRQMFLDFFKEHGHMVMQSASLIPQDDPTLLWINSGVATMKKYFDGSVVPKNHRI
SYA_ANASP       -------PQHLSGNEIRTRFLDFYAQRGHQILASASLVP-EDPTVLLTIAGMLPFKPIFLGQRTPEFKRA
SYA_CHLFF       ----------MLSNTLRSNFLKFYANRHHAIVPSSPIFPHNDPSILFTNAGMNQFKDIFLNKETVSYSRA
SYA_UNCTG       -------------SKIRAEFLGFFKNSGCAVVPSDSLIPAGDKTLLFTSAGMVQFKQHFLGQSKDSFTRA
SYA_ORITI       ----------LNINQIRTTFIEFFKKYGHHHASSSSLVPGNDPSLFFVNAGIVQFKDYVRAPETSKYSRV
SYA_GRAFK       ----------MKSQDIRKQFLEFFKSKSHTIVPSAPMVLKDDPTLMFTNAGMVQFKEFFLGNSVAKSNRV
SYA_PROM4       ------KSHPLTGEEIRTAFLHFFAERGHQVLPSASLVP-DDPTVLLTIAGMLPFKPVFLGHEERPSSRV
SYA_CLOBA       -----------KTNDLRDAYLKFFESKDHLKLESFSLVPQNDKSLLLINAGMAPLKPYFTGLQEPPKKRI
SYA_CYTH3       ----------MTSAEIRQQFLDFFASKGHQIVPSAPIVNKNDPTLMFTNAGMNQFKDYFLGNETPKYRRI
SYA_PROMM       -------------SEIRTAFLTFFAERAHQVIPSASLVP-EDPTVLLTIAGMLPFKPVFMGQAERPAPRA
SYA_SYNPX       --------------DIREAFLNFYAERGHQRMASASLIP-EDPTVLLTIAGMLPFKPVFLGQQQRPAPRA
SYA_CHLAB       ----------MLSNTLRSNFLKFYANRHHTIVSSSPVFPHNDPSILFTNAGMNQFKDIFLNKETVSYSRA
SYA_ACAM1       -------------AQIRQTFLDFYAAKGHKILPSASLVP-EDPTVLLTIAGMLPFKPIFLGQREAEVPRA
SYA_NOSP7       -------PQYLSGNEIRNTFLNFFAQRSHQILPSASLVP-EDPTVLLTIAGMLPFKPIFLGQRTPEFKRA
SYA_CLOBH       ----------MGLNEIREEYLKFFESKAHLRLPSFSLVPKNDKSLLLINAGMAPLKPYFTGLQVPPNKRV
SYA_CLOB1       ----------MGLNEIREEYLKFFESKAHLRLPSFSLVPKNDKSLLLINAGMAPLKPYFTGLQVPPNKRV
SYA_SYNS3       --------------EIRAAFLSFYEERGHKVMASASLIP-EDPTVLLTIAGMLPFKPVFLGQQKRPAPRA
SYA_LEUMM       ---------DLSSAEIRQMFLDFFASKGHEVVPSKNLIPQDDPTLLWINSGVATLKKYFDGTVVPNNPRI
SYA_CLOBM       ----------MGLNEIREEYLKFFESKAHLRLPSFSLVPKNDKSLLLINAGMAPLKPYFTGLQVPPNKRV
SYA_COREF       ----------MQTHEIRERFTNHFVNAGHTAVPSASLI-LDDPNLLFVNAGMVPFKPYFLGQQTPPFANA
SYA_STRT2       -------------AQIRQMWLDFWKSKGHAVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_STRT1       -------------AQIRQMWLDFWKSKGHAVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_STRTD       -------------AQIRQMWLDFWKSKGHAVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_LEPBP       ------------VQEIARLYTNYFQDKGHTIVPSSSLIPKGDPTLLFTTAGMVQFKPLFTGAVELPYTRA
SYA_LEPBA       ------------VQEIARLYTNYFQDKGHTIVPSSSLIPKGDPTLLFTTAGMVQFKPLFTGAVELPYTRA
SYA_MICAN       --------NHLSGSEIRQRFLDFFAARNHKILPSASLVP-EDPTVLLTIAGMLPFKPIFLGQKTPEFPRA
SYA_STRMU       -------------AQVRQMWLDFWKSKDHAIEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_LACLA       ----------MTSAEVRQMFLDFFKSKGHTVEPSQSLVPVNDPTLLWINSGVATLKKYFDGSVVPENPRL
SYA_SYNPW       -------------AEIRDAFLAFFEERGHKRMPSASLVP-EDPTVLLTIAGMLPFKPIFLGQQERPAPCA
SYA_SYNR3       -------------AEIRAAFLEFYESRGHQPIPSASLIPV-DPTVLLTIAGMLPFKPVFLGQQERPAPRA
SYA_STRA1       -------------AQIRQMWLDFWKSKGHSVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_LEPIN       ------------VSEIREIFLNYFKDKSHNVVPSSSLLPAGDPTLLFTTAGMVQFKPLFTGAVELPYTRA
SYA_THEFY       ----------MKSAEIARRFLAFFEKNGHTVVPSASLI-AEDPTLLLVNAGMVPFKPYFLGQRTPPYPRA
SYA_STRA5       -------------AQIRQMWLDFWKSKGHSVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_STRPG       -------------AQIRQMWLDFWKSKGHCVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVITENPRI
SYA_STRA3       -------------AQIRQMWLDFWKSKGHSVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_SYNS9       -------------AEIRSAFLRFYEERGHKVMASASLIP-EDPTVLLTIAGMLPFKPVFLGQQERPAPRA
SYA_LEPIC       ------------VSEIREIFLNYFKDKSHNVVPSSSLLPAGDPTLLFTTAGMVQFKPLFTGAVELPYTRA
SYA_DEIGD       ----------LTTAEIREKFLSFFESKGHLRLPSHSLI-APDPTTLFTVAGMQPFKPQFMGAPAKENRRV
SYA_STRPM       -------------AQIRQMWLDFWKSKGHCVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_LACLS       ----------MTSAEVRQMFLDFFKSKGHTVEPSQSLVPVNDPTLLWINSGVATLKKYFDGSVVPENPRL
SYA_STRPC       -------------AQIRQMWLDFWKSKGHCVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_STRPB       -------------AQIRQMWLDFWKSKGHCVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_STRP3       -------------AQIRQMWLDFWKSKGHCVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_STRP1       -------------AQIRQMWLDFWKSKGHCVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_STRPF       -------------AQIRQMWLDFWKSKGHCVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_STRPD       -------------AQIRQMWLDFWKSKGHCVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_WIGBR       -----------KTTEIRNIFLNFFYEKKHKIMDSSTLIPDNDKTLLFTNSGMNQFKDIFLGFKKPKYIRV
SYA_STRP6       -------------AQIRQMWLDFWKSKGHCVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_PROMT       --------------EIRDAFINFFVQHNHKKLASSSLIP-DDPTVLLTIAGMLPFKPIFLGLKESSTPRA
SYA_LACLM       ----------MTSAEVRQMFLDFFKSKGHTVEPSQSLVPVNDPTLLWINSGVATLKKYFDGSVVPENPRL
SYA_STRSY       ---------NLSSAQIRQMWLDFWKSKGHSVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPDNPRI
SYA_STRP8       -------------AQIRQMWLDFWKSKGHCVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPENPRI
SYA_STRPI       -------------AQVRQMWLDFWATKGHSVEPSVSLVPVNDPTLLWINSGVATLKKYFDGTIIPENPRI
SYA_STRPS       -------------AQVRQMWLDFWATKGHSVEPSVSLVPVNDPTLLWINSGVATLKKYFDGTIIPENPRI
SYA_RHOSR       ----------MQTHEIRRRFLDHFVKAGHTEVPSASLI-LDDPNLLFVNAGMVQFVPFFLGQQTPPYPRA
SYA_PROM1       --------------EIREAFINFFVQHNHQKLASSSLIP-DDPTVLLTIAGMLPFKPIFLGLKESSTPRA
SYA_MYCPA       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPYFLGARTPPYPTA
SYA_MYCA1       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPYFLGARTPPYPTA
SYA_BUCBP       -------------NEICQMFLNFFYKKGHTILPGSTLIPNNDPSLLFTNSGMNQFKDIFIQKNYNKYNRV
SYA_STRPN       -------------AQVRQMWLDFWATKGHSVEPSVSLVPVNDPTLLWINSGVATLKKYFDGTIIPENPRI
SYA_MYCGI       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPYFLGQRTPPWDRA
SYA_STRR6       -------------AQVRQMWLDFWATKGHSVEPSVSLVPVNDPTLLWINSGVATLKKYFDGTIIPENPRI
SYA_STRP2       -------------AQVRQMWLDFWATKGHSVEPSVSLVPVNDPTLLWINSGVATLKKYFDGTIIPENPRI
SYA_NOCFA       ----------MQTHEIRRRFLDHFVRAGHTEVPSASLILA-DPNLLFVNAGMVQFKPYFLGQEAPPYPRA
SYA_MYCVP       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPYFLGQRTPPWDRA
SYA_OPITP       ----------MTSAEIRQSFLDFFARQGHTIVXXXXXXXXXXXXX-FTNAGMNQFVPIFLG-DRAPDVRA
SYA_LACAC       -------------SEFRQMFLDFFKEHGHMIMPSASLIPQDDPTLLWINSGVATMKKYFDGSVVPKNRRI
SYA_PROM5       --------------EIRKAFLDFYESKSHXXXXXXXXXXXXX-TVMLTIAGMLPFKPVFLGLRNRPSPRA
SYA_STRGC       ----------MSSAQIRQMWLDFWASKGHSVEPSVSLVPVNDPTLLWINSGVATLKKYFDGTIIPENPRI
SYA_MYCTU       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPFFLGQRTPPYPTA
SYA_MYCTA       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPFFLGQRTPPYPTA
SYA_FRASC       ----------MDTAEIRSRFLNHFARRGHTVVPSASLV-AQDPTLLLVNAGMVPFKPYFLGDLPAPWPRA
SYA_SYNSC       --------------EIREAFLNFYAERGHKRMASASLIP-DDPTVLLTIAGMLPFKPVFLGQQERPAPRA
SYA_MYCBP       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPFFLGQRTPPYPTA
SYA_MYCBO       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPFFLGQRTPPYPTA
SYA_ACIC1       ----------MESAEIARRWLAFFEKRDHVVVPSTPLV-ADDPELLFVVAGMQPFKPYFRGDAPAPWPRA
SYA_DEIRA       ----------LTTAEIRERYLYFFETKGHLRLPSHSTI-APDPTTLFTVAGMQPFKENFMGADGQPSKRV
SYA_MYCSS       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPFFLGQRTPPYQRA
SYA_MYCSK       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPFFLGQRTPPYQRA
SYA_MYCSJ       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPFFLGQRTPPYQRA
SYA_FRAAA       ----------MDTAEIRSRFLNHFARRGHTIVPSASLV-AQDPTLLLVNAGMVPFKPYFLGDLATPWPRA
SYA_LYSSC       ----------MKAVDIRQMYLEFFKEKGHHHEPSAPLVPINDPSLLWINSGVATLKPYFDGRVIPDNPRI
SYA_CORGB       ----------MQTHEIRERFTNHFVNAGHQAVPSASLI-LDDPNLLFVNAGMVPFKPYFLGQQTPPFENA
SYA_CORGL       ----------MQTHEIRERFTNHFVNAGHQAVPSASLI-LDDPNLLFVNAGMVPFKPYFLGQQTPPFENA
SYA_LACH4       -------------SEFRQMFLDFFKDHGHMIMPSASLIPQDDPTLLWINSGVATMKKYFDGSVVPKNHRI
SYA_CORJK       ----------MQTHEIRQRFIEHFTKAGHTEVPSASLI-LDDPNLLFVNAGMVPFKPYFLGQQNPPFENA
SYA_SALAI       ----------MKTAEIRRRYLAHFEANGHAVVPSAPLPAISDPNLLFVAAGMMQFVPYFLGQQTAPYKRA
SYA_STRGG       ----------MESAEIRRRWLSFFEERGHTAVPSASLI-ADDPTLLLVPAGMVPFKPYFLGEVKPPAPRV
SYAC_YEAST      -------------TNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTDFYTLKRA
SYA_STRSV       ----------MSSAQVRQMWLDFWATKGHAVEPSVSLVPVNDPTLLWINSGVATLKKYFDGTIIPENPRI
SYA_METI4       ----------MNSNEIRQSFLDFFKERGHTILPSASLVPES-PNLLFTNAGMNPFVPFFLGKQKCPYVRI
SYA_ELUMP       ----------MDSKEIRASFLNFFKSKGCTVVASSSLIPQADPTLLFTSAGMVQFKANFLGLDKSLH-RA
SYA_SALTO       ----------MKTAEIRRRYLAHFEANGHAVVPSAPLPAISDPNLLFVAAGMMQFVPYFLGQQTAPYKRA
SYA_CORU7       ----------MQTHEIRQRFTDHFVKSGHTEVPSASLI-LDDPNLLFVNAGMVPFKPYFLGQETPPFGTA
SYA_MYCLE       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPFFLGQCTPPYATA
SYA_PROMA       --------------EIRAAFLNFYAERGHEIVPSASLVP-NDPTVLLTIAGMLPFKPVFLGHQDRPSARV
SYA_FRASN       ----------MDTAEIRRRFLNHFSERGHTVVPSASLV-AQDPTLLLVNAGMVPFKPYFLGDLKAPWNRA
SYA_ARATH       ---------------VRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTELSKLSRA
SYA_CLAM3       ----------MQTADIRNAWLTYFGDRGHTVVPSASLV-SDDPTLLFTVAGMVPFVPYLTGVVPAPFPRA
SYA_CLAMS       ----------MQTADIRNAWLTYFGDRGHTVVPSASLV-SDDPTLLFTVAGMVPFVPYLTGVVPAPFARA
SYA_MYCMM       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPFFLGQRTPPYATA
SYA_STRS2       ---------NLSSAQIRQMWLDFWKSKGHSVEPSANLVPVNDPTLLWINSGVATLKKYFDGSVIPDNPRI
SYA_MYCS2       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPYFLGQRTPPWNRA
SYA_LEIXX       ----------MQTAEIHRRWLDFFARRGHTVVPSASLV-SDDPSLLFTVAGMVPFVPYLTGIVPAPFPRA
SYA_MYCUA       ----------MQTHEIRKRFLDHFVKAGHTEVPSASVI-LDDPNLLFVNAGMVQFVPFFLGQRTPPYATA
SYA_KINRD       ----------MQTAEIRRRWLDFFERKEHTVVPSASLV-SSDPSLMFTVAGMVPFIPYLTAQVPAPYKRA
SYA_PROAC       ----------MRTAEIGQRFVDFFESKGHTVVPSASLL-YNDPTLLFVNAGMVPFKPYLMGTEPSPWKRA
SYA_KOCRD       --------------EITQRWLSYFEARDHHVVPSASLV-SQQPGAMFTIAGMVPFIPYFLGQETPPYQRA
SYA_ARTS2       ----------MKSQEITKRWIDFFVSKGHTAVPSASLV-SSDPSLLFTVAGMVPFIPYLTAREEAPYNRA
SYA_NOCSJ       ----------MDTAEIRRRFVAHFEHNAHTPVPSASLL-LDDPNLLFVNAGMVPFKPYFLGQEAPPYPRA
SYA_LACDB       -------------SEFRQMFLDFFAEHGHMVMQSASLIPKDDPTLLWINSGVATMKKYFDGSVVPKNRRI
SYA_LACDA       -------------SEFRQMFLDFFAEHGHMVMQSASLIPKDDPTLLWINSGVATMKKYFDGSVVPKNRRI
SYA_RUBXD       ---------HMKSAEIRRRFLDFFAERDHRIYPSSSLIPHDDPTVLLTTAGVQQFIPYFLGQEKPPHPRA
SYAC_MESAU      ----------------------------HTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTPSHPLARA
SYA_ARTAT       ----------MKSQEITKRWVDFFVNKGHTAVPSASLV-SSDPSLLFTVAGMVPFIPYLTAREEPPYSRA
SYAC_SCHPO      ---------NWPANEIRRTFLKYFEDHGHTIVPSSSVIPYDDPTLLFANAGMNQFKPIFLGTDFAKLKRA
SYA_AKKM8       ----------MTATEIRQSFLDFFREKQHTVVPSASLMPQS-PGLLFTNAGMNQFVPYFLGVWTPPWTRA
SYA_RENSM       ----------MKTQDIAQRWLDFFAAKGHTVVPSASLISA-DPSILFNIAGMVPFVPYLSGREKAPYDRA
SYA_THET8       ----------MRTAEIREKFLSFFEGKGHLRLPSFSLIPEDDPSLLFTSAGMAPLKPYFLGAKPREWRRV
SYA_THET2       ----------MRTAEIREKFLSFFEGKGHLRLPSFSLIPEDDPSLLFTSAGMAPLKPYFLGAKPREWRRV
SYAC_HUMAN      ----------LTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTPSHPMARA
SYAC_RAT        --------------EIRERFINYFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTPSHPMARA
SYAC_PONAB      ----------LTASKIRQRFIDFFKRNEHTYIHSSATIPLDDPTLLFANAGMNQFKPIFLNTPSHPMARA
SYAC_BOMMO      ---------SMTGNEIRKTFIDFFIKKGHKYVHSSSTIPLDDPTLLFANAGMNQFKPIFLGSDMAQYIRV
SYAC_MOUSE      ----------------------------HTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTPSHPMARA
SYA_ACHLI       ----------MTSEQIRQTWLNFFKDKGHIIEPSASLIPVDDPTLLWINAGVAPLKKYFDGTETPKSKRI
SYA_BIFLO       ----------MRTADIAKRYLDYFAKHDHLIVPSASLISPN-PTTLFTIAGMVPFIPYLMGEQTPPKRRM
SYA_BIFAA       ----------MRTSEIAKRFLDYFEQHDHLVVPSASLISPN-PTTLFTIAGMVPFIPYLMGEQTPPKHRM
SYA_TROWT       ----------MLTSDLRLLFLDFFAKRGHKVSPSASLI-SNDPSVMFTIAGMLPFIQCFLALEPPPHPRV
SYA_TROW8       ----------MLTSDLRLLFLDFFAKRGHKVSPSASLI-SNDPSVMFTIAGMLPFIQCFLALEPPPHPRV
SYA_MESFL       ----------LTTNEIRKMWLDFFKEKNHHFLEPVSLIPVEDPSLLWINSGVATLKPYFDGRKTPPSPRL
SYA_MYCMS       ----------LSTNQIRKIWLDFFISKNHYFLETVSLIPVDDPSLLWINSGVATLKPYFDGRKTPPSPRL
SYA_RHOBA       ----------MKTDELREKYLAFFETKGCVRQPSDVLVPAWDPSVLFTPAGMNQFKDHFLGKVKLDFTRA
SYA_MYCCT       ----------LSTNQIRKIWLDFFISKNHYFLEPVSLIPVDDPSLLWINSGVATLKPYFDGRKTPPSPRL
SYA_UREPA       ----------LSTNEIRKKWIEFFESKDHLFIEPKSLIPKNDPTLLWINSGVSTLKDYFSGKVKPPHKRL
SYA_UREP2       ----------LSTNEIRKKWIEFFESKDHLFIEPKSLIPKNDPTLLWINSGVSTLKDYFSGKVKPPHKRL
SYA_DICDI       ----------MDVNQIRKTFIDFFREKEHTFVPSSAVIPHDDPTLLFANAGMNQFKPIFLGSEQAKLKRA
SYA_ONYPE       --------------EIRQMWLKFFASKNHHIAKSSSLIPRNEANLLWVNAGITPLKKYFDGTQTPPFRRI
SYA_AYWBP       --------------EIRQMWIKFFASKNHHIEKSFSLIPRNEDNLLWVNAGITPLKKYFDGTQTPSFRRI
SYA_MYCAP       -------------TEIRQKWLDFFESKNHLVIESKSLIPVNDSSLLWINSGVATLKNYFSGKKVPPAFRL
SYA_ACIBL       ----------MTGSQVRRRFLDFFISKGHKEVHSSSLVPANDPTLLFTNAGMNQFKDVFLGVEKRDYNRA
SYA_BUCCC       ----------MKTDKIRAMFLQFFKEKNHKIFKSSSLIPKDDNSLLFTNAGMNQFXXXXXXXXXXNQLSI
SYA_MYCH7       ----------LSANKIRQLWIDFFREKNHFFIESKPLVPQNDDSLLWINSGVATLKDYFTGKKIPPSKRL
SYA_MYCH2       ----------LSANEIRQLWIDFFREKNHFFIESKPLVPQNDDSLLWINSGVATLKDYFTGKKIPPSKRL
SYAM_HUMAN      -------------------FLNFFRDRGHRLVPSASVRPRGDPSLLFVNAGMNQFKPIFLGTEMAGFRRV
SYA_MYCHJ       ----------LSANKIRQLWIDFFRERNHFFIESKPLVPQNDDSLLWINSGVATLKDYFTGKKIPPSKRL
SYA_MYCGA       -------------SQIRQIWLDFFXXXXXXXXXXXXLVPINDPSLLWINAGVATLKKYFSGEENPINPRL
SYAM_MOUSE      ---------------VRDAFLSFFRDRGHRLVPSATVRPRGDPSLLFVNAGMNQFKPIFLGTEMAGFRRV
SYA_MYCPE       ----------LTTNEIRKLWLDFFKSKNHTEVESKSLIPKNDDSLLWINSGVATLKTFFSGKENPPSKRL
SYA_MYCS5       ----------MNSKEIRKAWLDFFESKNHFIVPPKSLIPVNDNSLLWINSGVATLKDYFSGKKNPPSKRM
SYA_MYCGE       ---------NWTTDKVRQTWLDYFAKKDHLVLASKSLIPINDPSLLWINSGVATLKDYFSARKTPPSKRL
SYA_MYCPN       ---------------VRQTWLDYFTAKGHLALPSKSLIPVNDPSLLWINSGVATLKDYFSAKKTPPSKRL
SYA_MYCPU       --------------EIRQKWITFFESKNHLKLESKSLIPVDDPSLLWINSGVATLKDYFSGKKTPPSPRI
SYA_TREDE       ---------NITIDELRSKYIDFFKSKGHVEISGRSLIPENDPTVLFTTAGMHPLVPYLMGEPHPAGTRL
SYA_MYCMO       ----------MKSKEIRNKWLNFFESKGHLIIPSKSLIPIKDDSLLWINSGVATLKDFFSGKKIPPSKRL
SYA_TREPA       ----------IRADQLRSRYLAFFSQKAHVVISGKSLVPEHDPTVLFTTAGMHPLVPYLMGEPHPAGTRL
SYA_BORAP       ----------MTLDKLRKKYIDFFKSKKHFEIMGKSLVPENDPTVLFNTAGMQPLIPYLLGEVHPSGDML
SYA_BORGA       ----------MTLDKLRKKYIDFFKSKKHFEIMGKSLVPENDPTVLFNTAGMQPLIPYLLGEVHPSGDML
SYA_BORHD       ----------MKLDELRKKYIDFFKSKGHCEIAGKSLIPDNDSTVLFNTAGMQPLVPYLLGEMHPSGDML
SYA2_CLOPH      ----------MTANELRKMYVDYFKERGHQEIASASLLPENDPTVLFTTAGMHPLVPYLLGENHPKGTRL
SYA_RHILV       ------------VNDIRSTFLDYFKKNGHEIVPSSPLVPRNDPTLMFTNAGMVQFKNVFTGLEKRSYSTA
SYA_BORBU       ----------MTLNKLRKKYIDFFKSKKHFEIMGKSLVPENDPTVLFNTAGMQPLIPYLLGEVHPSGDML
SYA_THEPD       ------------LSATRKMFIDFFEKRNHTPVKRYPVVARWREDVYLVGASIYDFQPVTEGLVPPPANPL
SYA_METAC       ------------ISEMREYYLSFFEARGHTRLDRYPVVARWRDDIYLTIASIADFQPVTSGQVPPPANPL
SYA_METMA       ------------ISEMREYYLSFFEARGHTRINRYPVVARWRDDIYLTIASIADFQPVTSGQVPPPANPL
SYA_METBF       ------------ISQMREYYLSFFEEKGHTRINRYPVVARWRDDLYLTIASIADFQPVTSGQVPPPANPL
SYA_METJA       ------KPYTYK--EMVKEFINFFKEHGHEPIKRAPVTARRDDILLTIASIAVFQPWITKGIVKPKANPL
SYA_PYRAR       ----------------------------------------------------------------------
SYA_METS3       --------------EIQQVFREFLEKEGHTPIKRYPILAKRDDVFLVGASIFCFQPWVTSGMVKPPANPL
SYA_IGNH4       -------PTKVKLSDAKREFIKFFEEKGHVPVEPRPVVARWRDDLFLTIASIVVFQPVTKGLVPPPANPL
SYA_SULIM       -----IKSQPLTVKEAREKFLSFFEKRGHTRISPKPVLARWRDDLYLTIASIVDFQPVTSGLVPPPANPL
SYA_SULIK       -----IKSQPLTVKEAREKFLSFFEKRGHTRISPKPVLARWRDDLYLTIASIVDFQPVTSGLVPPPANPL
SYA_SULSO       -----IKSQPLTVKEAREKFLSFFEKRGHTRIPPKPVLARWREDLYLTIASIVDFQPVTSGLVPPPANPL
SYA_CALMQ       -PPGTYRPESIK--DVRERFLSFFEKRGHTRVARYPVVARWRNDVYLVGASIYDFQPVTEGVVPPPANPL
SYA_METMP       -------------NEMVKEFTNFFDEKGHTPVKRSPVVAKRDDILLTIASIAVFQPWVTSGLVKPVKNPL
SYA_METTH       --------------EIQDKFMEFFAERGHEPIRRYPVLAKRRDDVFLVGASIYNFQPVTSGLVKPPANPL
SYA_METM6       -------------NEMVKEFTNFFAEKGHSPVKRSPVVAKRDDILLTIASIAVFQPWVTNGLVKPVKNPL
SYA_METM5       -------------NEMVKEFTNFFAEKGHSPVKRSPVVAKRDDILLTIASIAVFQPWVTSGLVKPVKNPL
SYA_METLZ       ------------LTEMREAYLSFFERHGHTRINRYPVAARWRDDIYLTIASIADFQPVTSGVCPPPANPL
SYA_METM7       ------------------EFTNFFAEKGHSPVKRSPVVAKRDDILLTIASIAVFQPWVTNGLVKPVKNPL
SYA_METST       ----------------------------------------------------------------------
SYA_SULIA       -----IKSQPLTVKEAREKFLSFFEKRGHTRISPKPVLARWREDLYLTIASIVDFQPVTSGLVPPPANPL
SYA_HALLT       -------PEAYSLSEMREAFLSFFEEHGHERIDPYP-VAANRDDVLLTQASIYDFQPVTSGQTPPPANPL
SYA_SULIY       -----IKSQPLTVKEAREKFLSFFEKRGHTRISPKPVLARWREDLYLTIASIVDFQPVTSGLVPPPANPL
SYA_SULIN       -----IKSQPLTVKEAREKFLSFFEKRGHTRISPKPVLARWREDLYLTIASIVDFQPVTSGLVPPPTNPL
SYA_SULIL       -----IKSQPLTVKEAREKFLSFFEKRGHTRISPKPVLARWREDLYLTIASIVDFQPVTSGLVPPPANPL
SYA_PYRCJ       --------------DVRERFLSFFERHGHARIKRYPVVARWRDDVYLVGASIYDFQPVTSGAVPPPANPL
SYA_ARCFU       -----------ELDEMREYYLNFFERRGHGRIERYPVVARWRTDIYLTIASIADFQPVTSGVAPPPANPL
SYA_HALWD       ------------LSGMREEFLSFFESRDHDRIEPYP-VAANRDDVLLTQASIYDFQPVTSGQTPPPANPL
SYA_METTP       ----------MELDSMREHYLSFFEAHGHTRVQRYPVVARWRDDIYLTIASIADFQPVTSGQVPPPANPL
SYA_HALMA       ------------LTEMREAFLSFFEDRDHERIDPYP-VAANRDDVLLTQASIYDFQPVTSGTTPPPANPL
SYA_PYRIL       ----------------------------------------------------------------------
SYA_PYRAE       ----------------------------------------------------------------------
SYA_THENV       ----------------------------------------------------------------------
SYA_METBU       ----------LELPDMREFYLNFFEEQGHTRIERYPVIARWRDDIYLTIASIADFQPVTSGQVPPPANPL
SYA_KORCO       ---------NKSLEEVREDFLRFFERRGHTRINRYPVIARWREDLFLTSASIVDFQPITAGIVPPPANPL
SYA_METVS       -------------NEMVKEFTNFFDERGHSPVKRSPVIAKRDDILLTIASIAVFQPWVTNGLVKPVKNPL
SYA_SULAC       ----KIKSPPLTVRESREKFLRFFEKRGHTIVPPKPVVAKWRDDLYLTIASIVDFQPVTSGLAKPPANPL
SYA_META3       -------------NEMVKEFLNFFDKNGHTPIKRYPVSARRDDILLTIASIAVFQPWVTKGIVKPVANPL
SYA_AERPE       ----------MSVGEAREAFLSFFEKHGHTXXXXXXXXXXWREDLYLTIASIVVFQPVTSGLVPPPANPL
SYA_SULTO       ----------LTVREARQKFLKFFEKKGHTIIPPKPVLARWREDLYLTIASIVDFQPVTSGIVPPPANPL
SYA_METHJ       ------------VDEMREAYLSFFEKQGHTRIDRYPVAARWRDDIYLTIASIADFQPVTSGVVPPPANPL
SYA_NATPD       ------------LEEMREAFLSFFEDHDHERIEPYP-VAANRDDVLLTQASIYDFQPVTSGETPPPANPL
SYA_HALSA       ------------LTEMRSAMVSYFERAGHDSIDPYP-VAANRDDVLLTQASIYDFQPVTSGASPPPANPL
SYA_HALS3       ------------LTEMRSAMVSYFERAGHDSIDPYP-VAANRDDVLLTQASIYDFQPVTSGASPPPANPL
SYA_PYRKO       -------PKKYTLDEMREKFLSFFESYPHGRVKRYPVLPRWRDDVLLVGASIMDFQPVISGEADPPANPL
SYA_METB6       -------PHT--VDEMREAFLSFFEKNGHTRIERYPVAARWRDDIYLTIASIADFQPVTAGVVPPPANPL
SYA_METKA       ----------------------------------------------------------------------
SYA_HYPBU       ------RVRGLSVRDARRKFIEFFKRHGHEYVEPRPVVARWREDLYLTIASIVAFQPVTSGIVPPPANPL
SYA_CENSY       ---------------------EYFVKNGHESVPRYPVVCRWRDDLYFTIASIVDFQRV-MGSSEFPANPL
SYA_METS5       ---------NWSVSEARRRFLDFFRRNGHEIIPPKPVLARWREDLYLTIASIVDFQPITSGISPPPANPL
SYA_PYRHO       -------PRKYTLDEMREKFLRFFEKHEHGRVKRYPVLPRWRDDVLLVGASIMDFQPVISGEADPPANPL
SYA_STAMF       --------------EARRKFIEFFTSHGHGYVDPYPVLARWRNDLYLTIASIIVFQPVTEGIVDPPYNPL
SYA_PYRAB       -------PKKYTLDEMREKFLKFFEKHEHGRVKRYPVLPRWRDDVLLVGASIMDFQPVISGEADPPANPL
SYA_PYRFU       -------PKKYTLDEMREKFLSFFEKHEHGRVKRYPVLPRWRDDVLLVGASIMDFQPVISGEADPPANPL
SYA_THEVO       -------PKKYTLSEMRKAFFDFFEKRGHKLLEPYPVVPRWREDVLLVNASIYDFQPVTSGIVKPPGNPI
SYA_METMJ       ------KPHN--VSEMREAFLSFFERHGHTRLERYPVAARWRDDIYLTIASIADFQPVTSGVVPPPANPL
SYA_UNCMA       -------------------YVKTFEQWGYVPLERYPTVCRWYEDLYFVAAGINDFQPYVVSGEIEPPARA
SYA_THEAC       -------PKSYSLSEMRDAFIKFFEKRGHKFLKPYPVVPRWREDVLLVNASIYDFQPVTSGIVRPPGNPI
SYA_PICTO       ------------VDEMRDEFIKFFENDSHKFVEPYPVVPRWRDDVLLVNASIYDFQQVTSGLAKPPGNPI
SYA_NITMS       ---------------------EFFVKNNHTSVSRYPVVCRWRDDLYFTIASVVDFQRV-MGSKEFPANPL
SYT_BURS3       ----------------------------------------------------------------------
SYT_BURCJ       ----------------------------------------------------------------------
SYT_BURCC       ----------------------------------------------------------------------
SYT_BURCM       ----------------------------------------------------------------------
SYT_BURA4       ----------------------------------------------------------------------
SYT_BURVG       ----------------------------------------------------------------------
SYT_BURPP       ----------------------------------------------------------------------
SYT_BURPS       ----------------------------------------------------------------------
SYT_BURP6       ----------------------------------------------------------------------
SYT_BURP1       ----------------------------------------------------------------------
SYT_BURP0       ----------------------------------------------------------------------
SYT_BURMS       ----------------------------------------------------------------------
SYT_BURMA       ----------------------------------------------------------------------
SYT_BURM9       ----------------------------------------------------------------------
SYT_BURM7       ----------------------------------------------------------------------
SYT_BURP8       ----------------------------------------------------------------------
SYT_POLSJ       ----------------------------------------------------------------------
SYT_BURXL       ----------------------------------------------------------------------
SYT_BURTA       ----------------------------------------------------------------------
SYT_POLNA       ----------------------------------------------------------------------
SYT_POLSQ       ----------------------------------------------------------------------
SYT_DIAST       ----------------------------------------------------------------------
SYT_ACISJ       ----------------------------------------------------------------------
SYT_JANMA       ----------------------------------------------------------------------
SYT_DELAS       ----------------------------------------------------------------------
SYT_MAGSM       ----------------------------------------------------------------------
SYT_POLNS       ----------------------------------------------------------------------
SYT_HERAR       ----------------------------------------------------------------------
SYT_BURM1       ----------------------------------------------------------------------
SYT_LEPCP       ----------------------------------------------------------------------
SYT_METFK       ----------------------------------------------------------------------
SYT_RHILW       ----------------------------------------------------------------------
SYT_RHIEC       ----------------------------------------------------------------------
SYT_RHIE6       ----------------------------------------------------------------------
SYT_SINMW       ----------------------------------------------------------------------
SYT_DESMR       ----------------------------------------------------------------------
SYT_AZOSB       ----------------------------------------------------------------------
SYT_GRABC       ----------------------------------------------------------------------
SYT_AZOSE       ----------------------------------------------------------------------
SYT_TERTT       ----------------------------------------------------------------------
SYT_DESAD       ----------------------------------------------------------------------
SYT_RHIME       ----------------------------------------------------------------------
SYT_VEREI       ----------------------------------------------------------------------
SYT_MARAV       ----------------------------------------------------------------------
SYT_RHISN       ----------------------------------------------------------------------
SYT_PELPD       ----------------------------------------------------------------------
SYT_RALPJ       ----------------------------------------------------------------------
SYT_METPP       ----------------------------------------------------------------------
AASD1_RAT       ----------------------------------------------------------------------
AASD1_MOUSE     ----------------------------------------------------------------------
SYT_RHORT       ----------------------------------------------------------------------
SYT_LISW6       ----------------------------------------------------------------------
SYT_LISMO       ----------------------------------------------------------------------
SYT_LISMH       ----------------------------------------------------------------------
SYT_LISMF       ----------------------------------------------------------------------
SYT_LISMC       ----------------------------------------------------------------------
SYT_LISIN       ----------------------------------------------------------------------
AASDB_XENLA     ----------------------------------------------------------------------
AASDA_XENLA     ----------------------------------------------------------------------
SYT_RALEH       ----------------------------------------------------------------------
SYT_METCA       ----------------------------------------------------------------------
SYT_AGRT5       ----------------------------------------------------------------------
SYT_SACD2       ----------------------------------------------------------------------
SYT_RHILO       ----------------------------------------------------------------------
SYT_RHIL3       ----------------------------------------------------------------------
SYT_HAHCH       ----------------------------------------------------------------------
AASD1_HUMAN     ----------------------------------------------------------------------
SYT_RALSO       ----------------------------------------------------------------------
SYT_GLUOX       ----------------------------------------------------------------------
SYT_AGRRK       ----------------------------------------------------------------------
SYT_ACIF5       ----------------------------------------------------------------------
SYT_ACIF2       ----------------------------------------------------------------------
SYT_RHOCS       ----------------------------------------------------------------------
SYT_LARHH       ----------------------------------------------------------------------
SYT_DESDG       ----------------------------------------------------------------------
SYT_ACICJ       ----------------------------------------------------------------------
SYT_NITMU       ----------------------------------------------------------------------
SYT_GEOSL       ----------------------------------------------------------------------
SYT_CHRVO       ----------------------------------------------------------------------
SYT_BORPD       ----------------------------------------------------------------------
AASD1_DANRE     ----------------------------------------------------------------------
SYT_DEHSC       ----------------------------------------------------------------------
SYT_DEHSB       ----------------------------------------------------------------------
SYT_DEHE1       ----------------------------------------------------------------------
SYT_DECAR       ----------------------------------------------------------------------
SYT_COXBU       ----------------------------------------------------------------------
AASD1_BOVIN     ----------------------------------------------------------------------
SYT_RALEJ       ----------------------------------------------------------------------
SYT_CUPTR       ----------------------------------------------------------------------
SYT_ALHEH       ----------------------------------------------------------------------
SYT_STRR6       ----------------------------------------------------------------------
SYT_STRP2       ----------------------------------------------------------------------
SYT_FRATN       ----------------------------------------------------------------------
SYT_THEVO       ----------------------------------------------------------------------
SYT_PELUB       ----------------------------------------------------------------------
SYT_NITEC       ----------------------------------------------------------------------
SYT_DESVM       ----------------------------------------------------------------------
SYT_SYMTH       ----------------------------------------------------------------------
SYT_MESSB       ----------------------------------------------------------------------
SYT_ANASK       ----------------------------------------------------------------------
SYT_ANADE       ----------------------------------------------------------------------
SYT_ANAD2       ----------------------------------------------------------------------
SYT_TREPS       ----------------------------------------------------------------------
SYT_TREPA       ----------------------------------------------------------------------
SYT_FRATO       ----------------------------------------------------------------------
SYT_FRAP2       ----------------------------------------------------------------------
SYT_BORPE       ----------------------------------------------------------------------
SYT_BORPA       ----------------------------------------------------------------------
SYT_BORBR       ----------------------------------------------------------------------
SYT_THISH       ----------------------------------------------------------------------
SYT_FRATW       ----------------------------------------------------------------------
SYT_FRATM       ----------------------------------------------------------------------
SYT_FRATH       ----------------------------------------------------------------------
SYT_FRATF       ----------------------------------------------------------------------
SYT_FUSNN       ----------------------------------------------------------------------
SYT_FRATT       ----------------------------------------------------------------------
SYT_FRAT1       ----------------------------------------------------------------------
SYT_BORA1       ----------------------------------------------------------------------
SYT_HYPNA       ----------------------------------------------------------------------
SYT_GEOBB       ----------------------------------------------------------------------
SYT_GEOSM       ----------------------------------------------------------------------
SYT_BDEBA       ----------------------------------------------------------------------
SYT_AGRVS       ----------------------------------------------------------------------
SYT_WOLWR       ----------------------------------------------------------------------
SYT_THIDA       ----------------------------------------------------------------------
SYT_PELCD       ----------------------------------------------------------------------
SYT_ENTFA       ----------------------------------------------------------------------
SYT_BRUSU       ----------------------------------------------------------------------
SYT_BRUSI       ----------------------------------------------------------------------
SYT_BRUME       ----------------------------------------------------------------------
SYT_BRUMB       ----------------------------------------------------------------------
SYT_BRUC2       ----------------------------------------------------------------------
SYT_BRUAB       ----------------------------------------------------------------------
SYT_BRUA2       ----------------------------------------------------------------------
SYT_BRUA1       ----------------------------------------------------------------------
SYT_STAAW       ----------------------------------------------------------------------
SYT_STAAT       ----------------------------------------------------------------------
SYT_STAAS       ----------------------------------------------------------------------
SYT_STAAR       ----------------------------------------------------------------------
SYT_STAAN       ----------------------------------------------------------------------
SYT_STAAM       ----------------------------------------------------------------------
SYT_STAAE       ----------------------------------------------------------------------
SYT_STAAC       ----------------------------------------------------------------------
SYT_STAAB       ----------------------------------------------------------------------
SYT_STAA9       ----------------------------------------------------------------------
SYT_STAA3       ----------------------------------------------------------------------
SYT_STAA2       ----------------------------------------------------------------------
SYT_STAA1       ----------------------------------------------------------------------
SYT_GLUDA       ----------------------------------------------------------------------
SYT_DESVV       ----------------------------------------------------------------------
SYT_DESVH       ----------------------------------------------------------------------
SYT_DESRM       ----------------------------------------------------------------------
SYT_RHOPA       ----------------------------------------------------------------------
SYT_LEGPC       ----------------------------------------------------------------------
SYT_STRZT       ----------------------------------------------------------------------
SYT_STRZP       ----------------------------------------------------------------------
SYT_STRZJ       ----------------------------------------------------------------------
SYT_STRPN       ----------------------------------------------------------------------
SYT_STRPJ       ----------------------------------------------------------------------
SYT_STRPI       ----------------------------------------------------------------------
SYT_STRP7       ----------------------------------------------------------------------
SYT_STRP4       ----------------------------------------------------------------------
SYT_STRMU       ----------------------------------------------------------------------
SYT_STRGC       ----------------------------------------------------------------------
SYT_LEGPA       ----------------------------------------------------------------------
SYT_STRTD       ----------------------------------------------------------------------
SYT_STRT2       ----------------------------------------------------------------------
SYT_STRT1       ----------------------------------------------------------------------
SYT_STACT       ----------------------------------------------------------------------
SYT_RUBXD       ----------------------------------------------------------------------
SYT_LEGPH       ----------------------------------------------------------------------
SYT_STAS1       ----------------------------------------------------------------------
SYT_STAA8       ----------------------------------------------------------------------
SYT_NITEU       ----------------------------------------------------------------------
SYT_HALHL       ----------------------------------------------------------------------
SYT_THELT       ----------------------------------------------------------------------
SYT_MARMM       ----------------------------------------------------------------------
SYT_LEGPL       ----------------------------------------------------------------------
SYT_GEOKA       ----------------------------------------------------------------------
SYT_BIFLI       ----------------------------------------------------------------------
SYT_THENN       ----------------------------------------------------------------------
SYT_STRSV       ----------------------------------------------------------------------
SYT_STRA5       ----------------------------------------------------------------------
SYT_STRA1       ----------------------------------------------------------------------
SYT_LEPIN       ----------------------------------------------------------------------
SYT_LEPIC       ----------------------------------------------------------------------
SYT_BARBK       ----------------------------------------------------------------------
SYT_ACHLI       ----------------------------------------------------------------------
SYT1_BACSU      ----------------------------------------------------------------------
CH601_CHLAA     ----------------------------------------------------------------------
SYT_STRA3       ----------------------------------------------------------------------
SYT_ACIAC       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKVYQLPADKLWVTVYA
SYA_RALME       TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKVYQLPADKLWVTVYA
SYA_RALEJ       TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKVYQLPAEKLWVTVYA
SYA_RALEH       TSAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAILYAWELLTKTYQLPAEKLWVTVYA
SYA_BURPP       TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTGVYQLPKDKLWVTVYH
SYA_BURXL       TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTGVYQLPKDKLWVTVYH
SYA_BURP8       TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWELLTGVYQLPKEKLWVTVYQ
SYA_BURM1       TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKHDAIRFAWELLTTVYMLPKDKLWVTVYQ
SYA_BURVG       TTAQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFS