[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07787.1

[Show Plain Result]


## Summary of Sequence Search
    1::236
    1::91      6e-10  36%  215 aa  ACRR_SHIFL RecName: Full=HTH-type transcriptional regulator
    1::91      6e-10  36%  215 aa  ACRR_ECOLI RecName: Full=HTH-type transcriptional regulator
    1::91      6e-10  36%  215 aa  ACRR_ECOL6 RecName: Full=HTH-type transcriptional regulator
    6::164     6e-08  27%  196 aa  UIDR_SHIFL RecName: Full=HTH-type transcriptional regulator
    6::164     6e-08  27%  196 aa  UIDR_ECOLI RecName: Full=HTH-type transcriptional regulator
    6::164     6e-08  27%  196 aa  UIDR_ECOL6 RecName: Full=HTH-type transcriptional regulator
    6::164     6e-08  27%  196 aa  UIDR_ECO57 RecName: Full=HTH-type transcriptional regulator
   10::135     4e-07  27%  210 aa  MTRR_NEIGO RecName: Full=HTH-type transcriptional regulator mtrR;
    1::71      5e-07  30%  134 aa  TTGW_PSEPU RecName: Full=Uncharacterized HTH-type transcriptional
    9::110     8e-07  31%  210 aa  TETR7_VIBAN RecName: Full=Tetracycline repressor protein class G;
   26::74      2e-06  39%  226 aa  TCMR_STRGA RecName: Full=HTH-type transcriptional regulator
    3::75      3e-06  33%  218 aa  TETR8_PASPI RecName: Full=Tetracycline repressor protein class H;
    3::75      3e-06  33%  218 aa  TETR4_SALOR RecName: Full=Tetracycline repressor protein class D;
    3::75      3e-06  33%  218 aa  TETR4_ECOLX RecName: Full=Tetracycline repressor protein class D;
    6::61      4e-06  34%  185 aa  Y2897_STAA8 RecName: Full=HTH-type transcriptional regulator
    6::61      4e-06  34%  185 aa  Y2658_STAAR RecName: Full=HTH-type transcriptional regulator
    6::61      4e-06  34%  185 aa  Y2593_STAAC RecName: Full=HTH-type transcriptional regulator
    6::61      4e-06  34%  185 aa  Y2578_STAAM RecName: Full=HTH-type transcriptional regulator
    6::61      4e-06  34%  185 aa  Y2515_STAA3 RecName: Full=HTH-type transcriptional regulator
    6::61      4e-06  34%  185 aa  Y2498_STAAW RecName: Full=HTH-type transcriptional regulator
    6::61      4e-06  34%  185 aa  Y2464_STAAS RecName: Full=HTH-type transcriptional regulator
    9::72      4e-06  38%  185 aa  Y2452_STAAB RecName: Full=HTH-type transcriptional regulator
    6::61      4e-06  34%  185 aa  Y2364_STAAN RecName: Full=HTH-type transcriptional regulator
    2::47      4e-06  37%  185 aa  ICAR_STAEQ RecName: Full=Biofilm operon icaABCD HTH-type negative
    2::47      4e-06  37%  185 aa  ICAR_STAEP RecName: Full=Biofilm operon icaABCD HTH-type negative
    6::111     5e-06  27%  207 aa  TETR8_PASMU RecName: Full=Tetracycline repressor protein class H;
    1::65      5e-06  26%  220 aa  ENVR_ECOLI RecName: Full=Probable acrEF/envCD operon repressor;
    1::65      5e-06  26%  220 aa  ENVR_ECO57 RecName: Full=Probable acrEF/envCD operon repressor;
    2::47      1e-05  39%  186 aa  ICAR_STAAW RecName: Full=Biofilm operon icaABCD HTH-type negative
    2::47      1e-05  39%  186 aa  ICAR_STAAS RecName: Full=Biofilm operon icaABCD HTH-type negative
    2::47      1e-05  39%  186 aa  ICAR_STAAR RecName: Full=Biofilm operon icaABCD HTH-type negative
    2::47      1e-05  39%  186 aa  ICAR_STAAN RecName: Full=Biofilm operon icaABCD HTH-type negative
    2::47      1e-05  39%  186 aa  ICAR_STAAM RecName: Full=Biofilm operon icaABCD HTH-type negative
    2::47      1e-05  39%  186 aa  ICAR_STAAE RecName: Full=Biofilm operon icaABCD HTH-type negative
    2::47      1e-05  39%  186 aa  ICAR_STAAC RecName: Full=Biofilm operon icaABCD HTH-type negative
    2::47      1e-05  39%  186 aa  ICAR_STAA8 RecName: Full=Biofilm operon icaABCD HTH-type negative
   10::136     2e-05  29%  210 aa  TTGR_PSEPK RecName: Full=Probable HTH-type transcriptional
   10::71      2e-05  32%  194 aa  BSCR_BACSU RecName: Full=HTH-type transcriptional repressor bscR;
   10::136     2e-05  29%  210 aa  ARPR_PSEPU RecName: Full=Probable HTH-type transcriptional
    4::46      2e-05  47%  188 aa  QACR_STAHA RecName: Full=HTH-type transcriptional regulator qacR;
    4::46      2e-05  47%  188 aa  QACR_STAAU RecName: Full=HTH-type transcriptional regulator qacR;
    4::46      2e-05  47%  188 aa  QACR_STAAM RecName: Full=HTH-type transcriptional regulator qacR;
   11::64      2e-05  35%  192 aa  BM3R1_BACME RecName: Full=HTH-type transcriptional repressor
   10::160     3e-05  29%  210 aa  TTGR_PSEPU RecName: Full=HTH-type transcriptional regulator
    6::55      3e-05  30%  219 aa  TETR3_ECOLX RecName: Full=Tetracycline repressor protein class C;
    9::180     4e-05  22%  191 aa  YHGD_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    6::78      4e-05  26%  196 aa  Y6555_BACAN RecName: Full=Uncharacterized HTH-type
    3::75      4e-05  29%  207 aa  TETR2_ECOLX RecName: Full=Tetracycline repressor protein class B
    1::71      4e-05  27%  213 aa  SRPR_PSEPU RecName: Full=HTH-type transcriptional regulator
    3::55      8e-05  30%  211 aa  TETR5_ECOLX RecName: Full=Tetracycline repressor protein class E;
   10::136     1e-04  28%  210 aa  MEPR_PSEPU RecName: Full=Probable HTH-type transcriptional
    2::54      1e-04  32%  189 aa  YVKB_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    9::48      1e-04  40%  216 aa  TETR1_ECOLX RecName: Full=Tetracycline repressor protein class A
    5::68      2e-04  22%  207 aa  YTTP_BACSU RecName: Full=Probable HTH-type transcriptional
    2::76      2e-04  28%  198 aa  SLMA_SHIFL RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SHIF8 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SHIB3 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALTY RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALTI RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALSV RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALPK RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALPC RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALPB RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALPA RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALNS RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALHS RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALG2 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALEP RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALDC RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALCH RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALAR RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_SALA4 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_KLEP7 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_KLEP3 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ESCF3 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ENT38 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECOSM RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECOSE RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECOLU RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECOLI RecName: Full=HTH-type protein slmA;AltName:
    2::76      2e-04  28%  198 aa  SLMA_ECOLC RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECOL6 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECOL5 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECOHS RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECODH RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECOBW RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECO8A RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECO81 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECO7I RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECO5E RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECO57 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECO55 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECO45 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECO27 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_ECO24 RecName: Full=HTH-type protein slmA;
    2::76      2e-04  28%  198 aa  SLMA_CITK8 RecName: Full=HTH-type protein slmA;
    5::53      3e-04  37%  289 aa  YERO_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    4::73      3e-04  33%  276 aa  AFRP_STRGR RecName: Full=A-factor receptor protein;AltName:
   10::58      4e-04  31%  194 aa  FADR_BACSU RecName: Full=Fatty acid metabolism regulator protein;
    2::84      9e-04  28%  198 aa  SLMA_ENTS8 RecName: Full=HTH-type protein slmA;
   11::69      9e-04  24%  196 aa  BETI_STRM5 RecName: Full=HTH-type transcriptional regulator betI;
    3::72      9e-04  29%  198 aa  BETI_BRUC2 RecName: Full=HTH-type transcriptional regulator betI;
    8::74      9e-04  28%  198 aa  BETI_BRUAB RecName: Full=HTH-type transcriptional regulator betI;
    8::74      9e-04  28%  198 aa  BETI_BRUA2 RecName: Full=HTH-type transcriptional regulator betI;
    1::236

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEAKPQAGPRRTRDRILDVSLRLFNELGEPNVTTTTIAEAMEISPGNLYYHFRNKDDIINSIFVRFEQEM
ACRR_SHIFL      MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWELSESEL
ACRR_ECOLI      MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWELSESEL
ACRR_ECOL6      MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTRGAIYWHFKDKSDLFSEIWELSESEL
UIDR_SHIFL      -----QTEAQPTRTRILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQAIILQDQERA
UIDR_ECOLI      -----QTEAQPTRTRILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQAIILQDQERA
UIDR_ECOL6      -----QTEAQPTRTRILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQAIILQDQERA
UIDR_ECO57      -----QTEAQPTRTRILNAAREIFSENGFHSASMKAICKSCAISPGTLYHHFISKEALIQAIILQDQERA
MTRR_NEIGO      ----------KTKEHLMLAALETFYRKGIARTSLNEIAQAAGVTRGALYWHFKNKEDLFDALFQRICDDI
TTGW_PSEPU      MARKTAAEAKETRQRIIDAALEVFVAQGVPDATLDQIARKAGVTRGAVYWHFNGKLEVLQAVLASRQHPL
TETR7_VIBAN     ---------------VIAAGLELLNEVGMDSLTTRKLAERLKVQQPALYWHFQNKRALLDALPEAMLRER
TCMR_STRGA      ---------RRTRDQLIREALELFLAQGYEHTTVEQIAEAVEVHPRTFFRHFASKEEV------------
TETR8_PASPI     ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
TETR4_SALOR     ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
TETR4_ECOLX     ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEI----
Y2897_STAA8     ---------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQR-----
Y2658_STAAR     ---------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQR-----
Y2593_STAAC     ---------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQR-----
Y2578_STAAM     ---------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQR-----
Y2515_STAA3     ---------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQR-----
Y2498_STAAW     ---------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQR-----
Y2464_STAAS     ---------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQR-----
Y2452_STAAB     ------------RQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLLNTFITQFKQ--
Y2364_STAAN     ---------KENRQRIEEIAHKLFDEEGVENISMNRIAKELGIGMGTLYRHFKDKSDLCYYVIQR-----
ICAR_STAEQ      ------------KDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEI------------
ICAR_STAEP      ------------KDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEI------------
TETR8_PASMU     ------------KEQVIDDALILLNEVGIEGLTTRNVAQKIGVEQPTLYWHVKNKRALLDAL-------A
ENVR_ECOLI      MAKRTKAEALKTRQELIETAIAQFAQHGVSKTTLNDIADAANVTRGAIYWHFENKTQLFNEMWLQ-----
ENVR_ECO57      MAKRTKAEALKTRQELIETAIAQFAQHGVSKTTLNDIADAANVTRGAIYWHFENKTQLFNEMWLQ-----
ICAR_STAAW      ------------KDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSI------------
ICAR_STAAS      ------------KDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSI------------
ICAR_STAAR      ------------KDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSI------------
ICAR_STAAN      ------------KDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSI------------
ICAR_STAAM      ------------KDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSI------------
ICAR_STAAE      ------------KDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSI------------
ICAR_STAAC      ------------KDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSI------------
ICAR_STAA8      ------------KDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSI------------
TTGR_PSEPK      ---------QETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELV--------QAL
BSCR_BACSU      -------------DMIMKASVSLFTERGFDATTIPMIAERAHVGTGTIYRYFDSKETLVNVLFQESIQRF
ARPR_PSEPU      ---------QETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELV--------QAL
QACR_STAHA      ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
QACR_STAAU      ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
QACR_STAAM      ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTK---------------
BM3R1_BACME     ---------------IFSASLLLFAERGFDATTMPMIAENAKVGAGTIYRYFKNKESLVNELFQQHVNE-
TTGR_PSEPU      ---------QETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQALLDSLHETH
TETR3_ECOLX     ------------REAVIRTALELLNDVGMEGLTTRRLAERLGVQQPALYWHFKNKRALLDAL--------
YHGD_BACSU      ---------------ILEAATKSFTQFGYKATTMDLVAKLANVGKGTIYTFFKNKEELFDEIFTTLLKEM
Y6555_BACAN     ----------KVKEKIIETSLYLFNTNGITRTSIQDIMTATELPKGSIYRRFKNKEEIVLAAYDKSGEIM
TETR2_ECOLX     ---------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAIEM----
SRPR_PSEPU      MARKTXXXXXXTRQRIIDAALEVFVAQGVSDATLDQIARKAGVTRGAVYWHFNGKLEVLQAVLASRQHPL
TETR5_ECOLX     ---------RLSLDDVISMALTLLDSEGLEGLTTRKLAQSLKIEQPTLYWHVRNKQTLMNML--------
MEPR_PSEPU      ---------QETPAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELV--------QAL
YVKB_BACSU      ---------RPTNKRILDAAMQLLVKKGYRATTTKEIAEKANVSEATIFRNFKNKQGLVEAL--------
TETR1_ECOLX     ---------------VIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHFRNK---------------
YTTP_BACSU      -----------TKDKIIESAVMLFNQKGFSGTSVREIAKSADVNVAHISYYFKGKGGLMEHLVSEFYEGY
SLMA_SHIFL      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SHIF8      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SHIB3      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALTY      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALTI      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALSV      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALPK      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALPC      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALPB      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALPA      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALNS      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALHS      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALG2      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALEP      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALDC      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALCH      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALAR      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_SALA4      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_KLEP7      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_KLEP3      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ESCF3      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ENT38      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECOSM      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECOSE      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECOLU      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECOLI      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECOLC      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECOL6      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECOL5      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECOHS      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECODH      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECOBW      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECO8A      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECO81      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECO7I      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECO5E      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECO57      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECO55      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECO45      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECO27      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_ECO24      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
SLMA_CITK8      --AEKQTAKRNRREEILQLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
YERO_BACSU      ------------KERIIKTSIRLFAKKGFAATTIQEIASECGISKGAFYLHFKSKEALLLS---------
AFRP_STRGR      -----QARAVQTWRSIVDAAASVFDDYGYERAAISEILRRAKVTKGALYFHFASKEAIAQAIMVEFEQE-
FADR_BACSU      --------------QIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLF-------
SLMA_ENTS8      --AEKQTAKRNRREEILQLAQMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSL
BETI_STRM5      ------------REQLIRATFQTIDEIGMADATVATIAKKAGLSSGIVAHYFGDKDGLLNAAMRQILREL
BETI_BRUC2      ---KIEMEPLRRRE-LIDAAIRTIGQRGSLDVTVAQIAHEAGVSPALAHHYFGGKDKLILATMRHLLREL
BETI_BRUAB      --------PLRRRE-LIDAAIRTIGQRGSLDVTVAQIAHEAGVSPALAHHYFGGKDKLILATMRHLLREL
BETI_BRUA2      --------PLRRRE-LIDAAIRTIGQRGSLDVTVAQIAHEAGVSPALAHHYFGGKDKLILATMRHLLREL


                         .         .         *         .         .         .         .:140
query           ERRLKMPEDHKATLGESWGYLQYMSEFLWNYRFLYRDINDLLARNRMLETNFKRIVDQKKRFALEICRQF
ACRR_SHIFL      EYQAKFPGDPLSVLRE------------------------------------------------------
ACRR_ECOLI      EYQAKFPGDPLSVLRE------------------------------------------------------
ACRR_ECOL6      EYQAKFPGDPLSVLRE------------------------------------------------------
UIDR_SHIFL      LARFREPI-------EGIHFVDYMVESIFGQRALVVEIMAEGMRNPQVAAMLKNKHMTITEFVAQRMRDA
UIDR_ECOLI      LARFREPI-------EGIHFVDYMVESIFGQRALVVEIMAEGMRNPQVAAMLKNKHMTITEFVAQRMRDA
UIDR_ECOL6      LARFREPI-------EGIHFVDYMVESIFGQRALVVEIMAEGMRNPQVAAMLKNKHMTITEFVAQRMRDA
UIDR_ECO57      LARFREPI-------EGIHFVDYMVESIFGQRALVVEIMAEGMRNPQVAAMLKNKHMTITEFVAQRMRDA
MTRR_NEIGO      ENCI--AQDAADAEGGSWTVLLHFFERLQSNDIHYKFHNILFLKCEHTEQNAAVIAIARKHQAI------
TTGW_PSEPU      E---------------------------------------------------------------------
TETR7_VIBAN     HTR-SLPEEN-----EDWRV--FLKENALSFRLSYRDGARIHAGTRPTEPNF------------------
TCMR_STRGA      ----------------------------------------------------------------------
TETR8_PASPI     ---LARHHDYSPAAGESW----------------------------------------------------
TETR4_SALOR     ---LARHHDYSPAAGESW----------------------------------------------------
TETR4_ECOLX     ---LARHHDYSPAAGESW----------------------------------------------------
Y2897_STAA8     ----------------------------------------------------------------------
Y2658_STAAR     ----------------------------------------------------------------------
Y2593_STAAC     ----------------------------------------------------------------------
Y2578_STAAM     ----------------------------------------------------------------------
Y2515_STAA3     ----------------------------------------------------------------------
Y2498_STAAW     ----------------------------------------------------------------------
Y2464_STAAS     ----------------------------------------------------------------------
Y2452_STAAB     ----------------------------------------------------------------------
Y2364_STAAN     ----------------------------------------------------------------------
ICAR_STAEQ      ----------------------------------------------------------------------
ICAR_STAEP      ----------------------------------------------------------------------
TETR8_PASMU     ETILQKHHHHVLPLNETWDFLRNNAKSFRQALLMYRDGGKIHAGTRPSESQFE-----------------
ENVR_ECOLI      ----------------------------------------------------------------------
ENVR_ECO57      ----------------------------------------------------------------------
ICAR_STAAW      ----------------------------------------------------------------------
ICAR_STAAS      ----------------------------------------------------------------------
ICAR_STAAR      ----------------------------------------------------------------------
ICAR_STAAN      ----------------------------------------------------------------------
ICAR_STAAM      ----------------------------------------------------------------------
ICAR_STAAE      ----------------------------------------------------------------------
ICAR_STAAC      ----------------------------------------------------------------------
ICAR_STAA8      ----------------------------------------------------------------------
TTGR_PSEPK      LDSLHETHDHLARASESEDELDPLG---CMRKLLLQVFNELVLDARTRRIN--EILHHKCEFTDDMCRQQ
BSCR_BACSU      TEKLK-----------------------------------------------------------------
ARPR_PSEPU      LDSLHETHDHLARASESEDELDPLG---CMRKLLLQVFNELVLDARTRRIN--EILHHKCEFTDDMCRQQ
QACR_STAHA      ----------------------------------------------------------------------
QACR_STAAU      ----------------------------------------------------------------------
QACR_STAAM      ----------------------------------------------------------------------
BM3R1_BACME     ----------------------------------------------------------------------
TTGR_PSEPU      DHRASESEDEVDPLGMRKLLLQVFNELVLDAR--TRRINEILHHDDMCEIRQQRVLDCHKGITLALARRG
TETR3_ECOLX     ----------------------------------------------------------------------
YHGD_BACSU      KQKADEAMEPSLPFHENVHRALFA---ILEFRKTHQLTIKIFQENAEIGTAVQEVIQKMERSILSYIKSK
Y6555_BACAN     WSHFHKAMENKKT---------------------------------------------------------
TETR2_ECOLX     ---LDRHHTHFCPLGESW----------------------------------------------------
SRPR_PSEPU      E---------------------------------------------------------------------
TETR5_ECOLX     ----------------------------------------------------------------------
MEPR_PSEPU      LDSLHETHDHLARASESEDELDPLG---CMRKLLLQVFNELVLDARTRRIN--EILHHKCEFTDDMCRQQ
YVKB_BACSU      ----------------------------------------------------------------------
TETR1_ECOLX     ----------------------------------------------------------------------
YTTP_BACSU      SKTLE-----------------------------------------------------------------
SLMA_SHIFL      ITRINL----------------------------------------------------------------
SLMA_SHIF8      ITRINL----------------------------------------------------------------
SLMA_SHIB3      ITRINL----------------------------------------------------------------
SLMA_SALTY      ITRINL----------------------------------------------------------------
SLMA_SALTI      ITRINL----------------------------------------------------------------
SLMA_SALSV      ITRINL----------------------------------------------------------------
SLMA_SALPK      ITRINL----------------------------------------------------------------
SLMA_SALPC      ITRINL----------------------------------------------------------------
SLMA_SALPB      ITRINL----------------------------------------------------------------
SLMA_SALPA      ITRINL----------------------------------------------------------------
SLMA_SALNS      ITRINL----------------------------------------------------------------
SLMA_SALHS      ITRINL----------------------------------------------------------------
SLMA_SALG2      ITRINL----------------------------------------------------------------
SLMA_SALEP      ITRINL----------------------------------------------------------------
SLMA_SALDC      ITRINL----------------------------------------------------------------
SLMA_SALCH      ITRINL----------------------------------------------------------------
SLMA_SALAR      ITRINL----------------------------------------------------------------
SLMA_SALA4      ITRINL----------------------------------------------------------------
SLMA_KLEP7      ITRINL----------------------------------------------------------------
SLMA_KLEP3      ITRINL----------------------------------------------------------------
SLMA_ESCF3      ITRINL----------------------------------------------------------------
SLMA_ENT38      ITRINL----------------------------------------------------------------
SLMA_ECOSM      ITRINL----------------------------------------------------------------
SLMA_ECOSE      ITRINL----------------------------------------------------------------
SLMA_ECOLU      ITRINL----------------------------------------------------------------
SLMA_ECOLI      ITRINL----------------------------------------------------------------
SLMA_ECOLC      ITRINL----------------------------------------------------------------
SLMA_ECOL6      ITRINL----------------------------------------------------------------
SLMA_ECOL5      ITRINL----------------------------------------------------------------
SLMA_ECOHS      ITRINL----------------------------------------------------------------
SLMA_ECODH      ITRINL----------------------------------------------------------------
SLMA_ECOBW      ITRINL----------------------------------------------------------------
SLMA_ECO8A      ITRINL----------------------------------------------------------------
SLMA_ECO81      ITRINL----------------------------------------------------------------
SLMA_ECO7I      ITRINL----------------------------------------------------------------
SLMA_ECO5E      ITRINL----------------------------------------------------------------
SLMA_ECO57      ITRINL----------------------------------------------------------------
SLMA_ECO55      ITRINL----------------------------------------------------------------
SLMA_ECO45      ITRINL----------------------------------------------------------------
SLMA_ECO27      ITRINL----------------------------------------------------------------
SLMA_ECO24      ITRINL----------------------------------------------------------------
SLMA_CITK8      ITRINL----------------------------------------------------------------
YERO_BACSU      ----------------------------------------------------------------------
AFRP_STRGR      ----------------------------------------------------------------------
FADR_BACSU      ----------------------------------------------------------------------
SLMA_ENTS8      ITRINLLKDEKET---------------------------------------------------------
BETI_STRM5      K---------------------------------------------------------------------
BETI_BRUC2      GRDL------------------------------------------------------------------
BETI_BRUAB      GRDLNV----------------------------------------------------------------
BETI_BRUA2      GRDLNV----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QEDGDMDATPEQVDAICTNIVVIATYWLSFQFVQHPRQYNDPEQIRGYLxxxxxxxxxxxxxxxxxxxxx
ACRR_SHIFL      ----------------------------------------------------------------------
ACRR_ECOLI      ----------------------------------------------------------------------
ACRR_ECOL6      ----------------------------------------------------------------------
UIDR_SHIFL      QQKGEI--SPDINTAMTSRLLLDLTY--------------------------------------------
UIDR_ECOLI      QQKGEI--SPDINTAMTSRLLLDLTY--------------------------------------------
UIDR_ECOL6      QQKGEI--SPDINTAMTSRLLLDLTY--------------------------------------------
UIDR_ECO57      QQKGEI--SPDINTAMTSRLLLDLTY--------------------------------------------
MTRR_NEIGO      ----------------------------------------------------------------------
TTGW_PSEPU      ----------------------------------------------------------------------
TETR7_VIBAN     ----------------------------------------------------------------------
TCMR_STRGA      ----------------------------------------------------------------------
TETR8_PASPI     ----------------------------------------------------------------------
TETR4_SALOR     ----------------------------------------------------------------------
TETR4_ECOLX     ----------------------------------------------------------------------
Y2897_STAA8     ----------------------------------------------------------------------
Y2658_STAAR     ----------------------------------------------------------------------
Y2593_STAAC     ----------------------------------------------------------------------
Y2578_STAAM     ----------------------------------------------------------------------
Y2515_STAA3     ----------------------------------------------------------------------
Y2498_STAAW     ----------------------------------------------------------------------
Y2464_STAAS     ----------------------------------------------------------------------
Y2452_STAAB     ----------------------------------------------------------------------
Y2364_STAAN     ----------------------------------------------------------------------
ICAR_STAEQ      ----------------------------------------------------------------------
ICAR_STAEP      ----------------------------------------------------------------------
TETR8_PASMU     ----------------------------------------------------------------------
ENVR_ECOLI      ----------------------------------------------------------------------
ENVR_ECO57      ----------------------------------------------------------------------
ICAR_STAAW      ----------------------------------------------------------------------
ICAR_STAAS      ----------------------------------------------------------------------
ICAR_STAAR      ----------------------------------------------------------------------
ICAR_STAAN      ----------------------------------------------------------------------
ICAR_STAAM      ----------------------------------------------------------------------
ICAR_STAAE      ----------------------------------------------------------------------
ICAR_STAAC      ----------------------------------------------------------------------
ICAR_STAA8      ----------------------------------------------------------------------
TTGR_PSEPK      RQSAVLD---------------------------------------------------------------
BSCR_BACSU      ----------------------------------------------------------------------
ARPR_PSEPU      RQSAVLD---------------------------------------------------------------
QACR_STAHA      ----------------------------------------------------------------------
QACR_STAAU      ----------------------------------------------------------------------
QACR_STAAM      ----------------------------------------------------------------------
BM3R1_BACME     ----------------------------------------------------------------------
TTGR_PSEPU      QLPGELDA--------------------------------------------------------------
TETR3_ECOLX     ----------------------------------------------------------------------
YHGD_BACSU      IEDGIKSGAIKPCDPELTAFVMLKLYALIFDWKQHPPL--DKETIAGLL---------------------
Y6555_BACAN     ----------------------------------------------------------------------
TETR2_ECOLX     ----------------------------------------------------------------------
SRPR_PSEPU      ----------------------------------------------------------------------
TETR5_ECOLX     ----------------------------------------------------------------------
MEPR_PSEPU      RQSAVLD---------------------------------------------------------------
YVKB_BACSU      ----------------------------------------------------------------------
TETR1_ECOLX     ----------------------------------------------------------------------
YTTP_BACSU      ----------------------------------------------------------------------
SLMA_SHIFL      ----------------------------------------------------------------------
SLMA_SHIF8      ----------------------------------------------------------------------
SLMA_SHIB3      ----------------------------------------------------------------------
SLMA_SALTY      ----------------------------------------------------------------------
SLMA_SALTI      ----------------------------------------------------------------------
SLMA_SALSV      ----------------------------------------------------------------------
SLMA_SALPK      ----------------------------------------------------------------------
SLMA_SALPC      ----------------------------------------------------------------------
SLMA_SALPB      ----------------------------------------------------------------------
SLMA_SALPA      ----------------------------------------------------------------------
SLMA_SALNS      ----------------------------------------------------------------------
SLMA_SALHS      ----------------------------------------------------------------------
SLMA_SALG2      ----------------------------------------------------------------------
SLMA_SALEP      ----------------------------------------------------------------------
SLMA_SALDC      ----------------------------------------------------------------------
SLMA_SALCH      ----------------------------------------------------------------------
SLMA_SALAR      ----------------------------------------------------------------------
SLMA_SALA4      ----------------------------------------------------------------------
SLMA_KLEP7      ----------------------------------------------------------------------
SLMA_KLEP3      ----------------------------------------------------------------------
SLMA_ESCF3      ----------------------------------------------------------------------
SLMA_ENT38      ----------------------------------------------------------------------
SLMA_ECOSM      ----------------------------------------------------------------------
SLMA_ECOSE      ----------------------------------------------------------------------
SLMA_ECOLU      ----------------------------------------------------------------------
SLMA_ECOLI      ----------------------------------------------------------------------
SLMA_ECOLC      ----------------------------------------------------------------------
SLMA_ECOL6      ----------------------------------------------------------------------
SLMA_ECOL5      ----------------------------------------------------------------------
SLMA_ECOHS      ----------------------------------------------------------------------
SLMA_ECODH      ----------------------------------------------------------------------
SLMA_ECOBW      ----------------------------------------------------------------------
SLMA_ECO8A      ----------------------------------------------------------------------
SLMA_ECO81      ----------------------------------------------------------------------
SLMA_ECO7I      ----------------------------------------------------------------------
SLMA_ECO5E      ----------------------------------------------------------------------
SLMA_ECO57      ----------------------------------------------------------------------
SLMA_ECO55      ----------------------------------------------------------------------
SLMA_ECO45      ----------------------------------------------------------------------
SLMA_ECO27      ----------------------------------------------------------------------
SLMA_ECO24      ----------------------------------------------------------------------
SLMA_CITK8      ----------------------------------------------------------------------
YERO_BACSU      ----------------------------------------------------------------------
AFRP_STRGR      ----------------------------------------------------------------------
FADR_BACSU      ----------------------------------------------------------------------
SLMA_ENTS8      ----------------------------------------------------------------------
BETI_STRM5      ----------------------------------------------------------------------
BETI_BRUC2      ----------------------------------------------------------------------
BETI_BRUAB      ----------------------------------------------------------------------
BETI_BRUA2      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
ACRR_SHIFL      --------------------------
ACRR_ECOLI      --------------------------
ACRR_ECOL6      --------------------------
UIDR_SHIFL      --------------------------
UIDR_ECOLI      --------------------------
UIDR_ECOL6      --------------------------
UIDR_ECO57      --------------------------
MTRR_NEIGO      --------------------------
TTGW_PSEPU      --------------------------
TETR7_VIBAN     --------------------------
TCMR_STRGA      --------------------------
TETR8_PASPI     --------------------------
TETR4_SALOR     --------------------------
TETR4_ECOLX     --------------------------
Y2897_STAA8     --------------------------
Y2658_STAAR     --------------------------
Y2593_STAAC     --------------------------
Y2578_STAAM     --------------------------
Y2515_STAA3     --------------------------
Y2498_STAAW     --------------------------
Y2464_STAAS     --------------------------
Y2452_STAAB     --------------------------
Y2364_STAAN     --------------------------
ICAR_STAEQ      --------------------------
ICAR_STAEP      --------------------------
TETR8_PASMU     --------------------------
ENVR_ECOLI      --------------------------
ENVR_ECO57      --------------------------
ICAR_STAAW      --------------------------
ICAR_STAAS      --------------------------
ICAR_STAAR      --------------------------
ICAR_STAAN      --------------------------
ICAR_STAAM      --------------------------
ICAR_STAAE      --------------------------
ICAR_STAAC      --------------------------
ICAR_STAA8      --------------------------
TTGR_PSEPK      --------------------------
BSCR_BACSU      --------------------------
ARPR_PSEPU      --------------------------
QACR_STAHA      --------------------------
QACR_STAAU      --------------------------
QACR_STAAM      --------------------------
BM3R1_BACME     --------------------------
TTGR_PSEPU      --------------------------
TETR3_ECOLX     --------------------------
YHGD_BACSU      --------------------------
Y6555_BACAN     --------------------------
TETR2_ECOLX     --------------------------
SRPR_PSEPU      --------------------------
TETR5_ECOLX     --------------------------
MEPR_PSEPU      --------------------------
YVKB_BACSU      --------------------------
TETR1_ECOLX     --------------------------
YTTP_BACSU      --------------------------
SLMA_SHIFL      --------------------------
SLMA_SHIF8      --------------------------
SLMA_SHIB3      --------------------------
SLMA_SALTY      --------------------------
SLMA_SALTI      --------------------------
SLMA_SALSV      --------------------------
SLMA_SALPK      --------------------------
SLMA_SALPC      --------------------------
SLMA_SALPB      --------------------------
SLMA_SALPA      --------------------------
SLMA_SALNS      --------------------------
SLMA_SALHS      --------------------------
SLMA_SALG2      --------------------------
SLMA_SALEP      --------------------------
SLMA_SALDC      --------------------------
SLMA_SALCH      --------------------------
SLMA_SALAR      --------------------------
SLMA_SALA4      --------------------------
SLMA_KLEP7      --------------------------
SLMA_KLEP3      --------------------------
SLMA_ESCF3      --------------------------
SLMA_ENT38      --------------------------
SLMA_ECOSM      --------------------------
SLMA_ECOSE      --------------------------
SLMA_ECOLU      --------------------------
SLMA_ECOLI      --------------------------
SLMA_ECOLC      --------------------------
SLMA_ECOL6      --------------------------
SLMA_ECOL5      --------------------------
SLMA_ECOHS      --------------------------
SLMA_ECODH      --------------------------
SLMA_ECOBW      --------------------------
SLMA_ECO8A      --------------------------
SLMA_ECO81      --------------------------
SLMA_ECO7I      --------------------------
SLMA_ECO5E      --------------------------
SLMA_ECO57      --------------------------
SLMA_ECO55      --------------------------
SLMA_ECO45      --------------------------
SLMA_ECO27      --------------------------
SLMA_ECO24      --------------------------
SLMA_CITK8      --------------------------
YERO_BACSU      --------------------------
AFRP_STRGR      --------------------------
FADR_BACSU      --------------------------
SLMA_ENTS8      --------------------------
BETI_STRM5      --------------------------
BETI_BRUC2      --------------------------
BETI_BRUAB      --------------------------
BETI_BRUA2      --------------------------