[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07796.1

[Show Plain Result]


## Summary of Sequence Search
    1::188
    8::146     9e-09  29%  179 aa  RPOE_STRAW RecName: Full=RNA polymerase sigma-E factor;
    6::144     3e-08  32%  177 aa  RPOE_STRCO RecName: Full=RNA polymerase sigma-E factor;
   28::146     2e-07  36%  180 aa  RPOE_STRAT RecName: Full=RNA polymerase sigma-E factor;
   74::213     9e-07  24%  237 aa  RP28_BACTK RecName: Full=RNA polymerase sigma-28 factor;Flags:
   74::213     9e-07  24%  237 aa  RP28_BACCR RecName: Full=RNA polymerase sigma-28 factor;Flags:
   74::213     9e-07  24%  237 aa  RP28_BACAN RecName: Full=RNA polymerase sigma-28 factor;Flags:
   40::187     2e-06  26%  400 aa  RFAY_XANCP RecName: Full=Probable RNA polymerase sigma factor rfaY;
   23::152     7e-06  31%  166 aa  SIGV_BACSU RecName: Full=RNA polymerase sigma factor sigV;
   92::187     1e-05  29%  193 aa  RPSH_PSEAE RecName: Full=RNA polymerase sigma-H factor;AltName:
   23::160     1e-05  28%  163 aa  SIGM_BACSU RecName: Full=RNA polymerase sigma factor sigM;
  119::185     2e-05  27%  187 aa  SIGW_BACSU RecName: Full=RNA polymerase sigma factor sigW;AltName:
  157::267     5e-05  25%  294 aa  RPSK_BACSU RecName: Full=RNA polymerase sigma-K factor;AltName:
    6::181     8e-05  26%  191 aa  RPOE_SHIFL RecName: Full=RNA polymerase sigma-E factor;AltName:
    6::181     8e-05  26%  191 aa  RPOE_ECOLI RecName: Full=RNA polymerase sigma-E factor;AltName:
    6::181     8e-05  26%  191 aa  RPOE_ECOL6 RecName: Full=RNA polymerase sigma-E factor;AltName:
    6::181     8e-05  26%  191 aa  RPOE_ECO57 RecName: Full=RNA polymerase sigma-E factor;AltName:
    6::181     2e-04  26%  191 aa  RPOE_SALTY RecName: Full=RNA polymerase sigma-E factor;AltName:
    6::181     2e-04  26%  191 aa  RPOE_SALTI RecName: Full=RNA polymerase sigma-E factor;AltName:
    6::186     5e-04  26%  189 aa  RPOE_HAEIN RecName: Full=RNA polymerase sigma-E factor;AltName:
    1::188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxTDQELSDFLASVERRAFKQAVFAVRDDEAALDIVQDAMIKLAEKYGDKSAAELPPLFQRILQNTIHDW
RPOE_STRAW      -----EFEEYVRTRQDALLRSARRLVPDPVDAQDLLQTALVRTYGRWADKRLADA--YLRRVMINTRTEW
RPOE_STRCO      -----EFEEYVRTRQDALLRSARRLVPDPVDAQDLLQTA---LARTYGDKRLADA--YLRRVMINTRTEW
RPOE_STRAT      -------------------------VPDPVDAQDLLQTA---LARTYGDKRLADA--YLRRVMINTRTEW
RP28_BACTK      ---------------------------DAEDLISIGTIGLIKAIESYSAGKGTKLATYAARCIENEILMH
RP28_BACCR      ---------------------------DAEDLISIGTIGLIKAIESYSAGKGTKLATYAARCIENEILMH
RP28_BACAN      ---------------------------DAEDLISIGTIGLIKAIESYSAGKGTKLATYAARCIENEILMH
RFAY_XANCP      ---------------------ALAITRDVAASEDIAQEAFLRAWQRLAQHQPASFLPWLRQITRNLARDW
SIGV_BACSU      ------------------YRLAFSYVKNQDDALDIVQESIKKLSSVETVRNPETIKSWFYKILVRTAIDF
RPSH_PSEAE      ----------------------------------------------------------------------
SIGM_BACSU      --------------------------KDKHLAEDLLQETFMRAYIHIHSYDHSKVKPWLFQVARNAFIDY
SIGW_BACSU      ----------------------------------------------------------------------
RPSK_BACSU      ------------------------------------------------------MPPLF--VMNNEILMH
RPOE_SHIFL      --TDQVLVERVQKGDQKAFNLLVVRYQHKVASLDVVQEAFIK-AYRALDSFRGD----------SAFYTW
RPOE_ECOLI      --TDQVLVERVQKGDQKAFNLLVVRYQHKVASLDVVQEAFIK-AYRALDSFRGD----------SAFYTW
RPOE_ECOL6      --TDQVLVERVQKGDQKAFNLLVVRYQHKVASLDVVQEAFIK-AYRALDSFRGD----------SAFYTW
RPOE_ECO57      --TDQVLVERVQKGDQKAFNLLVVRYQHKVASLDVVQEAFIK-AYRALDSFRGD----------SAFYTW
RPOE_SALTY      --TDQVLVERVQKGDQKAFNLLVVRYQHKVASLDVVQESFIK-AYRALDSFRGD----------SAFYTW
RPOE_SALTI      --TDQVLVERVQKGDQKAFNLLVVRYQHKVASLDVVQESFIK-AYRALDSFRGD----------SAFYTW
RPOE_HAEIN      --TDQALVERVQQGDKKAFNLLVSRYQNKVAGLDVVQESFIKAIESFRGESA--FYTWLYRIAVNTAKNY


                         .         .         *         .         .         .         .:140
query           FRRQKVRNTWVTLFSNLRDEREGDDSDLLDTLEAQAGTEMAESSADKVERAQVMHIIEQEIQRLPTRQRE
RPOE_STRAW      WRARKLEEV---------------------PTEQLPDASVDDSTEQHADRALLMDILKV----LAPKQRS
RPOE_STRCO      WRARKLEEV---------------------PTEQLPESPMDDATEQHADRALLMDVLKV----LAPKQRS
RPOE_STRAT      WRARKLEEVPTEQLPDARVE---------------------DSTEQHADRALLMDAMKV----LAPKQRS
RP28_BACTK      LRVLKKTKKDVSLHDPIGQDKEGNEISLIDILKSE-----SEDVIDMIQLSMELEKIKEYIDILDEREKE
RP28_BACCR      LRVLKKTKKDVSLHDPIGQDKEGNEISLIDILKSE-----SEDVIDMIQLSMELEKIKEYIDILDEREKE
RP28_BACAN      LRVLKKTKKDVSLHDPIGQDKEGNEISLIDILKSE-----SEDVIDMIQLSMELEKIKEYIDILDEREKE
RFAY_XANCP      LRSHRHRPL------------SGEXXXXXXXXXXDPSPSPAEQALQVEEERAALEIMSA----LPNDSRE
SIGV_BACSU      LRKQKVMDDETIEFLSKGKEDHYKDTDLHEALD-----------------------------ELPYRYKT
RPSH_PSEAE      --------------------RRPPDSDVTEFFEGDHALKDIESPERAMLRDEIEATVHQTIQQLPEDLRT
SIGM_BACSU      VRKHKKE---VTI-----------SDDLIGSLFQNA----VQSPAHQVE---IKEVLTGYMSELPDNYRE
SIGW_BACSU      ---------------------------------------------DAVVSLELSNTIQQKILKLPDKYRT
RPSK_BACSU      LRALKKTKKDVSLHDPIGQDKEGNEISLIDVLKSE-----NEDVIDTIQLNMELEKVKQYIDILDDREKE
RPOE_SHIFL      LYRIAVNTAKNYLVAQGR-RPPSSDVDAIEAENFESGGALKEISNPEMLSEELRQIVFRTIESLPEDLRM
RPOE_ECOLI      LYRIAVNTAKNYLVAQGR-RPPSSDVDAIEAENFESGGALKEISNPEMLSEELRQIVFRTIESLPEDLRM
RPOE_ECOL6      LYRIAVNTAKNYLVAQGR-RPPSSDVDAIEAENFESGGALKEISNPEMLSEELRQIVFRTIESLPEDLRM
RPOE_ECO57      LYRIAVNTAKNYLVAQGR-RPPSSDVDAIEAENFESGGALKEISNPEMLSEELRQIVFRTIESLPEDLRM
RPOE_SALTY      LYRIAVNTAKNYLVAQGR-RPPSSDVDAIEAENFESGGALKEISNPEMLSEELRQIVFRTIESLPEDLRM
RPOE_SALTI      LYRIAVNTAKNYLVAQGR-RPPSSDVDAIEAENFESGGALKEISNPEMLSEELRQIVFRTIESLPEDLRM
RPOE_HAEIN      LTAQG---------------RRPPNEDILDAENYDVGTHLRDVDTPENEMSELERIVFDTIHNLPEDLKT


                         +         .         .         .         .         *         .:210
query           AFLMRYWEDMDVAETAAVMGCSEGSVKTHCSRATHTLAQALRARGVxx
RPOE_STRAW      VVVLRHWEQMSTEETAAALGMSAGTVKS--------------------
RPOE_STRCO      VVVLRHWEQMSTEETAAALGMSAGTVKS--------------------
RPOE_STRAT      VVVLRHWEQMSTEETAAALGMSAGTVKS--------------------
RP28_BACTK      VIVKRFGLGLDKEKTQREIAKALGISRSYVSR----------------
RP28_BACCR      VIVKRFGLGLDKEKTQREIAKALGISRSYVSR----------------
RP28_BACAN      VIVKRFGLGLDKEKTQREIAKALGISRSYVSR----------------
RFAY_XANCP      ILLLYYREGQRSQQVASLLGLSDAAVRKRLSRARATVRNELLQR----
SIGV_BACSU      IIILRFFEDLKLEEIAEITGENTNTVKTRLYRA---------------
RPSH_PSEAE      ALTLREFEGLSYEDIATVMQCPVGTVRSRIFRAREAIDKALQ------
SIGM_BACSU      ALTLYYLKELNYKEASHIMNISEANFKSVLFRARQRL-KALYNRGV--
SIGW_BACSU      VIVLKYIDELSLIEIGEILNIPVGTVKTRIHRGREALRKQLR------
RPSK_BACSU      VIVGRFGLDLKKEKTQREIAKELGISRSYVSR----------------
RPOE_SHIFL      AITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAI-----------
RPOE_ECOLI      AITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAI-----------
RPOE_ECOL6      AITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAI-----------
RPOE_ECO57      AITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAI-----------
RPOE_SALTY      AITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAI-----------
RPOE_SALTI      AITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAI-----------
RPOE_HAEIN      AITLRELEGLSYEDIAEIMDCPVGTVRSRIFRAREMIENKIQ------