[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07810.1

[Show Plain Result]


## Summary of Sequence Search
    1::334
    1::328     3e-59  40%  332 aa  QORX_HUMAN RecName: Full=Quinone oxidoreductase PIG3;       
    8::327     4e-40  36%  329 aa  QOR_CAVPO RecName: Full=Quinone oxidoreductase;       
    8::327     9e-39  34%  329 aa  QOR_HUMAN RecName: Full=Quinone oxidoreductase;       
    8::327     3e-38  34%  329 aa  QOR_PONAB RecName: Full=Quinone oxidoreductase;       
    8::329     2e-36  34%  331 aa  QOR_MOUSE RecName: Full=Quinone oxidoreductase;       
    8::327     2e-34  33%  329 aa  QOR_RAT RecName: Full=Quinone oxidoreductase;       
    8::327     2e-33  32%  330 aa  QOR_BOVIN RecName: Full=Zeta-crystallin;
    8::327     3e-33  33%  330 aa  QOR_LAMGU RecName: Full=Quinone oxidoreductase;       
    8::327     2e-32  33%  329 aa  QOR_PIG RecName: Full=Quinone oxidoreductase;       
   72::408     3e-30  30%  484 aa  VAT1_DANRE RecName: Full=Synaptic vesicle membrane protein VAT-1
    5::325     8e-27  34%  327 aa  QOR_SALTY RecName: Full=Quinone oxidoreductase;       
 1423::1741    2e-26  28% 2111 aa  MCAS_MYCBO RecName: Full=Mycocerosic acid synthase;       
 1549::1848    9e-26  36% 2505 aa  FAS_RAT RecName: Full=Fatty acid synthase;       
   33::347     2e-25  30%  349 aa  QORL2_BOVIN RecName: Full=Quinone oxidoreductase-like protein 2;   
    1::345     1e-24  34%  347 aa  ADH_SULTO RecName: Full=NAD-dependent alcohol dehydrogenase;       
 1601::1847    3e-24  35% 2504 aa  FAS_MOUSE RecName: Full=Fatty acid synthase;       
    3::300     4e-24  32%  325 aa  QOR_PSEAE RecName: Full=Quinone oxidoreductase;       
    5::325     5e-24  32%  327 aa  QOR_ECOLI RecName: Full=Quinone oxidoreductase;       
 1609::1854    8e-24  37% 2511 aa  FAS_HUMAN RecName: Full=Fatty acid synthase;       
 1611::1856    1e-23  36% 2513 aa  FAS_BOVIN RecName: Full=Fatty acid synthase;       
   28::348     3e-23  30%  350 aa  QORL2_RAT RecName: Full=Quinone oxidoreductase-like protein 2;     
   21::324     7e-23  30%  329 aa  YOGA_BACSU RecName: Full=Uncharacterized zinc-type alcohol
   61::398     7e-23  29%  406 aa  VAT1_MOUSE RecName: Full=Synaptic vesicle membrane protein VAT-1
   34::348     9e-23  29%  350 aa  QORL2_MOUSE RecName: Full=Quinone oxidoreductase-like protein 2;   
   19::343     2e-22  30%  346 aa  YGD6_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
   78::385     2e-22  30%  393 aa  VAT1_HUMAN RecName: Full=Synaptic vesicle membrane protein VAT-1
   40::376     3e-22  28%  417 aa  VAT1L_MOUSE RecName: Full=Synaptic vesicle membrane protein VAT-1
   43::393     3e-22  34%  396 aa  RT4I1_BOVIN RecName: Full=Reticulon-4-interacting protein 1,
   42::378     1e-21  28%  419 aa  VAT1L_HUMAN RecName: Full=Synaptic vesicle membrane protein VAT-1
    1::334     2e-21  30%  339 aa  ADH2_BACST RecName: Full=Alcohol dehydrogenase;         Short=ADH; 
   40::361     2e-21  27%  365 aa  QORL2_NEMVE RecName: Full=Quinone oxidoreductase-like protein 2
   29::380     5e-21  30%  387 aa  RT4I1_DANRE RecName: Full=Reticulon-4-interacting protein 1
 1846::2055    1e-20  29% 2968 aa  PKS37_DICDI RecName: Full=Probable polyketide synthase 37;       
   43::393     6e-20  32%  396 aa  RT4I1_HUMAN RecName: Full=Reticulon-4-interacting protein 1,
   56::324     2e-19  30%  377 aa  ZADH2_HUMAN RecName: Full=Zinc-binding alcohol dehydrogenase
   56::320     2e-19  30%  377 aa  ZADH2_BOVIN RecName: Full=Zinc-binding alcohol dehydrogenase
   43::393     2e-19  34%  396 aa  RT4I1_MOUSE RecName: Full=Reticulon-4-interacting protein 1,
   37::242     2e-19  32%  379 aa  VAT1_TORCA RecName: Full=Synaptic vesicle membrane protein VAT-1;  
    6::320     5e-19  27%  329 aa  QOR_SCHPO RecName: Full=Probable quinone oxidoreductase;       
   17::337     1e-18  29%  340 aa  QOR_LEIAM RecName: Full=Probable quinone oxidoreductase;       
   78::382     2e-18  35%  386 aa  QORL_ARATH RecName: Full=Quinone oxidoreductase-like protein
    8::344     4e-18  28%  348 aa  ADH1_KLUMA RecName: Full=Alcohol dehydrogenase 1;       
   26::333     9e-18  31%  336 aa  ZDH1_STAEQ RecName: Full=Zinc-type alcohol dehydrogenase-like
 1613::1858    9e-18  31% 2512 aa  FAS_CHICK RecName: Full=Fatty acid synthase;       
   16::346     9e-18  30%  350 aa  ADH1_EMENI RecName: Full=Alcohol dehydrogenase 1;       
   15::349     2e-17  31%  353 aa  ADH1_NEUCR RecName: Full=Alcohol dehydrogenase 1;       
   26::333     2e-17  31%  336 aa  ZDH1_STAES RecName: Full=Zinc-type alcohol dehydrogenase-like
    1::345     2e-17  32%  347 aa  ADH_SULSR RecName: Full=NAD-dependent alcohol dehydrogenase;       
   56::302     1e-16  29%  377 aa  ZADH2_MOUSE RecName: Full=Zinc-binding alcohol dehydrogenase
   10::330     4e-16  29%  334 aa  QOR_YEAST RecName: Full=Probable quinone oxidoreductase;       
   15::346     1e-15  24%  350 aa  ADH_SCHPO RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   19::344     2e-15  25%  348 aa  ADH2_KLULA RecName: Full=Alcohol dehydrogenase 2;       
 1871::2188    2e-15  26% 2603 aa  PKS16_DICDI RecName: Full=Probable polyketide synthase 16;       
    1::340     3e-15  28%  343 aa  DHSO_BACHD RecName: Full=Sorbitol dehydrogenase;       
 1693::1915    4e-15  30% 2380 aa  PKS25_DICDI RecName: Full=Probable polyketide synthase 25;       
   26::331     5e-15  28%  333 aa  ZDH1_STAAC RecName: Full=Zinc-type alcohol dehydrogenase-like
   26::333     7e-15  28%  335 aa  ZDH1_STAAW RecName: Full=Zinc-type alcohol dehydrogenase-like
   26::333     7e-15  28%  335 aa  ZDH1_STAAS RecName: Full=Zinc-type alcohol dehydrogenase-like
    8::344     1e-14  30%  348 aa  ADH1_PICST RecName: Full=Alcohol dehydrogenase 1;       
   26::333     2e-14  28%  335 aa  ZDH1_STAAR RecName: Full=Zinc-type alcohol dehydrogenase-like
 1652::1961    2e-14  26% 2779 aa  PKS21_DICDI RecName: Full=Probable polyketide synthase 21;       
    1::334     2e-14  29%  337 aa  ADH1_BACST RecName: Full=Alcohol dehydrogenase;       
   26::333     3e-14  28%  335 aa  ZDH1_STAAN RecName: Full=Zinc-type alcohol dehydrogenase-like
   26::333     3e-14  28%  335 aa  ZDH1_STAAM RecName: Full=Zinc-type alcohol dehydrogenase-like
   24::234     3e-14  34%  297 aa  TOXD_COCCA RecName: Full=Protein TOXD;
    3::291     3e-14  31%  340 aa  ADHA_RHIME RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
 1859::2169    1e-13  30% 2999 aa  PKS18_DICDI RecName: Full=Probable polyketide synthase 18;       
    1::335     1e-13  29%  339 aa  ADH3_BACST RecName: Full=Alcohol dehydrogenase;       
    6::327     1e-13  25%  329 aa  QORH_SPIOL RecName: Full=Quinone-oxidoreductase homolog,
 1852::2170    2e-13  32% 3010 aa  PKS2_DICDI RecName: Full=Probable polyketide synthase 2;       
    1::345     2e-13  31%  347 aa  ADH_SULSO RecName: Full=NAD-dependent alcohol dehydrogenase;       
    1::286     2e-13  30%  339 aa  YJMD_BACSU RecName: Full=Uncharacterized zinc-type alcohol
    6::238     2e-13  29%  339 aa  INC11_TRIAT RecName: Full=Protein indc11;
   30::347     3e-13  28%  351 aa  ADH5_YEAST RecName: Full=Alcohol dehydrogenase 5;       
   30::347     3e-13  28%  351 aa  ADH5_SACPS RecName: Full=Alcohol dehydrogenase 5;       
 1872::2189    4e-13  26% 2604 aa  PKS17_DICDI RecName: Full=Probable polyketide synthase 17;       
   51::370     4e-13  26%  374 aa  ADH3_KLULA RecName: Full=Alcohol dehydrogenase 3, mitochondrial;   
   27::346     4e-13  27%  350 aa  ADH1_CANAL RecName: Full=Alcohol dehydrogenase 1;       
 1649::1958    5e-13  28% 2778 aa  PKS19_DICDI RecName: Full=Probable polyketide synthase 19;       
 2016::2248    5e-13  29% 3174 aa  PKS15_DICDI RecName: Full=Probable polyketide synthase 15;       
   46::371     5e-13  26%  375 aa  ADH4_KLULA RecName: Full=Alcohol dehydrogenase 4, mitochondrial;   
    6::327     7e-13  24%  329 aa  QORH_ARATH RecName: Full=Putative quinone-oxidoreductase homolog,
  156::314     1e-12  34%  349 aa  YKM8_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
 1831::2058    1e-12  28% 2542 aa  PKS41_DICDI RecName: Full=Probable polyketide synthase 41;       
   24::335     2e-12  26%  357 aa  MECR_DROME RecName: Full=Probable trans-2-enoyl-CoA reductase,
   23::346     2e-12  28%  350 aa  ADH1_ASPFN RecName: Full=Alcohol dehydrogenase 1;       
   29::279     3e-12  30%  344 aa  MECR1_CAEEL RecName: Full=Probable trans-2-enoyl-CoA reductase 1,
 2831::3132    4e-12  31% 3567 aa  ERYA2_SACER RecName: Full=Erythronolide synthase, modules 3 and 4;   
    7::260     6e-12  30%  325 aa  YBJB_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
   30::328     7e-12  27%  329 aa  PTGR1_CAVPO RecName: Full=Prostaglandin reductase 1;       
 1957::2280    7e-12  25% 2690 aa  PKS28_DICDI RecName: Full=Probable polyketide synthase 28;       
   45::344     9e-12  29%  347 aa  YBI2_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
 1835::2062    9e-12  27% 2552 aa  PKS40_DICDI RecName: Full=Probable polyketide synthase 40;       
 1957::2262    9e-12  27% 3147 aa  PKS1_DICDI RecName: Full=Probable polyketide synthase 1;       
  123::344     1e-11  33%  348 aa  TDH_PYRHO RecName: Full=Probable L-threonine 3-dehydrogenase;      
  123::344     1e-11  32%  348 aa  TDH_PYRAB RecName: Full=Probable L-threonine 3-dehydrogenase;      
    1::337     1e-11  30%  339 aa  RSPB_ECOLI RecName: Full=Starvation-sensing protein rspB;       
  123::345     2e-11  31%  347 aa  TDH_THETN RecName: Full=L-threonine 3-dehydrogenase;       
    5::345     2e-11  33%  351 aa  TDH_SYMTH RecName: Full=L-threonine 3-dehydrogenase;       
   14::344     2e-11  30%  348 aa  TDH_PYRFU RecName: Full=Probable L-threonine 3-dehydrogenase;      
    8::344     3e-11  27%  348 aa  ADH2_PICST RecName: Full=Alcohol dehydrogenase 2;       
   13::340     4e-11  27%  341 aa  TDH_CHRVO RecName: Full=L-threonine 3-dehydrogenase;       
  120::341     6e-11  28%  343 aa  TDH_ANADF RecName: Full=L-threonine 3-dehydrogenase;       
 1891::2131    6e-11  26% 2623 aa  PKS31_DICDI RecName: Full=Probable polyketide synthase 31;       
 1430::1748    6e-11  23% 2126 aa  PHAS_MYCTU RecName: Full=Phthioceranic/hydroxyphthioceranic acid
 1430::1748    6e-11  23% 2126 aa  PHAS_MYCTA RecName: Full=Phthioceranic/hydroxyphthioceranic acid
 1430::1748    6e-11  23% 2126 aa  PHAS_MYCBP RecName: Full=Phthioceranic/hydroxyphthioceranic acid
 1430::1748    6e-11  23% 2126 aa  PHAS_MYCBO RecName: Full=Phthioceranic/hydroxyphthioceranic acid
   25::344     6e-11  27%  348 aa  ADH2_CANAL RecName: Full=Alcohol dehydrogenase 2;       
 1839::2141    1e-10  29% 2551 aa  PKS13_DICDI RecName: Full=Probable polyketide synthase 13;       
   21::346     1e-10  24%  350 aa  ADH1_KLULA RecName: Full=Alcohol dehydrogenase 1;       
   11::339     1e-10  31%  343 aa  TDH_THET2 RecName: Full=L-threonine 3-dehydrogenase;       
 1803::2038    1e-10  29% 2512 aa  PKS5_DICDI RecName: Full=Probable polyketide synthase 5;       
 1937::2258    2e-10  23% 3108 aa  PKS39_DICDI RecName: Full=Probable polyketide synthase 39;       
 1917::2252    2e-10  30% 3097 aa  PKS45_DICDI RecName: Full=Probable polyketide synthase 45;       
   30::294     4e-10  23%  330 aa  YHFP_BACSU RecName: Full=Putative quinone oxidoreductase yhfP;     
 1798::2035    4e-10  27% 2513 aa  PKS7_DICDI RecName: Full=Probable polyketide synthase 7;       
   23::232     4e-10  33%  336 aa  ADH_STAAW RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::232     4e-10  33%  336 aa  ADH_STAAS RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::232     4e-10  33%  336 aa  ADH_STAAR RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::232     4e-10  33%  336 aa  ADH_STAAN RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::232     4e-10  33%  336 aa  ADH_STAAM RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::232     4e-10  33%  336 aa  ADH_STAAC RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::232     4e-10  33%  336 aa  ADH_STAAB RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::232     4e-10  33%  336 aa  ADH_STAA8 RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   23::232     4e-10  33%  336 aa  ADH_STAA3 RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
 1715::1942    7e-10  27% 2837 aa  PKS3_DICDI RecName: Full=Probable polyketide synthase 3;       
   11::339     9e-10  32%  343 aa  TDH_THET8 RecName: Full=L-threonine 3-dehydrogenase;       
   25::268     1e-09  30%  350 aa  TDH_THEON RecName: Full=Probable L-threonine 3-dehydrogenase;      
    9::298     2e-09  29%  376 aa  YNN4_YEAST RecName: Full=Uncharacterized protein YNL134C;
   19::344     2e-09  23%  348 aa  ADH1_YEAST RecName: Full=Alcohol dehydrogenase 1;       
   19::344     2e-09  24%  348 aa  ADH2_YEAST RecName: Full=Alcohol dehydrogenase 2;       
    5::258     3e-09  31%  366 aa  ADH_RALEU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   15::268     3e-09  28%  350 aa  TDH_PYRKO RecName: Full=Probable L-threonine 3-dehydrogenase;      
    1::341     3e-09  27%  344 aa  ADH_SULAC RecName: Full=NAD-dependent alcohol dehydrogenase;       
 1897::2239    4e-09  29% 3078 aa  PKS44_DICDI RecName: Full=Probable polyketide synthase 44;       
 1902::2140    6e-09  25% 3106 aa  PKS29_DICDI RecName: Full=Probable polyketide synthase 29;       
   43::309     7e-09  27%  373 aa  MECR_RAT RecName: Full=Trans-2-enoyl-CoA reductase, mitochondrial; 
   29::301     2e-08  26%  376 aa  ETR1_YARLI RecName: Full=Probable trans-2-enoyl-CoA reductase,
   25::294     2e-08  26%  348 aa  ADH2_KLUMA RecName: Full=Alcohol dehydrogenase 2;       
   26::281     2e-08  33%  353 aa  DHSO_BACSU RecName: Full=Sorbitol dehydrogenase;       
   13::340     3e-08  30%  343 aa  TDH_SACEN RecName: Full=L-threonine 3-dehydrogenase;       
  155::338     3e-08  28%  343 aa  P2_ARATH RecName: Full=Probable NADP-dependent oxidoreductase P2;  
   43::237     3e-08  31%  373 aa  MECR_HUMAN RecName: Full=Trans-2-enoyl-CoA reductase,
   30::324     4e-08  23%  349 aa  PTGR1_RABIT RecName: Full=Prostaglandin reductase 1;       
 2022::2238    4e-08  26% 3101 aa  PKS32_DICDI RecName: Full=Probable polyketide synthase 32;       
 1888::2112    4e-08  26% 2499 aa  PKS22_DICDI RecName: Full=Probable polyketide synthase 22;       
   19::340     5e-08  24%  342 aa  TDH_COXBU RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     5e-08  24%  342 aa  TDH_COXBR RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     5e-08  24%  342 aa  TDH_COXBN RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     5e-08  24%  342 aa  TDH_COXB2 RecName: Full=L-threonine 3-dehydrogenase;       
 1802::2040    5e-08  26% 2514 aa  PKS8_DICDI RecName: Full=Probable polyketide synthase 8/35;       
   29::259     6e-08  29%  339 aa  YFMJ_BACSU RecName: Full=Putative NADP-dependent oxidoreductase
    1::217     6e-08  33%  336 aa  ADHP_ECOLI RecName: Full=Alcohol dehydrogenase,
  160::238     8e-08  39%  329 aa  PTGR1_MOUSE RecName: Full=Prostaglandin reductase 1;       
 1803::2040    8e-08  26% 2924 aa  PKS6_DICDI RecName: Full=Probable polyketide synthase 6;       
 1856::2086    8e-08  29% 2998 aa  PKS14_DICDI RecName: Full=Probable polyketide synthase 14;       
   47::311     8e-08  25%  377 aa  MECR_DANRE RecName: Full=Trans-2-enoyl-CoA reductase,
    1::323     8e-08  28%  337 aa  ADH1_ZYMMO RecName: Full=Alcohol dehydrogenase 1;       
 1801::2038    1e-07  25% 2931 aa  PKS9_DICDI RecName: Full=Probable polyketide synthase 9/36;       
    1::340     1e-07  27%  343 aa  TDH_BURXL RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     1e-07  28%  342 aa  TDH_BURS3 RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     1e-07  28%  343 aa  TDH_BURPP RecName: Full=L-threonine 3-dehydrogenase;       
 1973::2172    1e-07  25% 3133 aa  PKS38_DICDI RecName: Full=Probable polyketide synthase 38;       
  157::340     1e-07  27%  345 aa  P1_ARATH RecName: Full=Probable NADP-dependent oxidoreductase P1;  
   22::275     2e-07  30%  347 aa  YDJJ_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
   13::341     2e-07  31%  345 aa  TDH_PROAC RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     2e-07  28%  340 aa  TDH_LEGPA RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     2e-07  28%  342 aa  TDH_BURCJ RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     2e-07  28%  342 aa  TDH_BURCH RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     2e-07  28%  342 aa  TDH_BURCC RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     2e-07  28%  342 aa  TDH_BURCA RecName: Full=L-threonine 3-dehydrogenase;       
 1977::2146    2e-07  25% 3127 aa  PKS33_DICDI RecName: Full=Probable polyketide synthase 33;       
   52::371     2e-07  25%  375 aa  ADH3_YEAST RecName: Full=Alcohol dehydrogenase 3, mitochondrial;   
 1980::2149    2e-07  25% 3078 aa  PKS34_DICDI RecName: Full=Probable polyketide synthase 34;       
   43::309     2e-07  26%  373 aa  MECR_MOUSE RecName: Full=Trans-2-enoyl-CoA reductase,
    8::174     2e-07  31%  346 aa  MECR2_CAEEL RecName: Full=Probable trans-2-enoyl-CoA reductase 2,
    1::340     3e-07  28%  342 aa  TDH_BURCM RecName: Full=L-threonine 3-dehydrogenase;       
  211::344     3e-07  32%  346 aa  TDH_BACLD RecName: Full=L-threonine 3-dehydrogenase;       
 1949::2272    3e-07  23% 2684 aa  PKS27_DICDI RecName: Full=Probable polyketide synthase 27;       
 1798::2112    3e-07  26% 2499 aa  PKS23_DICDI RecName: Full=Probable polyketide synthase 23;       
   33::342     3e-07  28%  352 aa  ADH3_EMENI RecName: Full=Alcohol dehydrogenase 3;       
    1::340     4e-07  28%  341 aa  TDH_YERPY RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     4e-07  28%  341 aa  TDH_YERPS RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     4e-07  28%  341 aa  TDH_YERPB RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     4e-07  28%  341 aa  TDH_YERP3 RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     4e-07  28%  342 aa  TDH_BURA4 RecName: Full=L-threonine 3-dehydrogenase;       
   21::280     4e-07  25%  314 aa  CIPB_EMENI RecName: Full=Zinc-binding alcohol dehydrogenase
  130::298     4e-07  28%  375 aa  CADH3_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 3;        
  119::319     4e-07  26%  367 aa  ADH2_EMENI RecName: Full=Alcohol dehydrogenase 2;       
   16::340     5e-07  27%  342 aa  TDH_BURP8 RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     7e-07  27%  341 aa  TDH_SHEWM RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     7e-07  28%  341 aa  TDH_SERP5 RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     7e-07  28%  340 aa  TDH_LEGPL RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     7e-07  28%  340 aa  TDH_LEGPH RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     7e-07  28%  340 aa  TDH_LEGPC RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     7e-07  27%  342 aa  TDH_BURM1 RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-07  27%  343 aa  TDH_BURPS RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-07  27%  343 aa  TDH_BURP6 RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-07  27%  343 aa  TDH_BURP1 RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-07  27%  343 aa  TDH_BURP0 RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-07  27%  343 aa  TDH_BURMS RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-07  27%  343 aa  TDH_BURMA RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-07  27%  343 aa  TDH_BURM9 RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-07  27%  343 aa  TDH_BURM7 RecName: Full=L-threonine 3-dehydrogenase;       
    6::345     9e-07  28%  347 aa  TDH_BACSU RecName: Full=L-threonine 3-dehydrogenase;       
  121::342     1e-06  30%  344 aa  TDH_PSYIN RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     1e-06  27%  342 aa  TDH_BURVG RecName: Full=L-threonine 3-dehydrogenase;       
 2005::2140    1e-06  28% 3075 aa  PKS30_DICDI RecName: Full=Probable polyketide synthase 30;       
  131::299     1e-06  28%  376 aa  CADH2_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 2;        
    9::274     2e-06  29%  376 aa  YL460_YEAST RecName: Full=Uncharacterized protein YLR460C;
  120::354     2e-06  24%  358 aa  YDJL_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
    1::340     2e-06  27%  343 aa  TDH_BURTA RecName: Full=L-threonine 3-dehydrogenase;       
  162::346     2e-06  25%  350 aa  MECR_DICDI RecName: Full=Trans-2-enoyl-CoA reductase,
    1::266     3e-06  29%  368 aa  YCZ2_YEAST RecName: Full=Uncharacterized protein YCR102C;
   19::340     3e-06  29%  341 aa  TDH_SHESH RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-06  28%  341 aa  TDH_SHEAM RecName: Full=L-threonine 3-dehydrogenase;       
  123::344     3e-06  24%  345 aa  TDH_RHIL3 RecName: Full=L-threonine 3-dehydrogenase;       
  123::344     3e-06  24%  345 aa  TDH_RHIEC RecName: Full=L-threonine 3-dehydrogenase;       
  123::344     3e-06  24%  345 aa  TDH_RHIE6 RecName: Full=L-threonine 3-dehydrogenase;       
  163::238     3e-06  37%  329 aa  PTGR1_RAT RecName: Full=Prostaglandin reductase 1;       
   19::270     3e-06  28%  341 aa  TDH_SHEFN RecName: Full=L-threonine 3-dehydrogenase;       
  172::341     3e-06  28%  345 aa  TDH_ANADE RecName: Full=L-threonine 3-dehydrogenase;       
   30::327     3e-06  24%  329 aa  PTGR1_BOVIN RecName: Full=Prostaglandin reductase 1;       
   22::303     3e-06  25%  372 aa  ETR1_SCHPO RecName: Full=Probable trans-2-enoyl-CoA reductase,
  133::227     3e-06  35%  365 aa  CADH_SACOF RecName: Full=Probable cinnamyl alcohol dehydrogenase;  
   19::340     5e-06  29%  341 aa  TDH_SOLUE RecName: Full=L-threonine 3-dehydrogenase;       
  172::341     5e-06  26%  345 aa  TDH_ANASK RecName: Full=L-threonine 3-dehydrogenase;       
  172::341     5e-06  27%  345 aa  TDH_ANAD2 RecName: Full=L-threonine 3-dehydrogenase;       
  163::238     5e-06  36%  329 aa  PTGR1_PIG RecName: Full=Prostaglandin reductase 1;       
   21::232     5e-06  32%  340 aa  ADH_STAEQ RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  123::344     6e-06  23%  345 aa  TDH_AGRRK RecName: Full=L-threonine 3-dehydrogenase;       
    4::296     6e-06  29%  360 aa  FADH_AMYME RecName: Full=NAD/mycothiol-dependent formaldehyde
  121::342     8e-06  26%  343 aa  TDH_VIBCM RecName: Full=L-threonine 3-dehydrogenase;       
  121::342     8e-06  26%  343 aa  TDH_VIBCH RecName: Full=L-threonine 3-dehydrogenase;       
  121::342     8e-06  26%  343 aa  TDH_VIBC3 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     8e-06  26%  341 aa  TDH_SHESW RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     8e-06  26%  341 aa  TDH_SHEPA RecName: Full=L-threonine 3-dehydrogenase;       
   16::239     8e-06  28%  341 aa  TDH_PSEHT RecName: Full=L-threonine 3-dehydrogenase;       
 1937::2126    8e-06  26% 2655 aa  PKS42_DICDI RecName: Full=Probable polyketide synthase 42;       
    6::283     8e-06  31%  343 aa  DOIAD_STRKN RecName: Full=2-deoxy-scyllo-inosamine dehydrogenase;  
    9::340     1e-05  27%  341 aa  TDH_YERE8 RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     1e-05  30%  341 aa  TDH_SHESR RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     1e-05  29%  341 aa  TDH_SHEPC RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     1e-05  25%  341 aa  TDH_SHEB9 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     1e-05  25%  341 aa  TDH_SHEB5 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     1e-05  25%  341 aa  TDH_SHEB2 RecName: Full=L-threonine 3-dehydrogenase;       
  117::340     1e-05  27%  340 aa  TDH_PSEA6 RecName: Full=L-threonine 3-dehydrogenase;       
   21::232     1e-05  31%  340 aa  ADH_STAES RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
   19::340     1e-05  30%  341 aa  TDH_SHESM RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     1e-05  30%  341 aa  TDH_SHESA RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     1e-05  25%  341 aa  TDH_SHEHH RecName: Full=L-threonine 3-dehydrogenase;       
  123::344     1e-05  23%  345 aa  TDH_RHILW RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     1e-05  28%  341 aa  TDH_PHOLL RecName: Full=L-threonine 3-dehydrogenase;       
    1::174     1e-05  26%  352 aa  RT4I1_DICDI RecName: Full=Reticulon-4-interacting protein 1
  119::340     2e-05  24%  341 aa  TDH_SHEON RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     2e-05  27%  341 aa  TDH_EDWI9 RecName: Full=L-threonine 3-dehydrogenase;       
   17::238     2e-05  31%  357 aa  DHSO_HUMAN RecName: Full=Sorbitol dehydrogenase;       
  134::299     2e-05  29%  365 aa  CADH4_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 4;        
  153::252     2e-05  30%  351 aa  PTGR2_MOUSE RecName: Full=Prostaglandin reductase 2;       
  163::238     2e-05  33%  329 aa  PTGR1_HUMAN RecName: Full=Prostaglandin reductase 1;       
   17::238     2e-05  32%  357 aa  DHSO_MACFA RecName: Full=Sorbitol dehydrogenase;       
  119::340     3e-05  27%  341 aa  TDH_SHEB8 RecName: Full=L-threonine 3-dehydrogenase;       
   63::292     3e-05  31%  349 aa  QORL1_HUMAN RecName: Full=Quinone oxidoreductase-like protein 1;   
   63::223     4e-05  31%  349 aa  QORL1_BOVIN RecName: Full=Quinone oxidoreductase-like protein 1;   
  176::289     4e-05  32%  346 aa  BDHA_BACSU RecName: Full=(R,R)-butanediol dehydrogenase;       
    1::340     5e-05  27%  341 aa  TDH_SALAR RecName: Full=L-threonine 3-dehydrogenase;       
   19::340     5e-05  28%  361 aa  TDH_ERWCT RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALTY RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALSV RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALPK RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALPC RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALPB RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALPA RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALNS RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALHS RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALEP RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALDC RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALCH RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_SALA4 RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_KLEP7 RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     9e-05  27%  341 aa  TDH_KLEP3 RecName: Full=L-threonine 3-dehydrogenase;       
    5::345     9e-05  29%  347 aa  TDH_BACA2 RecName: Full=L-threonine 3-dehydrogenase;       
  173::264     9e-05  34%  351 aa  PTGR2_PONAB RecName: Full=Prostaglandin reductase 2;       
    1::341     1e-04  26%  342 aa  TDH_SILPO RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     1e-04  27%  341 aa  TDH_SALG2 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     1e-04  24%  341 aa  TDH_PROMH RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     1e-04  27%  341 aa  TDH_ALTMD RecName: Full=L-threonine 3-dehydrogenase;       
   16::239     1e-04  28%  342 aa  TDH_AERS4 RecName: Full=L-threonine 3-dehydrogenase;       
   63::346     1e-04  27%  348 aa  QORL1_MOUSE RecName: Full=Quinone oxidoreductase-like protein 1;   
    1::139     1e-04  37%  339 aa  DOIAD_STRRY RecName: Full=2-deoxy-scyllo-inosamine dehydrogenase;  
   17::238     1e-04  31%  357 aa  DHSO_PONAB RecName: Full=Sorbitol dehydrogenase;       
  133::298     1e-04  30%  357 aa  CADH1_TOBAC RecName: Full=Probable cinnamyl alcohol dehydrogenase
  119::340     1e-04  24%  341 aa  TDH_SHELP RecName: Full=L-threonine 3-dehydrogenase;       
  123::344     1e-04  24%  344 aa  TDH_MESSB RecName: Full=L-threonine 3-dehydrogenase;       
    1::340     1e-04  26%  341 aa  TDH_ESCF3 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     1e-04  25%  341 aa  TDH_ECOLI RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     1e-04  25%  341 aa  TDH_ECODH RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     1e-04  25%  341 aa  TDH_ECOBW RecName: Full=L-threonine 3-dehydrogenase;       
  173::264     1e-04  34%  351 aa  PTGR2_HUMAN RecName: Full=Prostaglandin reductase 2;       
   33::256     1e-04  33%  354 aa  CADH1_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase
  187::273     1e-04  35%  351 aa  ADH_CLOBE RecName: Full=NADP-dependent alcohol dehydrogenase;      
  174::240     1e-04  32%  360 aa  ADH1_ENTHI RecName: Full=NADP-dependent alcohol dehydrogenase;     
  169::311     2e-04  29%  350 aa  YCJQ_SHIFL RecName: Full=Uncharacterized zinc-type alcohol
  169::311     2e-04  29%  350 aa  YCJQ_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
    1::340     2e-04  27%  341 aa  TDH_SALTI RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     2e-04  25%  341 aa  TDH_ENTS8 RecName: Full=L-threonine 3-dehydrogenase;       
  139::251     2e-04  28%  365 aa  YMN1_YEAST RecName: Full=Uncharacterized membrane protein YML131W;
  119::340     2e-04  25%  341 aa  TDH_SHISS RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     2e-04  25%  341 aa  TDH_ECOLU RecName: Full=L-threonine 3-dehydrogenase;       
   16::340     2e-04  24%  342 aa  TDH_AERHH RecName: Full=L-threonine 3-dehydrogenase;       
   18::230     3e-04  24%  324 aa  YHDH_ECOLI RecName: Full=Putative quinone oxidoreductase yhdH;     
  119::340     3e-04  25%  341 aa  TDH_SHIFL RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_SHIF8 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_SHIBS RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_SHIB3 RecName: Full=L-threonine 3-dehydrogenase;       
   13::344     3e-04  25%  345 aa  TDH_RHISN RecName: Full=L-threonine 3-dehydrogenase;       
  123::344     3e-04  23%  344 aa  TDH_RHIME RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECOUT RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECOSM RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECOSE RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECOLC RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECOL6 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECOL5 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECOK1 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECOHS RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECO8A RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECO81 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECO7I RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECO55 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECO45 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECO27 RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     3e-04  25%  341 aa  TDH_ECO24 RecName: Full=L-threonine 3-dehydrogenase;       
  153::252     3e-04  32%  351 aa  PTGR2_RAT RecName: Full=Prostaglandin reductase 2;       
   42::138     3e-04  27%  312 aa  DHB12_BOVIN RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
  121::342     4e-04  30%  343 aa  TDH_VIBPA RecName: Full=L-threonine 3-dehydrogenase;       
  121::266     4e-04  25%  343 aa  TDH_PHOPR RecName: Full=L-threonine 3-dehydrogenase;       
   85::141     4e-04  39%  274 aa  NADE_NOCFA RecName: Full=NH(3)-dependent NAD(+) synthetase;        
   16::340     7e-04  25%  341 aa  TDH_MARMS RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     0.001  25%  341 aa  TDH_ECO5E RecName: Full=L-threonine 3-dehydrogenase;       
  119::340     0.001  25%  341 aa  TDH_ECO57 RecName: Full=L-threonine 3-dehydrogenase;       
   42::138     0.001  27%  312 aa  DHB12_MACFA RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
    1::334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKAIEIREYGAPEVLQETQRPDPEPKAGEILIRVAAAGINRPDVFQRTGNYPVPPGASDLPGLEVAGVVV
QORX_HUMAN      MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVA
QOR_CAVPO       MRAIRVFEFGGPEVLKQSDVAVPIPKDHQVLIKVHACGINPVETYIRSGTYTRIPLLPYTPGTDVAGVVI
QOR_HUMAN       MRAVRVFEFGGPEVLKRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIE
QOR_PONAB       MRAVRVFEFGGPEVLKQSDIAVPIPKDHQALIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIV
QOR_MOUSE       MRAIRVFEFGGPEVLKQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIV
QOR_RAT         MRAIRVFEFGGPEVLKQSDVVVPAPQSHQVLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDVAGIIV
QOR_BOVIN       MRAIRVFEFGGPEVLKQSDVAVPIPKDHQVLIKVQACGVNPVDTYIRSGTHNIKPLLPYTPGFDVAGIIV
QOR_LAMGU       MRAIRVSEFGGPEVLKQSDVAVPIPEEHQVLIKVQACGVNPVDTYIRSGTYSRKPRLPYTPGLDVAGLIV
QOR_PIG         MSAIRVFKFGGPEVMKQSDVAIPIPKDNQVLIKVHACGVNPVDTYIRSGTHNMKPLLPYTPGLDVAGIVV
VAT1_DANRE      -RALVLTGYGGDKVKLQVKKGKPALKSGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTPGMECSGVIV
QOR_SALTY       ---IEFHKHGGPEVLQTVEFTPAEPAEHEIQVENKAIGINFIDTYIRSGLYPPPSLPAGL-GTEAAGVVV
MCAS_MYCBO      ---VQVRRPGDLQTLEFVASDRVPPGPGQIEVAVSMSSINFADVLIAFGRFPIIDDREPQLGMDFXXXXX
FAS_RAT         ----------------------PPSSSGAQLCTVYYASLNFRDIMLATGK--LSPDA--IPGKWASDCML
QORL2_BOVIN     -------ELKRPLVIEEVTPRPVQPH--EVRVNVHFCGINFADILACQGQYQERHQLPFTPGMEFSGMVL
ADH_SULTO       MRAMRLVEIGKPLKLEDI--PIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNLRIVEDLGGHEIAGEVV
FAS_MOUSE       ----------------------------------------------------------------------
QOR_PSEAE       -KRIQFAAYGGPEVLEYRDYQPAEPGPREVRVRNRAIGLNFIDTYYRSGLYPAPGLPS---GLXXXXXXX
QOR_ECOLI       ---IEFHKHGGPEVLQAVEFTPADPAENEIQVENKAIGINFIDTYIRXXXXXXXXXXXXXX-TEAAGIVV
FAS_HUMAN       ----------------------------------------------------------------------
FAS_BOVIN       ----------------------------------------------------------------------
QORL2_RAT       -RAAVCTELKQPLTIQEVAPRPIGPQ--EVRVDVHFCGINFADNLVCRGQYQEKPPLPFTPGMEFSGVVL
YOGA_BACSU      --------------------PSTKPGYGEVKVKLKSAGLNHRDLFLMKNKSEQDPHGSDXXXXXVKNVTV
VAT1_MOUSE      LRCLVLTGFGGYDKVKLQSRPPPAPGPGQLTLRVRACGLNFADLMGRQGLYDRLPPLPVTPGMXXXXXXX
QORL2_MOUSE     -------ELKQPLTIQEVAPRPVGPQ--EVRVDVHFCGVNFADILACRGQYQEKPPLPFTPGMEFSGAVL
YGD6_SCHPO      -----------PEEYEVPQKLNP----GEVLVKLKAASLNYRDLIITKGXXXXXXXXXXXXGSDGAGIIV
VAT1_HUMAN      ----------------------------QLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMXXXXXXX
VAT1L_MOUSE     MRAVVLAGFGGLNKLRLSRKAMPEPQDGELKIRVKACGLNFIDLMVRQGNIDNPPKTPLVPGFECSGIVE
RT4I1_BOVIN     MPAWVIDKYGSNEVLRFTQNMPMIHYPNEVIIKVHAASINPIDVNMRSGNMKRDPLHVKIKGEEFP-LTL
VAT1L_HUMAN     MRAVVLAGFGGLNKLRLFRKAMPEPQDGELKIRVKACGLNFIDLMVRQGNIDNPPKTPLVPGFECSGIVE
ADH2_BACST      MKAAVVNEFKKALEIKEVERPKLEE--GEVLVKIEACGVCHTDLHAAHGDWPIKPKLPLIPGHEGVGIVV
QORL2_NEMVE     -RAVMCNELGKPLVVEDKFSTE-NLGTSQVRVAVHSCGINFADILKCIGKYQEKPELPFVPGTEISGEVV
RT4I1_DANRE     MPAWVIDKYGKNDVLRFTKNAALPHYPNEVVVKVHAAGLNPIDISMR-GGYGAATMAMKRDPLNISQLIL
PKS37_DICDI     ----------------------------------------------------------------------
RT4I1_HUMAN     MPAWVIDKYGKNEVLRFTQNMMMPHYPNEVIVKVHAASVNPIDVNMRSGNMKRDPLHVKIKGEEFP-LTL
ZADH2_HUMAN     --------------------PVPLPGDGDLLVRNRFVGVNASDINYSAGRYPSVKPPFDI-GFEGIGEVV
ZADH2_BOVIN     --------------------PVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKTPFDAGFEGVGEVV
RT4I1_MOUSE     MPAWVIDKYGKNEVLRFTQNMMLPHYPNEVIIKVHAASVNPIDVNMRSGNMKRDPLHMKTKGEEFP-LTL
VAT1_TORCA      ---------GYDKVKVEVKKGVPTLKSDEILVRVQACGLNFSDLLVRQGAF----GKHHSLGTECAGVVE
QOR_SCHPO       ---VQVSKTGPSSVLQVITKEIPKPAPNGLVIKNAYAGLNYIDTYLRTGLYTAP-----LPYIPGXXXXX
QOR_LEIAM       ------KDFRSSTSVVEAHLPEEVPE-GMVRVSVKYAGVNASDLNFTNGSYFKNVQPPFDCGFEAAGTVV
QORL_ARATH      MKAWVYSDYGGVDVLKESNIVVPEIKEDQVLIKVVAAALNPVDAKRRQGKFK----ATDSPLPTVPGYXX
ADH1_KLUMA      -KGVIFYEHGGE--LQYKDIPVPKPKPNELLINVKYSGVCHTDLHAWQGDWPLDTKLPLVGGHEGAGIVV
ZDH1_STAEQ      ----------------------PHPSGHELLVKVQSISVNPVDTKQRT--MPVDKAPRVL-GFDAVGVIE
FAS_CHICK       ----------------------------------------------------------------------
ADH1_EMENI      ---------GGPLVYK--QIPVPKPGPDQILVKIRYSGVCHTDLHAMMGHWPIPVKMPLVGGHEGAGIVV
ADH1_NEUCR      -----VEKKGGPVVFKQVQKPGPD----EVLINVKYSGVCHTDLHAMKGDWPL---ATKMPXXXXXXVEV
ZDH1_STAES      ----------------------PHPSGHELLVKVQSISVNPVDTKQRT--MPVDKVPRVL-GFDAVGVIE
ADH_SULSR       MRAVRLVEIGKPLVLKDIDIP--KPKGAQVLIKVEAAGVCHSDVHMRQGRFGNLRIVEDLGGHEIAGKVV
ZADH2_MOUSE     --------------------PVPLPGDGDLLVRNRFVGINASDINYSAGRYPSLKPPFDI-GFEGIGEVV
QOR_YEAST       -KVILIDEIGGYDVIKYEDYPVPSISEEELLIKNKYTGVNYIESYFRKGIYPCEKPY--VLGREASGTVV
ADH_SCHPO       --------HGGPENVKFEEVPVAEPGQDEVLVNIKYTGVCHTDLHALQGDWPLPAKMPLIXXXXXXXXXX
ADH2_KLULA      --------------LQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTNIGDFAGIKLNGSCM
PKS16_DICDI     ---------------------------GSVEIKVMSTGINYKDNLFYRGLLPFTKGDIYSPGLECAGYIT
DHSO_BACHD      MKALVKTQHGTGHFAVQ-EKPEPTPGKHQVKIKVKYTGVCGSDIHTYEGHYPV--AAPVTLGHEFSGEIV
PKS25_DICDI     -------------------------KPYDIEVEIKATGLNYKD-------YLVYSGLIKLKG---DSVDF
ZDH1_STAAC      ----------------------PTPENDDILVKVNSISVNPVDTKQRQMEVTQAPGFDAIGTVEAIGPDV
ZDH1_STAAW      ----------------------PTPENDDILVKVNSISVNPVDTKQRQMEVTQAPGFDAIGTVEAIGPDV
ZDH1_STAAS      ----------------------PTPENDDILVKVNSISVNPVDTKQRQMEVTQAPGFDAIGTVEAIGPDV
ADH1_PICST      -KAVVFESNGGPLLYKDI--PVPTPKPNEILINVKYSGVCHTDLHAWKGDWPLD---TKLP-LXXXXXXX
ZDH1_STAAR      ----------------------PTPENDDILVKVNSISVNPVDTKQRQMEVTQAPGFDAIGTVEAIGPNV
PKS21_DICDI     ----------------------------QIEVKVLATGINYKDYLIYRGLVVIDENVSNPLGLEFSGIIT
ADH1_BACST      MKAAVVEQFKKPLQVKEVEKP--KISYGEVLVRIKACGVCHTDLHAAHGDWPVKP---KLP-LXXXXXXX
ZDH1_STAAN      ----------------------PTPENDDILVKVNSISVNPVDTKQRQMKVTQAPGFDAIGTVEAIGPDV
ZDH1_STAAM      ----------------------PTPENDDILVKVNSISVNPVDTKQRQMKVTQAPGFDAIGTVEAIGPDV
TOXD_COCCA      ----------------------PKLRDDYILVRTVSVALNPTDILRLS-----PPGC--LVGCDYAGIVV
ADHA_RHIME      MTAAVVREFGKPLVIEEXXXXXXXXXXX--LIKYEATGVCHTDLHAAKGDWPVRPNPPFIPGHEGVGYVL
PKS18_DICDI     -------------------------KDDEIEVEVKATGINYKDYLIYCGLVSAESGDVNNPGIEYSGIII
ADH3_BACST      MKAAVVEQFKEPLKIKEVEKPTIS--YGEVLVRIKACGVCHTDLHAAHGDWPVKP---KLP-LXXXXXXX
QORH_SPIOL      MHAIQYSGYGGTDALKHVEVAVPDPKSDELLLKIEAATLNPIDWKIQKGRPLLPRKFPTIPGTDVAGEVV
PKS2_DICDI      ---------------------------GFIEVKVLASGINFKDVYRRTGNSNDPEF-----GYECSGIVV
ADH_SULSO       MRAVRLVEIGKPLSLQEIGVP--KPKGPQVLIKVEAAGVCHSDVHMRQGRFGNLRIVEDLGGHEIAGKVV
YJMD_BACSU      MKAVQVRK--AYDLVTAEVKKPVLSKDDEVLVKVKRVGICGSDMHIYHGTNPL----ATLPGHEVTGQVV
INC11_TRIAT     -RKVVITAYGPPSTLQFVTEDLPPPPKDHVQVKILYAGFAGADVNMRLGVYPMQSAPPFTPGYCFAGVSV
ADH5_YEAST      ----------------------PEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHEGAGVVV
ADH5_SACPS      ----------------------PEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHEGAGVVV
PKS17_DICDI     ---------------------------GCVEIKVMSTGINYKDSLFYRGLLPFSKGDIYSPGLECAGYIT
ADH3_KLULA      --------------------PVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTNIGDFAGIKLNGSCM
ADH1_CANAL      --------------------PVPTPKPNELLIHVKYSGVCHTDLHARKGDWPL---ATKLP-LXXXXXXX
PKS19_DICDI     ----------------------------EIEVKVLATGINYKDYLIYRGLVVIDENVSNPLGLEFSGIIT
PKS15_DICDI     -------------------------KSNKVEVNVLSLGVNYKDYLVYCGL--VPPEICNRKG-DINNPEI
ADH4_KLULA      --------------LEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGAGIVV
QORH_ARATH      MHALQYNSYGGGAALEHVQVPVPTPKSNEVCLKLEATSLNPVDKIQKGMIRPFLP--RKFPCIPATDXXX
YKM8_SCHPO      ----------------------------------------------------------------------
PKS41_DICDI     -------------------KPTSILKENEVEIKVMSTGLNYKDYLIYAG---LVESVEPIFGIEFSGIIT
MECR_DROME      -KSLKYTQHGEPEVLQLVEDKLPDPKDNQVLVKILAAPINPADINTIQGKYPVKPKFPAVGGNEVAEVIC
ADH1_ASPFN      ------------------QIPVPKPGPDEILVKVRYSGVCHTDLHALKGDWPLPXXXXXXXXXXXXDLVT
MECR1_CAEEL     -----------PEAIQKTVTIADKPSADQVLVQWIAAPINPADLNQIQGVYPVKPALPAVGGNEGFGKVI
ERYA2_SACER     ---------GAIDSVAFEPAPDVEQRAGEVRVDVRATGVNFRDVLLALGMY---PQKADM-GTEAAGVVV
YBJB_SCHPO      MKALRMLKKPKPGCLGEIQSPIPQPKNGELLVKIEAAAINPSDLMNATGGFPYTV-YPRIVGRDYAGTVI
PTGR1_CAVPO     ----------------------PPLKNGEVLLEALFLSV---DPYMRIASKRLKEGAV-MMGQQVARVVE
PKS28_DICDI     -----------------------EPNSKEVEIEIKATGINYKDYLMHIGKYGKEYEVENCIGIE--NPMI
YBI2_SCHPO      ----------------------------DVLVEVVATSINPLD-YKLMNTYQMIAKAPNIPGYDFAGRVV
PKS40_DICDI     -------------------KPTSILKENEVEIKVMSTGLNYKDYLIYAG---LVESVEPIFGIEFSGIIT
PKS1_DICDI      ----------------------------QIEIKVECVGINLPQEIFRMGDIYNPPY-----GLECSGVII
TDH_PYRHO       ----------------------------------------------------------------------
TDH_PYRAB       ----------------------------------------------------------------------
RSPB_ECOLI      MKSILIEK---PNQLAIVEREIPTPSAGEVRVKVKLAGICGSDSHIYRGHNPFAKYPRVI-GHEFFGVID
TDH_THETN       ----------------------------------------------------------------------
TDH_SYMTH       MRALRKLEAGPGATLQEVPIPTIGPR--DVLVKVRAASICGTDYHIYTWD-PWSAGRVKPPGHELAGVAV
TDH_PYRFU       -------EYGAELVEVDVPKPGP----GEVLIKILATSICGTDLHIYEWNEWAPPXXXDYVSVETH-IVC
ADH2_PICST      -KAVIFETNGGPLLYKDI--PVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLDTKLGDYAGIKINGSCL
TDH_CHRVO       --------------LEMTDVPLPEVGHNDLLIKIVKTAICGTDIHQKTIPVPMHVGHEYVGGSEVQGFKI
TDH_ANADF       ----------------------------------------------------------------------
PKS31_DICDI     -----------------------ELNSNEVEIEVKATGINYKDYLMYIGDLDIKYGKEIEYGIGIDNPKI
PHAS_MYCTU      ---LQIRTPGDMQTIELAAFHRVPPGPGQIEVAVRASSVNFADVLIAFGRYPSFEGHLPQLGTDFXXXXX
PHAS_MYCTA      ---LQIRTPGDMQTIELAAFHRVPPGPGQIEVAVRASSVNFADVLIAFGRYPSFEGHLPQLGTDFXXXXX
PHAS_MYCBP      ---LQIRTPGDMQTIELAAFHRVPPGPGQIEVAVRASSVNFADVLIAFGRYPSFEGHLPQLGTDFXXXXX
PHAS_MYCBO      ---LQIRTPGDMQTIELAAFHRVPPGPGQIEVAVRASSVNFADVLIAFGRYPSFEGHLPQLGTDFXXXXX
ADH2_CANAL      --------------------PVPKPKANELLINVKYSGVCHTDLHAWKGDWPL---ATKLPXXXXXXXXX
PKS13_DICDI     ---------------QLQSKPFKQLLQNEIEVEIKATGINYRDYLVFTGSLPIEKGISNQPGVDFSGIVT
ADH1_KLULA      --------------LQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLGDFAGIKLNGSCM
TDH_THET2       ------------EGLTLVDRPVPEPGPGEILVRVEAASICGTDLWDAWARGRIRPPL--VTGHEFSGVVV
PKS5_DICDI      ----------SPNLEYQLQSKQIKLRDNQVEVKTIATGINNKDYLVYSGLEGSVNSNTPQFGYEFSGIIV
PKS39_DICDI     -----------------------ELNSNEVEIEIKATGINYKDYLLHIGNLEIKYGKEIENGIGFDNPKI
PKS45_DICDI     -------------------------KENEIEVQVVATGINFKDIFRNL----VPPGDYSKPGIECSGIV-
YHFP_BACSU      ------------------------PKDG-VLIKVAYSGINYKDGLAGKAGGNIVREYPLILGIDAAGTVV
PKS7_DICDI      ----------SPNLEYQLQSKQIKLRDNQVEVKTIATGINYKDYLNFXXXXXXXXXXTGLPGYEFSGIIV
ADH_STAAW       -------------------------KPGEALVQTEYCGVCHTDLHVKNADF------GDVTGVTLGHEGI
ADH_STAAS       -------------------------KPGEALVQTEYCGVCHTDLHVKNADF------GDVTGVTLGHEGI
ADH_STAAR       -------------------------KPGEALVQTEYCGVCHTDLHVKNADF------GDVTGVTLGHEGI
ADH_STAAN       -------------------------KPGEALVQTEYCGVCHTDLHVKNADF------GDVTGVTLGHEGI
ADH_STAAM       -------------------------KPGEALVQTEYCGVCHTDLHVKNADF------GDVTGVTLGHEGI
ADH_STAAC       -------------------------KPGEALVQTEYCGVCHTDLHVKNADF------GDVTGVTLGHEGI
ADH_STAAB       -------------------------KPGEALVQTEYCGVCHTDLHVKNADF------GDVTGVTLGHEGI
ADH_STAA8       -------------------------KPGEALVQTEYCGVCHTDLHVKNADF------GDVTGVTLGHEGI
ADH_STAA3       -------------------------KPGEALVQTEYCGVCHTDLHVKNADF------GDVTGVTLGHEGI
PKS3_DICDI      ----------------------------EVQVEIKSFALNYKDYLTYIGS--VPPEMVNHKTGDINDPEF
TDH_THET8       ------------EGLTLVDRPVPEPGPGEILVRVEAASICGTDLWDAWARGRIRPPL--VTGHEFSGVVV
TDH_THEON       ----------------------PKPGPGEVLIKVLATSICGTDLHIYEWNEWAPP---QIMGHEVAGIVC
YNN4_YEAST      MKAVVI-ENGKAVVKQDI--PIPELEEGFVLIKTVAVAGNPTD-WKHIDFKIGPQGA--LLGCDAAGQIV
ADH1_YEAST      --------------LEHKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLGDYAGIKLNGSCM
ADH2_YEAST      --------------LEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLGDYAGIKLNGSCM
ADH_RALEU       MKAAVFVEPGRIEL---ADKPIPDIGPNDALVRITTTTICGTDVHILKGEYPVPVGIIEKLGSAVTGYVI
TDH_PYRKO       --------YGAELVEVDVPKPGP----GEVLIKVLATSIKPPQIMXXXXXXXXXXXXXXXXDLQVGDIVC
ADH_SULAC       MKAMLLHKFGEPLRLEDMDVP--KVGVGQVLVKVDYAGVCHTDLSVRSGAIRISSSKPTLPGHEIAXVLI
PKS44_DICDI     -------------------------KENEIEVQVVATGINFKDIFRNL----VPPVLANHEG-DFSKPEF
PKS29_DICDI     --------------------------SNEVEIEIKATGMNYKDYLMYIGNLDIKYGKEIENCIGFNNPKI
MECR_RAT        VRALVYGNHGDPKVIQLKNLELTAVEGSDVHVKMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGIAV
ETR1_YARLI      -RAFVFSQTGEPDVIQVLEYPIEKPLENQVLLKSLGFTINPADINQLEGVYPVPPKSVQINNEDAA---I
ADH2_KLUMA      --------------------PVPKPKSNELLINVKYSGVCHTDLHAWKGDWPLD---TKLP-LXXXXXXX
DHSO_BACSU      --------------------PVPDINHDEVLIKVMAVGICGSDLHYRIGNYVVEKPF--ILGHECAGEIA
TDH_SACEN       --------------LELTELPDPTPGANDIVVQVFRTGICGTDLHARTVPTPLVIGAGEVVGSAVTQAQV
P2_ARATH        ----------------------------------------------------------------------
MECR_HUMAN      VRALVYGHHGDPAKVVELKNLELAAVRGDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEVAQVVA
PTGR1_RABIT     ----------------------PPLNNGEVLLEALFLSV---DPYMRLGSKRLKEGDT-MMGQQVARVVE
PKS32_DICDI     ----------------------------------------------------------------------
PKS22_DICDI     ----------------------------------------------------------------------
TDH_COXBU       --------------------PTPKPGRDEVLIKIKKTAICGTDLHQKTIPVPMHVGHEFVGEIEAASALA
TDH_COXBR       --------------------PTPKPGRDEVLIKIKKTAICGTDLHQKTIPVPMHVGHEFVGEIEAASALA
TDH_COXBN       --------------------PTPKPGRDEVLIKIKKTAICGTDLHQKTIPVPMHVGHEFVGEIEAASALA
TDH_COXB2       --------------------PTPKPGRDEVLIKIKKTAICGTDLHQKTIPVPMHVGHEFVGEIEAASALA
PKS8_DICDI      ----------SPNLEYQLQSKQIKLRDNQVEVKTIATGINYKDYLNXXXXXXXXXXXTGLPGYEFSGIIV
YFMJ_BACSU      --------------------PVPEPKQGEVLVKTLYVSVDMRGRMQDTKSY-VEPFALDLSGGVIAEVVS
ADHP_ECOLI      MKAAVVTKDHHVDVTYKTLR---SLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGV--ILGHEGIGVVV
PTGR1_MOUSE     ----------------------------------------------------------------------
PKS6_DICDI      ----------SPNLEYQLQSKQIKLRDNQVEVKTIATGINYKDYLNFXXXXXXXXXXTGLPGYEFSGIIV
PKS14_DICDI     -------------------------KENQLEVHVKATGINYKDYLLYCGLLPMVSHNNDINGLEFSGIVI
MECR_DANRE      --ALLYRNHGEPSQVVQLESLDPQVGAECVLVKMLAAPINPSDLNMLQGTYAILPELPAVGGNEVAQVME
ADH1_ZYMMO      MKAAVITKDHTIEVKDTKLRP---LKYGEALLEMEYCGVCHTDLHVKNGDFGDETGR--ITGHEGIGIVV
PKS9_DICDI      ----------SPNLEYQLQSKQIKLRDNQVEVKTIATGINYKDYLNFXXXXXXXXXXTGLPGYEFSGIIV
TDH_BURXL       MKALAKLERAPGLTLTDVKKP--EVGHNDVMIRITRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFAI
TDH_BURS3       MKALAKLERGPGLTLTRVKRP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFAI
TDH_BURPP       MKALAKLERAPGLTLTDVKKP--EVGHNDVMIRITRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFAI
PKS38_DICDI     -------------------------------------------------------------GIGIDNPKI
P1_ARATH        ----------------------------------------------------------------------
YDJJ_ECOLI      ----------------------PVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQEGHECAGTVV
TDH_PROAC       --------------LELVEVPDPVAGPNDVIVKVMRTGICGTDVHAKTVHTPLVLGGSEVNDLEV-GQFV
TDH_LEGPA       --------------------PVPEYGVNDVLIKIKRTAICGTDIHIYSATIPVPMGEIVEVGKEVQGLKV
TDH_BURCJ       MKALAKLERGPGLTLTRVKRP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFAI
TDH_BURCH       MKALAKLERGPGLTLTRVKRP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFAI
TDH_BURCC       MKALAKLERGPGLTLTRVKRP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFAI
TDH_BURCA       MKALAKLERGPGLTLTRVKRP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFAI
PKS33_DICDI     ----------------------------------------------------------------------
ADH3_YEAST      --------------------PVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVV
PKS34_DICDI     ----------------------------------------------------------------------
MECR_MOUSE      VRALVYGNHGDPKVVQLKNLELTAVEGSDVHVRMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQVI
MECR2_CAEEL     -QALIYRKFGDPKVLQETVEVPAEPGSGECLVEWLASPINPLDINRIQGNYAVRAELPVIGGSEGVGRVV
TDH_BURCM       MKALAKLERGPGLTLTRVKRP--EVGHNDVLIKIHRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFAI
TDH_BACLD       ----------------------------------------------------------------------
PKS27_DICDI     -----------------------EINSKEVEIEIKATGINYKDYLMHIGEYEVENGINPMIGIDFSGIIT
PKS23_DICDI     -------------------------------VKVMASGVNFKDINMANSNENGDPSKPQF-GYELSGIVV
ADH3_EMENI      ----------------------------EILVKMRYSGVCHTDLHAMKGDWPLPSKMPLIGGHEGAGVVV
TDH_YERPY       MKALS--KLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHQKTIPVPMVVGHEYVGGQEVKGFNI
TDH_YERPS       MKALS--KLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHQKTIPVPMVVGHEYVGGQEVKGFNI
TDH_YERPB       MKALS--KLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHQKTIPVPMVVGHEYVGGQEVKGFNI
TDH_YERP3       MKALS--KLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHQKTIPVPMVVGHEYVGGQEVKGFNI
TDH_BURA4       MKALAKLERGPGLTLTRVKRP--EVGHNDVLIKIHRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFAI
CIPB_EMENI      ---------------QVKEAPSYTPEENEILVKNHAVAINPVDGSLQSKNYPT------ILGQDVAGEVV
CADH3_ARATH     ----------------------------------------------------------------------
ADH2_EMENI      ----------------------------------------------------------------------
TDH_BURP8       -----------------TRVKKPEVGHNDVMIRITRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFSI
TDH_SHEWM       --------------------PKPEMGHNDLLIKIRKTAICGTDVHQNTIPVPMVVGHEYVGGQEVRGFSI
TDH_SERP5       MKALS--KLKAEEGIWMTDVPQPELGHNDIMIKIRKTAICGTDVHQKTIPVPMVVGHEYVGGQEVKGFTV
TDH_LEGPL       --------------------PVPEYGVNDVLIKIKRTAICGTDIHIYSATIPVPMGEIVEVGKEVQGLKV
TDH_LEGPH       --------------------PVPEYGVNDVLIKIKRTAICGTDIHIYSATIPVPMGEIVEVGKEVQGLKV
TDH_LEGPC       --------------------PVPEYGVNDVLIKIKRTAICGTDIHIYSATIPVPMGEIVEVGKEVQGLKV
TDH_BURM1       MKALAKLERAPGLTLTRVKRP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFAI
TDH_BURPS       MKALAKLERGPGLTLTRVKKP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFSI
TDH_BURP6       MKALAKLERGPGLTLTRVKKP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFSI
TDH_BURP1       MKALAKLERGPGLTLTRVKKP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFSI
TDH_BURP0       MKALAKLERGPGLTLTRVKKP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFSI
TDH_BURMS       MKALAKLERGPGLTLTRVKKP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFSI
TDH_BURMA       MKALAKLERGPGLTLTRVKKP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFSI
TDH_BURM9       MKALAKLERGPGLTLTRVKKP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFSI
TDH_BURM7       MKALAKLERGPGLTLTRVKKP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFSI
TDH_BACSU       MKALMKKDGAFGAVLTEV--PIPEIDKHEVLIKVKAASICGTDVHIYNWDQWARQRIKTVFGHEFSGIVE
TDH_PSYIN       ----------------------------------------------------------------------
TDH_BURVG       MKALAKLERAPGLTLTRVKRP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFAI
PKS30_DICDI     ----------------------------------------------------------------------
CADH2_ARATH     ----------------------------------------------------------------------
YL460_YEAST     MKAVVIEDGKA--VVKEGI-PIPELEEGFVLIKTLAVAGNPTDWAHI--DYKIGPQGSIL-GCDAAGQIV
YDJL_ECOLI      ----------------------------------------------------------------------
TDH_BURTA       MKALAKLERGPGLTLTRVKKP--EVGHNDVLIKIRRTAICGTDIHQKTIPVPMHVGHEYVGGQEVRGFSI
MECR_DICDI      ----------------------------------------------------------------------
YCZ2_YEAST      MKAVVIEDGKA--VVKEGV-PIPELEEGFVLIKTLAVAGNPTDWAHI--DYKVGPQGSIL-GCDAAGQIV
TDH_SHESH       --------------------PKPEMGHNDLLIKIRKTAICGTDIHQKTIPVPMVVGHEYVGGIEVRGFDV
TDH_SHEAM       ----------------------------------------------------------------------
TDH_RHIL3       ----------------------------------------------------------------------
TDH_RHIEC       ----------------------------------------------------------------------
TDH_RHIE6       ----------------------------------------------------------------------
PTGR1_RAT       ----------------------------------------------------------------------
TDH_SHEFN       --------------------PKPEMGHNDLLIKIRKTAICGTDVHQKTIPVPMIAGHEYVGGQEVRGFSI
TDH_ANADE       ----------------------------------------------------------------------
PTGR1_BOVIN     ----------------------PPLKDGEVLLEALYLTV---DPYMRIMAKSLKEGDM-MMGEQVARVVE
ETR1_SCHPO      -KAIAYSEYGNPEVLRAVSYNVPKCSKNQVNVRFLASPINPSDINQIQGVYPKPPFTNDVCSSKPSAVAG
CADH_SACOF      ----------------------------------------------------------------------
TDH_SOLUE       ----------------------PEPAIGDVLIRVLRTGICGTDVHRETIHVPMAIGHEFVGRIEAVGSNV
TDH_ANASK       ----------------------------------------------------------------------
TDH_ANAD2       ----------------------------------------------------------------------
PTGR1_PIG       ----------------------------------------------------------------------
ADH_STAEQ       -----------------------ELKPGEALVKTEYCGVCHTDLHVKNADF------GDVTGVTLGHEGI
TDH_AGRRK       ----------------------------------------------------------------------
FADH_AMYME      VRGVIARSKGAPVELTDIVIPDPGPS--EVTALIATCAVCHTDLTYREG------GINDLLGHEAAGTVE
TDH_VIBCM       ----------------------------------------------------------------------
TDH_VIBCH       ----------------------------------------------------------------------
TDH_VIBC3       ----------------------------------------------------------------------
TDH_SHESW       ----------------------------------------------------------------------
TDH_SHEPA       ----------------------------------------------------------------------
TDH_PSEHT       -----------------TDAPKPEVGHNDLLIKIRKTAICGTDVHQKTIPTPMVVGHEYVGGQEVRGFKV
PKS42_DICDI     ---------------------------------------------------------------------I
DOIAD_STRKN     --------FHSPEKATFEQRDVPTPRPGEALVHIAYNSICGSDLSLYRGGYPV------VPGHEWSGTVV
TDH_YERE8       ----------AEEGIWMTNVPQPELGHNDIMIKIRKTAICGTDVHQKTIPVPMVVGHEYVGGQEVKGFNI
TDH_SHESR       --------------------PKPEMGHNDLLIKIKKTAICGTDMHQKT--IPVPM----VVGHEYVGEVV
TDH_SHEPC       --------------------PKPEMGHNDLLIKIKKTAICGTDMHQKT--IPVPM----VVGHEYVGEVV
TDH_SHEB9       ----------------------------------------------------------------------
TDH_SHEB5       ----------------------------------------------------------------------
TDH_SHEB2       ----------------------------------------------------------------------
TDH_PSEA6       ----------------------------------------------------------------------
ADH_STAES       -----------------------ELRPGEALVKTEYCGVCHTDLHVKNADF------GDVTGVTLGHEGI
TDH_SHESM       --------------------PKPEMGHNDLLIKIKKTAICGTDMHQKT--IPVPM----VVGHEYVGEVV
TDH_SHESA       --------------------PKPEMGHNDLLIKIKKTAICGTDMHQKT--IPVPM----VVGHEYVGEVV
TDH_SHEHH       ----------------------------------------------------------------------
TDH_RHILW       ----------------------------------------------------------------------
TDH_PHOLL       --------------------PEPELGHNDVMIKIRKTAICGTDVHQKT--IPVPM----VVGHEYVGVAI
RT4I1_DICDI     MKGILLNGYGESLDLLETDLPVPKPIKSQVLIKIHSTSINPLDNVMRKGY------ASSIVDLKLLPIIL
TDH_SHEON       ----------------------------------------------------------------------
TDH_EDWI9       MKALS--KLKAEEGIWMTDVPLPALGHNDIMIKIRKAAICGTDVHQKTIPVPMVVGHEYVGGQEVRGFRI
DHSO_HUMAN      -----------PGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVYGRIGNFIVKKPM--VLGHEASGTVV
CADH4_ARATH     ----------------------------------------------------------------------
PTGR2_MOUSE     ----------------------------------------------------------------------
PTGR1_HUMAN     ----------------------------------------------------------------------
DHSO_MACFA      -----------PGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYRIGNFIVKKPM--VLGHEASGTVV
TDH_SHEB8       ----------------------------------------------------------------------
QORL1_HUMAN     -------------------------------------------------------------GREIAGIVL
QORL1_BOVIN     -------------------------------------------------------------GREVAGIVL
BDHA_BACSU      ----------------------------------------------------------------------
TDH_SALAR       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFNI
TDH_ERWCT       --------------------PMPELGHNDIMIKIRKSAICGTDVHQKTIPVPMVVGHEYVGGQEVNGFHI
TDH_SALTY       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_SALSV       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_SALPK       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_SALPC       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_SALPB       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_SALPA       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_SALNS       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_SALHS       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_SALEP       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_SALDC       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_SALCH       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_SALA4       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_KLEP7       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVRGFKI
TDH_KLEP3       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVRGFKI
TDH_BACA2       MKAIVKNENAFGATLKEI--PIPSINENEVLIKVQAASICGTDVHIYNWDQWAQKRIKQVFGHEFSGIVA
PTGR2_PONAB     ----------------------------------------------------------------------
TDH_SILPO       MKALEKSK--PEEGLWMVQAPVPEIGPDDVLIKIKKTGICGTDIHWAAHTVPVPAGEIVELGRDVTGLSI
TDH_SALG2       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_PROMH       ----------------------------------------------------------------------
TDH_ALTMD       ----------------------------------------------------------------------
TDH_AERS4       -----------------TDVPAPELGHNDLLIKIRKTAICGTDMHQKTIPVPMVVGHEYVGGQEVRGFAV
QORL1_MOUSE     -------------------------------------------------------------GREVSGIVL
DOIAD_STRRY     MKALMFK---APLQAVLTERDVPEPAPGEALVKLAYNSICGSDLSFYKGTYPVVPGAADLVGQNVVGTVA
DHSO_PONAB      -----------PGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYRIGNFIVKKPM--VLGHEASGTVV
CADH1_TOBAC     ----------------------------------------------------------------------
TDH_SHELP       ----------------------------------------------------------------------
TDH_MESSB       ----------------------------------------------------------------------
TDH_ESCF3       MKALS--KLKAEEGIWMTDVPEPELGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_ECOLI       ----------------------------------------------------------------------
TDH_ECODH       ----------------------------------------------------------------------
TDH_ECOBW       ----------------------------------------------------------------------
PTGR2_HUMAN     ----------------------------------------------------------------------
CADH1_ORYSJ     -------------------------QSDDVSLRITHCGVCYADVILNNSMYPL------VPGHEIAGVVV
ADH_CLOBE       ----------------------------------------------------------------------
ADH1_ENTHI      ----------------------------------------------------------------------
YCJQ_SHIFL      ----------------------------------------------------------------------
YCJQ_ECOLI      ----------------------------------------------------------------------
TDH_SALTI       MKALS--KLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHQKT--IPVPMXXXXXXXXEVKGFKI
TDH_ENTS8       ----------------------------------------------------------------------
YMN1_YEAST      ----------------------------------------------------------------------
TDH_SHISS       ----------------------------------------------------------------------
TDH_ECOLU       ----------------------------------------------------------------------
TDH_AERHH       -----------------TDVPAPELGHNDLLIKIRKTAICGTDIHQKTIPVPMVVGHEYVGGQEVRGFAV
YHDH_ECOLI      ------------QTLDESRLPE-----GDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFAGTVT
TDH_SHIFL       ----------------------------------------------------------------------
TDH_SHIF8       ----------------------------------------------------------------------
TDH_SHIBS       ----------------------------------------------------------------------
TDH_SHIB3       ----------------------------------------------------------------------
TDH_RHISN       -----------PEVGLWMERPVPEVGPNDVLIRVKKSAICGTDVHQKTIPVPMVVGHEFMGEIAEVGIVC
TDH_RHIME       ----------------------------------------------------------------------
TDH_ECOUT       ----------------------------------------------------------------------
TDH_ECOSM       ----------------------------------------------------------------------
TDH_ECOSE       ----------------------------------------------------------------------
TDH_ECOLC       ----------------------------------------------------------------------
TDH_ECOL6       ----------------------------------------------------------------------
TDH_ECOL5       ----------------------------------------------------------------------
TDH_ECOK1       ----------------------------------------------------------------------
TDH_ECOHS       ----------------------------------------------------------------------
TDH_ECO8A       ----------------------------------------------------------------------
TDH_ECO81       ----------------------------------------------------------------------
TDH_ECO7I       ----------------------------------------------------------------------
TDH_ECO55       ----------------------------------------------------------------------
TDH_ECO45       ----------------------------------------------------------------------
TDH_ECO27       ----------------------------------------------------------------------
TDH_ECO24       ----------------------------------------------------------------------
PTGR2_RAT       ----------------------------------------------------------------------
DHB12_BOVIN     ----------------------------------------------------------------------
TDH_VIBPA       ----------------------------------------------------------------------
TDH_PHOPR       ----------------------------------------------------------------------
NADE_NOCFA      ----------------------------------------------------------------------
TDH_MARMS       -----------------TDVPHPDCGHNDVVIKISKTAICGTDIYQAQNTIPVPMTV----GHEFVGVIV
TDH_ECO5E       ----------------------------------------------------------------------
TDH_ECO57       ----------------------------------------------------------------------
DHB12_MACFA     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GGDLSHPANRFGLKAGDRVCALVQGGGYAELCTAPIEQCLPVPEGLTDIEAAALPETFFTVWSNVFDRGQ
QORX_HUMAN      --ELG-PGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGN
QOR_CAVPO       GNDVS------AFKKGDRVFTTSTSGGYAEYALASDHTVYRLPEKLDFRQGAAIGIPYFTACRALFHSAR
QOR_HUMAN       AGD-----NASAFKKGDRVTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAY-----RAL
QOR_PONAB       GGNAS------AFKKGDRVTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSAH
QOR_MOUSE       GDKVS------AFKKGDRVCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSAR
QOR_RAT         GDGVS------AFKKGDRVCFSTVSGGYAEFALSADNTTYPLPETLDFRQGAALGIPYFTACRALFHSAR
QOR_BOVIN       GESVS------AFKKGDRVFTTTISGGYAEYALAADHTVYTLPEKLDFKQGAAIGIPYFTAYRALLHSAC
QOR_LAMGU       GERVS------AFKKGDRVFTTTVSGGYAEYALAADHTVYKLPGELDFQKGAAIGVPYFTAY-----RAL
QOR_PIG         GEHVS------SFKKGDRVFTVTLSGGYAEYALAADDTVYMLPEKLDFKQGAAIGIPYFTACLALLHSAC
VAT1_DANRE      GEEVT------DRKVGDKVLVLNRSGMWQEVVVVASTHTFLMPEGMSFEEAAALPVNYITAYMMLFDFGH
QOR_SALTY       GNGVEH------IRVGDRVVAQSTLGAYSSVHNVTADKAAILPDAISFEQAAASFLKGLTVFYLLRKTYE
MCAS_MYCBO      XXXXXXXXHQ----VGDRVGGFSEGGCWRTFLTCDANLAVTLPPGLTDEQXXXXXXXXXXXWYGLNDLAQ
FAS_RAT         GMEFSGRD-----KCGRRVMGLVPAEGLATSVLLSPDFLWDVPSSWTLEEAASVPVVYTTAYYSLVVRGR
QORL2_BOVIN     GTDVST------VKEGDRVIGLPGFSGMAEECITDHKNLWQIPEKVSLREAAALPVSYGTAIFALEHRAQ
ADH_SULTO       GGDLEGEGNCYYCRIGERWLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTYRAV-----
FAS_MOUSE       -------------RCGRRVMGLVPAEGLATSVLLSSDFLWDVPSSWTLEEAASVPVVYTTAYYSLVVRGR
QOR_PSEAE       XXXXXXXXTRF--KVGDRVAATGPLGAYSELHVLAEEKLVHLPDGIDFEQAAAVMLKGLTTQYLLRQTYE
QOR_ECOLI       GSGVKH------IKAGDRVVYAQSAGAYSSVHNIIADKAAILPAAISFEQAAASFLKGLTVYYLLRKTYE
FAS_HUMAN       --------------SGKRVMGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGR
FAS_BOVIN       --------------SGKRVMGLVPAEGLATSTLVPQSFLWDVPSNWTLEEAASVPVVYSTAYYALMVRGR
QORL2_RAT       GADVST------VKKGDRVIGVSNFHSMAEQCITDQKTLWRIPENVSLQDAAVLPVSYGTAILAVDHRAR
YOGA_BACSU      QTEVVFPTLNWDLTENVPPVPEILGGPLAEYVIIPSQNAIKKPAYLSWEEAGVLPLSALTAYRALFTKGQ
VAT1_MOUSE      XXXXXXXDR----KAGDRVMVLNRSGMWQEEVTVPSAQTFLMPEAMTFEEAAALLVNYITAYMVLFDFGN
QORL2_MOUSE     GTDVST------VKKGDRVIGVSSFHAMAEQCITDQKTLWRIPENVSLQDAAVLPVSYGTAILAVDHRAR
YGD6_SCHPO      GEDVE------GFEKGDSVVCNTRDGCFQKYAVLPAHALVHAPKNLSFEEIATLPCAAVTAWNGLFGSKE
VAT1_HUMAN      XXXXXXSDR----KAGDRVMVLNRSGMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGN
VAT1L_MOUSE     AGD-----SVKGYEIGDRVMAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTAYTMLFEIAN
RT4I1_BOVIN     GRDVSGVVMECGLKPGDEVWAAVKQGTLSEFVVVSGNEVSHKPRSLTHTQAASLPYVALTAWSAINKVGG
VAT1L_HUMAN     AGD-----SVKGYEIGDRVMAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVAN
ADH2_BACST      --EVAKGVK--SIKVGDRVCLTGQDGGYAEYCKAPADYVAKIPDNLDPVEVAPI------LCAGVTTYKA
QORL2_NEMVE     GSKVT------SLSKGDRVLGVCQGGGMAEECVLPQTALWKIPSSLSFTQAAALAISYGTAYIGLKHKAN
RT4I1_DANRE     GRDVSGEIMECGLKPGDQVWAAIKQGSLAEFVVVSGNEVSHKPKSLRHDEAASIPYVAATAWSAIVNTGG
PKS37_DICDI     -----------------------------------------------------IPIVFLTSWYSIVIQGR
RT4I1_HUMAN     GRDVSGVVMECGLKPGDEVWAAVKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGG
ZADH2_HUMAN     ALGLSASAR---YTVGQAV-AYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGT--TAYISLKELGG
ZADH2_BOVIN     ALGLSASA---AFMVGQAV-AYMAPGSFAEYTVVPARVAIPVP-GLKP-EYLTLLVSGTTAYISLKELGG
RT4I1_MOUSE     GRDVSGVVMECGLQPGDEVWAAVKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGG
VAT1_TORCA      AGDLV-----IDRKVGDKIIMLIDGGLWTELVVTTVNRTFLMPDGMSFQEAAAISVNYTAAYVMIYDFAN
QOR_SCHPO       XXXXXXXXXXXXFKVGDRVVYLTPFGAYAQYTNVPTTLVSKVSEKILKIASAALLQTAYTLIEEAY----
QOR_LEIAM       ----QIGAGVANVKVGDHV-VLMQYGCFAEFLDAPAERCIPVPE--LKPEYSVLPVSALTAAVALGEVGR
QORL_ARATH      XXXXXXXXXXXXLKEGDEVYANVQFGSLAEY-TAVEEKLLALPKNIDFAQAAGLPLAIETA-----DEG-
ADH1_KLUMA      GWEIGDYAGIKWLNGSCMSCGYTHDGSFQQYATADAVQAARIPKNVDLAEVAPILCAGVTVYK------A
ZDH1_STAEQ      -------------KIGDQV-SMFQEGDVVFYSGSPIEEYLKAPTNLKSEQAASLPLTGLTAYETLFDVFG
FAS_CHICK       --------------AGRRVMGLLPAKGLATVVDCDKRFLWEVPENWTLEEXXXXXXXXXXXXXXXXXRGG
ADH1_EMENI      AGELVHEGDQAGIKSDDPLCARAQLSGYTQYALGKASHASKIPAGVPLDAAAPVLCAGITVYKGLKEAGV
ADH1_NEUCR      GDHASCLACSFCMQADEPLCALLSGGSFQQYAIAKAAHVAKIPKGCDLETTAPVLCAGITVYKGLKESGV
ZDH1_STAES      -------------KIGDQV-SMFQEGDVVFYSGSPIEEYLKAPTNLKSEQAASLPLTGLTAYETLFDVFG
ADH_SULSR       GGDLQGEGNCYYCRIGERWLGINFDGAYAEYVLNPHYKYMYKLRRLNAVEASPLTCSGITTYRAV-----
ZADH2_MOUSE     ALGLSASAR---YTVGQAV-AYMAPGSFAEYTVVPASIAIPMPSVKPEYLTMLVSGTTAYXXXXXXXXXX
QOR_YEAST       ----AKGKGVTNFEVGDQV-AYISNSTFAQYSKISSQPVMKLPKGTSDEEAAGLLQVL-TALSFTNEAYH
ADH_SCHPO       XXXXXXTRLKIGMKAEETICPHIQLSGYTHYCIANATHATIIPESVPLEVAAPIMCAGITCYR------A
ADH2_KLULA      SCEYCELSNESNCPDAD-LSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVYK------A
PKS16_DICDI     R---VAPSGVTRFKVGDQVVGFASHS-LSSLAITHQDKIVLKPENISFNEAAAVCVVYATSYYSIFHIGA
DHSO_BACHD      --ELGEGVT--GFNVGDRVTSETQDGSFAKYVIARQESLHHLPAGVDDRSAAMTEPLACT--HHAIAKTS
PKS25_DICDI     GLDFSGRVSRVGIKSGDEVYGIGQSTSSSHIIIDSMHACHK-PSKITHVQAASIPAVYATSIHSLYNIGN
ZDH1_STAAC      TGDVVFYAGSPNRQGSNATYQLVSEAIVAK-----------APHNISANEAVSLPLTGITAYETFFDTFK
ZDH1_STAAW      TGDVVFYAGSPNRQGSNATYQLVSEAIVAK-----------APHNISANEAVSLPLTGITAYETFFDTFK
ZDH1_STAAS      TGDVVFYAGSPNRQGSNATYQLVSEAIVAK-----------APHNISANEAVSLPLTGITAYETFFDTFK
ADH1_PICST      XXXXXXXSNVTGWELGDYACAKADLSGYTQYATADAVQAARLPKGTDLAQAAPILCAGITVYK-------
ZDH1_STAAR      TGDVVFYAGSPNRQGSNATYQLVSEAIVAK-----------APHNISANEAVSLPLTGITAYETFFDTFK
PKS21_DICDI     R--ISNENQNCEFKVGDNVFGIACDTTASHVI-ADVLYVSHKPENISHVEAASLPVIFSTCLHGMFNIGN
ADH1_BACST      XXXXXXXXXXTHLKVGDRVCERQQNGGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTG-
ZDH1_STAAN      TGDVVFYAGSPNRQGSNATYQLVSEAIVAK-----------APHNISANEAVSLPLTGITAYETFFDTFK
ZDH1_STAAM      TGDVVFYAGSPNRQGSNATYQLVSEAIVAK-----------APHNISANEAVSLPLTGITAYETFFDTFK
TOXD_COCCA      GRSVKKP-----FKKGDRVCGFAHGGNFAEVITVKGDIQAWIPENLSFQEAATLGVGIKTVGQGLYQSLK
ADHA_RHIME      GAEVTR------LKEGDRVCCTPCRTGWETLCGSQQNTGYSVDGGLADPDVGRLPARLFGPAAPVLCAGV
PKS18_DICDI     GNNITN------FEIGDQV----YGMGLDTISTHVINYCYHKPTNISFQEAASIPCVYLTSLCSIFNIGC
ADH3_BACST      XXXXXXXXXXTHLKVGDRVCLSGQDGGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTTYKALKVTG-
QORH_SPIOL      --QAGSAVNRF--KTGDKVVAVLSGGALAEYAVAKENLTVARPPEVSXXXXXXXXXXXXXXXXXLTQFAN
PKS2_DICDI      GDGVTK------FKVGDEVVGL----GFN--CTGSLEQFRFVPKNLTHVEAASIPVVYLTSYYSLFVAGY
ADH_SULSO       GGDLQGEGNCYYCRIGERWLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAV-----
YJMD_BACSU      GANISYCGSCYACRKGPNVCAKLEDGGMREYIVLPERQLHAVSKDLP-WEEAVMAEPY-TIGAQAVWRGQ
INC11_TRIAT     NGPGSGK-----FEPGTLVTALTKYDSDAEYINIPEKYLLAIPDGVDPKVAAALPVDWSTAYGMVHRAAK
ADH5_YEAST      ----KLGSNVKGWKVGDFACPYLDGTGFTEYATADAVQAAHIPPNVNLAEVAPILCAGITVYK-ALKRAN
ADH5_SACPS      ----KLGSNVKGWKVGDFACPYLDGTGFTEYATADAVQAAHIPPNVNLAEVAPILCAGITVYK-ALKRAN
PKS17_DICDI     R---VAPSGVTRFKVGDQVVGFASHSLSSHVTTHQNKIVLK-PENISFNEAAAVCVVYATSYYSIFHIGA
ADH3_KLULA      SCEYCELSNESNCPDAD-LSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVYK------A
ADH1_CANAL      XXXXXXXXXXKGWKIGDFACEFCQDGSFEQYATADAVQAAKIPAGTDLANVAPILCAGVTVYK------A
PKS19_DICDI     R--ISDENKNCEFKVGDNVFGVSHDATASHVIT-DVLYVSHKPNNISHIEAASLPIIFSTCLHGMFNIGN
PKS15_DICDI     GIDFSGIITRVGFKVGDEVYGIAFXXXXXXXXXXXXXX-VKKPTNLSHSEAASIPAVYLTSLYSIFNIGN
ADH4_KLULA      AKGENVKNFEIGDYAGIKSCELCEDGSFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVYK------A
QORH_ARATH      XXXXXXXXXK-NFKAGDKVVAVLSGGGLAEFAVATEKLTVKRPQXXXXXXXXXXXXXXXXXLQALTNPAG
YKM8_SCHPO      ----------------------------------------------------------------------
PKS41_DICDI     R--ISTGSKEF--KVGDHVYGIGKSTTSSHIIT-DIDVISHKPSNISHSEASSIPVVYLTSYHSLYNIGA
MECR_DROME      VGDKVK-----GFEAGQHVIPLASGGTWTTHAVYKEDQLLIVSKKVGLAEAATSTVNPTTAYRMLKDFVQ
ADH1_ASPFN      EFEIGDHAGEFCKQADEPLCPNASLSGYTQYAIGKATHASKLPKNVPLDAVAPVLCAGITVYKGLKESGV
MECR1_CAEEL     ----SVGSNVSSIKVGDHVIPDRSGGTWRELGLHQENDLFPIDNTLSMEYAATFQVNPPTAYRMLKDFID
ERYA2_SACER     GPDVD------AFAPGDRVLGLFQ-GAFAPIAVTDHRLLARVPDGWSDADAAAVPIAYTTAHYALHDLAG
YBJB_SCHPO      SG-ASHLVGTRVFGTSGSELSFTKDGTHAEYCIIPEKAAVRMPSNLSFTEAASVGVPFTTAYL------A
PTGR1_CAVPO     SKNSAFPAGSIVLAQSGWTTHFISDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTAYF----------GL
PKS28_DICDI     GNDFSGIITRLGFKVGDHVCGVASKTSGSHV-VIDYNFIYHQPLNYNHSISASIPSIYVTSLHSIYGVGN
YBI2_SCHPO      GSEVSATQRVWGCQSFPR--AGRQGGSCATHIVTGDKDVWHLPDGVSFNEGAGFGIAGLTAWEVLVRQMK
PKS40_DICDI     --NIGSGNKEF--KVGDSVYGTGKSTTSSHIIT-DIDVISHKPSNISHSEASSIPVVYLTSYHSLYNIGA
PKS1_DICDI      GSNVTE------YSVGQNVFGFARHSLGSHVVTNK-DLVILKPDTISFSEAASIPVVYCTAWYSLFNIGQ
TDH_PYRHO       -------------------------GVFAEYAVVPAQNIWKNPKSIPP-EYATLQEPLGNAVDTVL----
TDH_PYRAB       -------------------------GVFAEYAVVPAQNVWKNPKSIPP-EYATLQEPLGNAVDTVL----
RSPB_ECOLI      AVGEGVESARVGERVAPNVCTTLADGGFSEYAVVPAKNAWKIPEAVADQYAVMIEP--FTIAANVTGHGQ
TDH_THETN       -------------------------GAFAEYIKVP-ESNVWINDKNIPLEILSIQEPLGNAVHTVFSGDV
TDH_SYMTH       GREVT------ACKVGDYVCPRCHMGEY-HLCENT--KILGVDTDGAFAEYVAVPEQ--NIWVNDKDELQ
TDH_PYRFU       GKCYACKRGQYHVCQNTKIFGVDTDGVFAEYAVVPAQNVWKNPKNIPP-EYATLQEPLGNAVDTVL----
ADH2_PICST      QCEYCVTAHESNCPDAD-LSGYTHDGSFQQYATADAIQAARIPKGTDLALIAPILCAGITVYK-------
TDH_CHRVO       GQRVSGEGHITNCRAGRRLCRNTTGGAFAEYLVIPAFNAFPIPDDISD-DLASIFDPFGNAVHTALSFNL
TDH_ANADF       -------------------------GSFAEYVVIPADNVYRIPDDIPD-EVAAIFDPYGNATHTALSFEL
PKS31_DICDI     GNDFSGIITRLGFKVGDQVCGFGSKTNSSHVII-DFNSIYYKPLNCSHSVSASIPSIYITTLHSIYSIGN
PHAS_MYCTU      XXXXXXXDH----KVGDHVGGMSPNGCWGTFVTCDARLAATLPPGLGDXXXXXXXXXXXXXWYGLHELAR
PHAS_MYCTA      XXXXXXXDH----KVGDHVGGMSPNGCWGTFVTCDARLAATLPPGLGDXXXXXXXXXXXXXWYGLHELAR
PHAS_MYCBP      XXXXXXXDH----KVGDHVGGMSPNGCWGTFVTCDARLAATLPPGLGDXXXXXXXXXXXXXWYGLHELAR
PHAS_MYCBO      XXXXXXXDH----KVGDHVGGMSPNGCWGTFVTCDARLAATLPPGLGDXXXXXXXXXXXXXWYGLHELAR
ADH2_CANAL      XXXXXXXXXK-GWKVGDYACAEADLSGYTQYATADAVQAARIPAGTDLANVAPILCAGVTVYK------A
PKS13_DICDI     KVXXXXXXXEF--KVGDRVYGIGHNTTSSHI-TIDSRYASLIPNSLDYIEAXXXXXXXXXXXXGIFDIGN
ADH1_KLULA      SCEYCELSNESNCPEAD-LSGYTHDGSFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVYK------A
TDH_THET2       GPGVKRPTGNYHVCLNTKILGVDRDGGFAEYVVVPAENAWVNPKDL-PFEVAAILEPFGNAVHTVY----
PKS5_DICDI      GNNVKD------YKVGDNVF------GLSNSCTSSNERIQIKPSNISHIEAASIPIDYLTSFMSLFNVGC
PKS39_DICDI     GNDFSGIITRLGFKVGDQVCGFGSKTNSSHIIVDS-DSIYYKPLYYSHSVSASIPSIYITSLHSIYGIGN
PKS45_DICDI     -SRIGSKVTKF--KVGDSVLGISWKSTSSHAINYQDAFVLK-PDNISFVEAASIPLVYCTSFYSLFYSGN
YHFP_BACSU      SSNDPRFAEGDEVIATSYELGVSRDGGLSEYASVPGDWLVPLPQNLSLKEAMVYGTAGFTAALSVHRLEQ
PKS7_DICDI      GNNVKD------YKVGDNVFGLSNSCTSSHIVTN-FKNIQLKPSKISHIEASSIPIDYLASFISLFNVGS
ADH_STAAW       GKVIEVAEDVESLKIGDRVCRSVKNAGYAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAV-----
ADH_STAAS       GKVIEVAEDVESLKIGDRVCRSVKNAGYAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAV-----
ADH_STAAR       GKVIEVAEDVESLKIGDRVCRSVKNAGYAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAV-----
ADH_STAAN       GKVIEVAEDVESLKIGDRVCRSVKNAGYAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAV-----
ADH_STAAM       GKVIEVAEDVESLKIGDRVCRSVKNAGYAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAV-----
ADH_STAAC       GKVIEVAEDVESLKIGDRVCRSVKNAGYAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAV-----
ADH_STAAB       GKVIEVAEDVESLKIGDRVCRSVKNAGYAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAV-----
ADH_STAA8       GKVIEVAEDVESLKIGDRVCRSVKNAGYAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAV-----
ADH_STAA3       GKVIEVAEDVESLKIGDRVCRSVKNAGYAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAV-----
PKS3_DICDI      GSDFSGVITRVSFKVGDQV----YGTAYNTASSKSIIDSGSIPNNLSHEQASTIPVVYSTSLHSIYNIGN
TDH_THET8       GDHVSCPACRTGVCLNTQILGVDRDGGFAEYVVVPAENAWVNPKDL-PFEVAAILEPFGNAVHTVY----
TDH_THEON       GKCYACKHNRYHVCQNTKIFGVDMDGVFAEYAIVPAQNAWKNPKDMPP-EYATLQEPLGNAVDTVL----
YNN4_YEAST      KLGPNVDAARFAI--GDYIYGVIHGGAFAEYSAISSETAYKLPEGVKSLEGASLPVSLTTILTHSFGLDM
ADH1_YEAST      ACEYCELGNESNCPHAD-LSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANL
ADH2_YEAST      ACEYCELGNESNCPHAD-LSGYTHDGSFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVYK------A
ADH_RALEU       AGAICPNFNSYGVASQDGSYLMASGGTQAEYVLVPDAQATPIPDGLTDEQVLMCPD----IMSTGFKGAE
TDH_PYRKO       GKCYACKHNRYHVCQNTKIFGVDMDGVFAHYAIVPAKNAWKNPKDMPP-EYAALQEPLGNAVDTVL----
ADH_SULAC       DPWIGDGSCHYCKIGEDQYCGINVNGGYGEYVLVPDYRYMFKLRNLSTSTASPLACSGVTAYR------A
PKS44_DICDI     GFECSGIVSRIGFKVGDSVLGISWKSTSSHAINYQDAFVLK-PDNISFVEAASIPIVYCTSFYSLFYSGN
PKS29_DICDI     GKDFSGIITRLGFKVGDQVCGVGSKTSSSHIIV-DYDYIYYKPLNYSHSVSALIPSVYITSLHSLYGIGS
MECR_RAT        GSSVS------GLKPGDWVIPANAGGTWRTEAVFSEEALIGVPKDIPLQSAATLGVNPCTAYRMLVDFEQ
ETR1_YARLI      GGNVLDPGAKSGLKKGDWVLRKTCFGTWRSHALVEADTVVKIDNDLTKVQATTVSVNPSTAYEMLKDLKE
ADH2_KLUMA      XXXXXXXDNVKGWKIGDLLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGVTVYK------A
DHSO_BACSU      A--VGSSVDQF--KVGDRVCEACKEGRY-NLCTPPVDGAFVIPDSLSYEEAALIEP--FSVGIHAAARTK
TDH_SACEN       GDFVSGEGHLVNCRAGRRLCANTRGGAFAEYAVLP-EQNVWVHREHVDPDVAAIFDPFGNAVHTALTFPV
P2_ARATH        ----------------------------------------------------------------------
MECR_HUMAN      VG-----SNVTGLKPGDWVIPANAGGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQ
PTGR1_RABIT     SKNPAWPVGTLVLAHSGWASHSISDGQQLEKLLTEWPDTLPLSLALGTVGMPGITAYF----------GL
PKS32_DICDI     --------------------------------------------------SASIPSIYITSLHSIYSIGN
PKS22_DICDI     ---------------------------------------------------ASISLVYLTSYCSLFELGR
TDH_COXBU       VGDRVSGEGHINCRAGKRLCRYTVGGAFAEYLVIPAKNAYKIPAKISD-DIAAILDPFGNAAHSALEFDL
TDH_COXBR       VGDRVSGEGHINCRAGKRLCRYTVGGAFAEYLVIPAKNAYKIPAKISD-DIAAILDPFGNAAHSALEFDL
TDH_COXBN       VGDRVSGEGHINCRAGKRLCRYTVGGAFAEYLVIPAKNAYKIPAKISD-DIAAILDPFGNAAHSALEFDL
TDH_COXB2       VGDRVSGEGHINCRAGKRLCRYTVGGAFAEYLVIPAKNAYKIPAKISD-DIAAILDPFGNAAHSALEFDL
PKS8_DICDI      GNNVKD------YKVGDNVFGLSNSCTSSHIVTN-FKNIQLKPSNISHNEASSIPIDYLTSFMSLFNVGS
YFMJ_BACSU      DGN--------HLKKGDIVIGNLSWQEFSAVSESALRK---IDTSLAPASAGILGMTGLTAYFGLLDIGR
ADHP_ECOLI      GPGVT------SLKPGDRLCRSVKNAGYAEECIVVADYAVKVPDGLDSAAASSITCAGVTTYKAV----K
PTGR1_MOUSE     ----------------------------------------------------------------------
PKS6_DICDI      GNNVKD------YKVGDNVFGLSNSCTSSHIVTN-FKKIQIKPSKISHIEASSIPIDYLTSFMSLFNVGS
PKS14_DICDI     GSNIND------FKIGDQI----YGIGYDTTSTHIINQIYHKPTNINHIEAASIPGVYLTSYHSIFNVGN
MECR_DANRE      VGDKVKT-----LKVGDWVIPKDAGGTWRTAAVLKADDLVTLPKDIPVLSAATLGVNPCTAYRMLTDFEE
ADH1_ZYMMO      GEGVT------SLKVGDRLCRNVENAGYAEECIVVADYSVKVPDGLDPAVASSITCAGVTTYKAV-KVSQ
PKS9_DICDI      GNNVKD------YKVGDNVFGLSNSCTSSHIVTN-YKKIQIKPSNLSHNEASSIPIDYLTSFMSLFNIGS
TDH_BURXL       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLVIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
TDH_BURS3       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLASIFDPFGNATHTALSFNL
TDH_BURPP       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLVIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
PKS38_DICDI     GNDFSGIITRLGFKVGDQVCGVGSKTNSSHIIV-DYNYIYYKPLNYSYSVSASIPSVYITSLHSIYNIGN
P1_ARATH        ----------------------------------------------------------------------
YDJJ_ECOLI      A--VGSRVRKF--KPGDRVCRYCLEGKY-NICTQPLTHYLCHPESFT----YKLPDNMDTMEGALVEPAA
TDH_PROAC       SGEGHYVCGRCACLAGKRLCRNTQGIGYA--VNGAYCQYFVMPAGNVDPDVAAIFDPFGNAVHTALQFPC
TDH_LEGPA       GQRVSHITCGFNCRAGKRLCRNTLGVGFAEYLALPATNVIALPDNITEEQAAILPFGNAAHCALAFDV--
TDH_BURCJ       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLASIFDPFGNATHTALSFNL
TDH_BURCH       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLASIFDPFGNATHTALSFNL
TDH_BURCC       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLASIFDPFGNATHTALSFNL
TDH_BURCA       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLASIFDPFGNATHTALSFNL
PKS33_DICDI     -------------KVGDQVCGIGPKASSSHVIV-DFNFIYYKPFNCNHSVSASIPSIYITSLHSIYSIGN
ADH3_YEAST      ----KLGSNVKGWKVGDMTCEFCESGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVYK------A
PKS34_DICDI     -------------KVGDQVCGIGSKASSSHVIV-DFTSIYYKPLNYSHSVSASIPSIYITSLHSIYSIGN
MECR_MOUSE      AVGSSVSA----LKPGDWVIPANAGGTWRTEAVFSEEALIGIPKDIPLQSAATLGVNPCTAYRMLVDFEQ
MECR2_CAEEL     ---KAGSGSRF--KSGDHVTIFSANTPWTEFGVVDDDELVKLDNRIPLDLAATLMINPPTAWIMLKKYVN
TDH_BURCM       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLASIFDPFGNATHTALSFNL
TDH_BACLD       ----------------------------------------------------------------------
PKS27_DICDI     R--LGSDAERNKFKVGDHVCGVASKTSGSHV-VIDYNFIYHQPLNYNHSISASIPSIYITSLHSIYGVGN
PKS23_DICDI     GKNVTK------FKVGDHV----MGGAFHTFSSSDQDRIELKPSNISWFEASQ-SLVYLTSYCSLFELGR
ADH3_EMENI      AGELVKDED---FKIGDRAGIKWLNGSCCEMCMQADEPLCPIPDNVPLDAAAPILCAGITVYKGLKESGA
TDH_YERPY       GDRVSHCRNCRGGRT--HLCRNTVGGSFAEYLVIPAFNAFKIPDNISD-ELAAIFDPFGNAVHTALSFDL
TDH_YERPS       GDRVSHCRNCRGGRT--HLCRNTVGGSFAEYLVIPAFNAFKIPDNISD-ELAAIFDPFGNAVHTALSFDL
TDH_YERPB       GDRVSHCRNCRGGRT--HLCRNTVGGSFAEYLVIPAFNAFKIPDNISD-ELAAIFDPFGNAVHTALSFDL
TDH_YERP3       GDRVSHCRNCRGGRT--HLCRNTVGGSFAEYLVIPAFNAFKIPDNISD-ELAAIFDPFGNAVHTALSFDL
TDH_BURA4       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLASIFDPFGNATHTALSFNL
CIPB_EMENI      GPNVARPGDRVVGHAVGMATKRLQDNAFQAYTILQTNMASQLPSEISYEDAAVLPLGLSTAASGLFQ---
CADH3_ARATH     -------------------------GGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITVYSPMKYYGM
ADH2_EMENI      -----------GLCFNQKVSGYYTPGTFQQYVLGPAQYVTPIPDGLPSAEAAPLLCAGVTVYAS------
TDH_BURP8       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLVIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
TDH_SHEWM       GDRVSGEAGRTHLCRNTSGVGVNRDGAFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_SERP5       GDRVSHCRNCRGGRT--HLCRNTTGGSFAEYLVIPAFNAFKIPDNISD-ELASIFDPFGNAVHTALSFDL
TDH_LEGPL       GQRVSHITCGFNCRAGKRLCRNTLGVGFAEYLALPATNVIALPDNITEEQAAILPFGNAAHCALAFDV--
TDH_LEGPH       GQRVSHITCGFNCRAGKRLCRNTLGVGFAEYLALPATNVIALPDNITEEQAAILPFGNAAHCALAFDV--
TDH_LEGPC       GQRVSHITCGFNCRAGKRLCRNTLGVGFAEYLALPATNVIALPDNITEEQAAILPFGNAAHCALAFDV--
TDH_BURM1       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLASIFDPFGNATHTALSFNL
TDH_BURPS       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
TDH_BURP6       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
TDH_BURP1       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
TDH_BURP0       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
TDH_BURMS       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
TDH_BURMA       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
TDH_BURM9       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
TDH_BURM7       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
TDH_BACSU       GVG----ENVSSVKVGEYVSAIVCGEGKSHVCTNTA--IIGVDTAGCFAEYVKVPAD--NIWRNPADMDP
TDH_PSYIN       -------------------------GAFAEYLVIPAFNAFKIPAGISD-DLASIFDPFGNAVHSALSFDV
TDH_BURVG       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLASIFDPFGNATHTALSFNL
PKS30_DICDI     --------------------------------------------------SASIPSIYITSLHSIYSIGN
CADH2_ARATH     -------------------------GGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITVYSPMKYYGM
YL460_YEAST     --KLGPAVNPKDFSIGDYIYGFIHGGAFAEYSAISTVVAYKSPNELKFLGEDVLPEGVATIPVSLTTAGN
YDJL_ECOLI      ------------------------GGGFSKYCLVPGEALWEIPDGV-DYEDAAVLDPICNAYKSIAQQSK
TDH_BURTA       GDRVSHITCGFNCRAGRRLCRNTVGGAFAEYLAIPAFNAFKIPPEISD-DLAAIFDPFGNATHTALSFNL
MECR_DICDI      ----------------------------------------------------------------------
YCZ2_YEAST      --KLGPAVDPKDFSIGDYIYGFIHGGAFAEYSAISTVVAYKSPNELKFLGEDVLPEGAATIPVSLTTAGN
TDH_SHESH       GDRVSHCRNCRGGRT--HLCRNTSGGAFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_SHEAM       -------------------------GSFAEYLVIPAFNAFKIPDDISD-DLAAIFDPFGNAVHTALSFDL
TDH_RHIL3       -------------------------GSFGEFVCIPESNVVPIPDDISD-EIAAIFDPFGNAVHTALSFDL
TDH_RHIEC       -------------------------GSFGEFVCIPESNVVPIPDDISD-EIAAIFDPFGNAVHTALSFDL
TDH_RHIE6       -------------------------GSFGEFVCIPESNVVPIPDDISD-EIAAIFDPFGNAVHTALSFDL
PTGR1_RAT       ----------------------------------------------------------------------
TDH_SHEFN       GDRVSGEAGRTHLCRNTSGVGVNRDGAFAEYLVLPAFNAFKIPADIPD-DLAAIFDPFGNAVHTALSFDL
TDH_ANADE       ----------------------------------------------------------------------
PTGR1_BOVIN     SKNSAFPTGTIVLAPSGWTTHSISNGEKLEKVLAEWPDTLPLSLALGTVGMPGLTAYF----------GL
ETR1_SCHPO      NEGLVEVVD-----VGDQFKGTFSPGQWAILGSVNLRSLVPVDKSASIAEAATLSVNPCTAYCLLQHVVQ
CADH_SACOF      -------------------------GGFASTMVVDQKFVMKIPAGLAPEQAAPLLCAGVTVYSPLKAFGL
TDH_SOLUE       AGDIVSGEGHVNCFAGRRLCAKTMGGAFAEYIALPMTNIWRHHEGI-DLDVAAIFDPFGNAVHTALSFPV
TDH_ANASK       ----------------------------------------------------------------------
TDH_ANAD2       ----------------------------------------------------------------------
PTGR1_PIG       ----------------------------------------------------------------------
ADH_STAEQ       GRVIEVADNVDSLKVGDRVSIMYAACGNCEYCTTGRETCRDVLNAGYTVDGAMAEEV-------IVDANY
TDH_AGRRK       -------------------------GSFGEFVCIPESNVVPIPDDIPD-EVAAIFDPFGNAVHTALSFDL
FADH_AMYME      GVDSVQPGDKMTLTDGTELTPALGIGAFADKTLVHAGQCTKVDPAADPAVAGLLGCGVMAGLGAAVNTGA
TDH_VIBCM       -------------------------GCFSEYLVIPAFNAFKIPDGISD-DLASIFDPFGNAVHTALSFDL
TDH_VIBCH       -------------------------GCFSEYLVIPAFNAFKIPDGISD-DLASIFDPFGNAVHTALSFDL
TDH_VIBC3       -------------------------GCFSEYLVIPAFNAFKIPDGISD-DLASIFDPFGNAVHTALSFDL
TDH_SHESW       -------------------------GSFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_SHEPA       -------------------------GAFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_PSEHT       GDRVSGEAGRVHLCRNTTGVGVNREGAFAEYLVIPAFNAFKIPDNISD-ELASIFDPFGNAVHTALSFDL
PKS42_DICDI     GNDFSGVITRIGFKVGDEVCGLAPKTSASHIITEEGYLCKK-PSNISHSEAASSVTVYTTSFQSIYSIGD
DOIAD_STRKN     NGANGHDQSLVGKNVGDQELGFTKDGACAEYMTIPVDNLRPLPDALS-LRSACQVEP-LAVALNAVSIAG
TDH_YERE8       GDRVSHCRNCRGGRT--HLCRNTVGGSFAEYLVIPAFNAFKIPDNISD-ELAAIFDPFGNAVHTALSFDL
TDH_SHESR       --DIGQEVR--GFKIGDRVCRNTSGGSFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_SHEPC       --DIGQEVR--GFKIGDRVCRNTSGGSFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_SHEB9       -------------------------GSFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_SHEB5       -------------------------GSFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_SHEB2       -------------------------GSFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_PSEA6       -----------------------RAGAFAEYLSIPAFNAFKIPDNISD-DLAAIFDPFGNAVHTALSFDL
ADH_STAES       GRVIKIADNVDSLKVGDRVSIMYAACGNCEYCTTGRETCRDVLNAGYTVDGAMAEEV-------IVDANY
TDH_SHESM       --DIGQEVR--GFKIGDRVCRNTSGGSFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_SHESA       --DIGQEVR--GFKIGDRVCRNTSGGSFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_SHEHH       -------------------------GAFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_RHILW       -------------------------GSFGEFVCIPESNVVAIPEDISD-EIAAIFDPFGNAVHTALSFDL
TDH_PHOLL       GQEVK------GFKIGDRVCRNCRGGRFAQYLVIPAFNAFKIPDNISD-ELAAIFDPFGNAVHTALSFDL
RT4I1_DICDI     GRECSGEIVEIGYEIGDQVWSAFSMGSHCEYITVDESEISLKPKNLTHQQSASIPFASLTAWNAIYN-VL
TDH_SHEON       -------------------------GSFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_EDWI9       GDRVSGEAGRTHLCRNTIGVGVNRQGAFAEYLVIPAFNAFKIPDNIPDA-LAAIFDPFGNAVHTALSFDL
DHSO_HUMAN      GSSVKHPGDRVAIEPGDEFCKM---GRYIFFCATPPDDCYKLPDNVTFEEGALIEP--LSVGIHACRRGG
CADH4_ARATH     -------------------------GGFADTMIVNQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGL
PTGR2_MOUSE     ----------------------------------------------------------------------
PTGR1_HUMAN     ----------------------------------------------------------------------
DHSO_MACFA      GSLVKHPGDRVAIEPGDEFC---KSGRYIFFCATPPDDCYKLPDNVTFEEGALIEP--LSVGIHACRRGG
TDH_SHEB8       -------------------------GSFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
QORL1_HUMAN     --DVGSKVSFF--QPDDEVVGILEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLSH
QORL1_BOVIN     --DVGSKVSFF--QPDDEVVGILEDPGLCEAVRVHEHYLVHKPEKVTWTEAAGTIRDGLRVYTALHYLSH
BDHA_BACSU      ----------------------------------------------------------------------
TDH_SALAR       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ERWCT       GDRVSGEGHITNCRAGRRLCRNAIGGSFAEYLVIPAYNAFRIPDNISD-ELAAIFDPFGNAVHTALSFDL
TDH_SALTY       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SALSV       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SALPK       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SALPC       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SALPB       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SALPA       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SALNS       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SALHS       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SALEP       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SALDC       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SALCH       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SALA4       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_KLEP7       GDRVSGEAGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_KLEP3       GDRVSGEAGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_BACA2       ETG-KHVTN---VKTGDYVSAFVCGTGKHHVCTHT--KILGVDTAGSFAEYVKVPAR--NVWKNPADQEP
PTGR2_PONAB     ----------------------------------------------------------------------
TDH_SILPO       GQRVSSRAGKFHLDPGTRGIGVNVQGAFAQYLRLPAFNVVPLPEDIPD-EIGAILDPLGNAVHTALSFDL
TDH_SALG2       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPALNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_PROMH       -------------------------GCFAEYLVIPAFNAFKIPDNIPD-ELAAIFDPFGNAVHTALSFDL
TDH_ALTMD       -------------------------GAFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_AERS4       GDRVSGEAGRTHLCRNTIGVGVNRPGSFAEYLVIPAFNAFKLPDNIPD-ELAAIFDPFGNAVHTALSFDL
QORL1_MOUSE     --EVGRKVTFF--QPDDEVVGILEDPGLCEVIRVHEHYLVHKPEKVSWTEAAGVIRDGVRACTALYYLSQ
DOIAD_STRRY     CGSCRHTVGKPTLCADLQELGFTRDGACAEYMTVPTGNLHRLPEGLSLREA-------------------
DHSO_PONAB      GSLVKHPGDRVAIEPGDEFCKI---GRYIFFCATPPDDCYKLPDNVTFEEGAMIEP--LSVGIHACRRGG
CADH1_TOBAC     -------------------------GGFAKSMVVDQKFVVKIPEGMAPEQAAPLLCAGITVYSNHFGFKQ
TDH_SHELP       -------------------------GAFAEYLVIPAFNAFKIPDDISD-DLASIFDPFGNAVHTALSFDL
TDH_MESSB       -------------------------GAFAEYISLPQHNVVAIPDDVPD-EIAAIFDPLGNAVHTALSFDL
TDH_ESCF3       GDRVSGEAGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECOLI       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLAAIFDPFGNAVHTALSFDL
TDH_ECODH       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLAAIFDPFGNAVHTALSFDL
TDH_ECOBW       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLAAIFDPFGNAVHTALSFDL
PTGR2_HUMAN     ----------------------------------------------------------------------
CADH1_ORYSJ     GADVK------SFKVGDHVGVYVNSCRDCENCNSSLENCFKIPDGYPLEKAAPLLCAGITVYSPMMNMNQ
ADH_CLOBE       ----------------------------------------------------------------------
ADH1_ENTHI      ----------------------------------------------------------------------
YCJQ_SHIFL      ----------------------------------------------------------------------
YCJQ_ECOLI      ----------------------------------------------------------------------
TDH_SALTI       GDRVSHCRNCRGGRT--HLCRNTTGVGFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ENTS8       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
YMN1_YEAST      ---------------------------------------------------SVLGGTSLTAYFIFFTYAQ
TDH_SHISS       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECOLU       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_AERHH       GDRVSGEAGRTHLCRNTIGVGVNRPGAFAEYLVIPAFNAFKLPDNVPD-ELAAIFDPFGNAVHTALSFDL
YHDH_ECOLI      SEDPRFHAGQEVLLTGWGV-GENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTAMLCVMALED
TDH_SHIFL       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SHIF8       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SHIBS       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_SHIB3       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_RHISN       GKCRNCRAGRGHLCRNTLGVGVNRPGSFAEFVCLPEYNVVTIPDDVPD-EIAAIFDPFGNAVHTALSFDL
TDH_RHIME       -------------------------GSFAEFVCLPEYNVVSIPDDVPD-EIAAIFDPFGNAVHTALSFDL
TDH_ECOUT       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECOSM       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECOSE       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECOLC       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECOL6       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECOL5       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECOK1       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECOHS       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECO8A       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECO81       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECO7I       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECO55       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECO45       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECO27       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECO24       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
PTGR2_RAT       ----------------------------------------------------------------------
DHB12_BOVIN     ---------------------------------------------------------------------E
TDH_VIBPA       -------------------------GAFAEYLVIPAFNAFKIPDEISD-DLASIFDPFGNAVHTALSFDL
TDH_PHOPR       -------------------------GAFAEFLVIPAFNAFKIPAGISD-DLASIFDPFGNAVHTALSFDL
NADE_NOCFA      ----------------------------------------------------------------------
TDH_MARMS       GPEVS------GFKIGDRVCRKTLGGAFAEYLVIPASNAFKIPNNISD-DMAAIFDPFGNATHTALSFDL
TDH_ECO5E       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
TDH_ECO57       -------------------------GCFAEYLVIPAFNAFKIPDNISD-DLASIFDPFGNAVHTALSFDL
DHB12_MACFA     ---------------------------------------------------------------------E


                         +         .         .         .         .         *         .:210
query           LGKGPRGAAETLLIQGGSSGIGTTAIQIAKALGFKVFVTAGSDDKCKACESLGADRAINYKTQDFVAEVK
QORX_HUMAN      VQAG-----DYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATL
QOR_CAVPO       AKAG-----ESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKVVLQNGAHEVFNHRDAHYIDEIK
QOR_HUMAN       IHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIK
QOR_PONAB       VKAG-----ESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIK
QOR_MOUSE       ARAG-----ESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIK
QOR_RAT         ARAG-----ESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIK
QOR_BOVIN       VKPG-----ESVLVHGASGGVGIAACQIARAYGLKVLGTASTEEGQKIVLENGAHKVFNHKEADYIDKIK
QOR_LAMGU       LHSACAKAGESVLVHGASGGVGLAACQIARACCFKVLGTAGTEEGQRVVLQNGAHEVFNHREDINIDKIK
QOR_PIG         VKAG-----EIVLIHGASGGVGIAACQIARAYGLKVLGTAGTEEGQNIVLQNGAHEVFNHREVNYIDKIK
VAT1_DANRE      LRPN-----QSVLVHMAAGGVGIAATQLCKTVNDVTVFGTASASKHEVISQGGVTHPIDYRTRDYVEEVR
QOR_SALTY       VKPD-----EPFLFHAAAGGVGLIACQWAKALGAKLIGTVGSAQKAQRALDAGAWQVINYREESIVERVK
MCAS_MYCBO      IKAGDK-----VLIHSATGGVGQAAISIARAKGAEIFATAGNPAKRAMLRDMGVEHVYDSRSVEFAEQIR
FAS_RAT         IQHG-----ETVLIHSGSGGVGQAAISIALSLGCRVFTTVGSAEKRAYLQALDDTSFANSRDTSFEQHVL
QORL2_BOVIN     PGEXXXXXXXXXXXXXXXIDVATNILQA------KVIAAAGSDEKCQLAMQSGAQSSVNYSRGSLKEAVG
ADH_SULTO       -RKASLDPSKTLVVIGAGGGLGTMAIQIAKAVGATIIGVDVREEALEAAKRAGADYVINASSQDPVSEIR
FAS_MOUSE       IQRG-----ETVLIHSGSGGVGQAAISIALSLGCRVFTTVGSAEKRAYLQALDDTSFANSRDTSFEQHVL
QOR_PSEAE       LRGG-----ETILFHAAAGGVGLFACQWAKALGVQLIGTVSSPEKARLARQHGAWETIDYSHENVARRVL
QOR_ECOLI       IKPD-----EQFLFHAAAGGVGLIACQWAKALGAKLIGTVGTAQKAQSALKAGAWQVINYREEDLVERLK
FAS_HUMAN       VRPG-----ETLLIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQALDSTSFANSRDTSFEQHVL
FAS_BOVIN       MQPG-----ETVLIHSGSGGVGQAAIAIALSLGCRVFPLVGSAEKRAYLQSLNETSFANSRDTSFEQHVL
QORL2_RAT       IQPG-----EXXXXXXXXXXXXXXXIDVANVFCAKVIAAAGSDEKCKLAMQRGAQSGVNYSQGSLKDAVK
YOGA_BACSU      LKKG-----EHLLIPGIGSGVATYALFMAKAIGATVSVTSRSEEKRKKALKLGADYAF-----DSYSNWD
VAT1_MOUSE      LRPG-----HSXXXXXXXXXXXXXXXQLCRTVNVTVFGTA-SASKHEVLKENGVTHPIDYHTTDYVDEIK
QORL2_MOUSE     IQPGEXXXXXXXXXXXXXXXIDV-ATNVFRA---KVIAATGSDEKCKLAVQRGAQFSVNYSQGSLRDAVK
YGD6_SCHPO      HQVKPXXXXXXXXXXXXS----TFALQFALAAGANVTVTSSSDEKLEFAKKLGATHTINYKTPQWASPAL
VAT1_HUMAN      LQPG-----HSVLVHXXXXXXXXXXXQLCRTVNVTVFGTA-SASKHEALKENGVTHPIDYHTTDYVDEIK
VAT1L_MOUSE     LREG-----MSVLVHSXXXXXXXXXXXLCSTVNVTVFGTA-STFKHEAIKD--SVTHLFDRNADYVQEVK
RT4I1_BOVIN     LNDR-NCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVC-SQDASELVRKLGADDVIDYKSGNVEAQLK
VAT1L_HUMAN     LREG-----MSVLVHSXXXXXXXXXXXLCSTVNVTVFGTA-STFKHEAIKD--SVTHLFDRNADYVQEVK
ADH2_BACST      LKVSGARPGEWVAIY-GIGGLGHIALQYAKAMGLNVVAVDISDEKSKLAKDLGADIAINGLKED---PVK
QORL2_NEMVE     LQPGQXXXXXXXXXXXXXXXXXXXX----NVFGAKV-IGASRKEKLVIVQEIGATATIDYTRENIKDKVK
RT4I1_DANRE     LNKD-NSAKKRVLILGGSGGVGTFAIQMVKAWGAHVTVTC-SQNAERLVRDLGADDVVDYTAGPVEKQLK
PKS37_DICDI     LKKG-----EKILIHSGCGGVGLATIQISMMIGAEIHVTVGSNEKKQLIKEFGIDRIYSSRSLQFYNDLM
RT4I1_HUMAN     LND-KNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVC-SQDASELVRKLGADDVIDYKSGSVEEQLK
ZADH2_HUMAN     LSEGKK-----VLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEP-VGTVL
ZADH2_BOVIN     LSEGKK-----VLVTAAAGGTGQFAVQLAKKAKCHVIGTCSSAEKSAFLKSVGCDRPINYNT-EHVGTVL
RT4I1_MOUSE     LSKGKRA-----LILGASGGVGTFAIQVMKAWGAHVTAVC-SKDASELVRKLGADEVIDYTLGSVEEQLK
VAT1_TORCA      LRP-----SQSILIHMAAGGVGIAATQLCKLVHDVTIFGTASPSKHETIKENGVTYPIDYTTLDYAEEVR
QOR_SCHPO       ----PVKTGDTXXXXXXXXXXXXXXCQMLRARNVHVIATASTAAKRRIAIKNGAEIACSY--EDLTKVVA
QOR_LEIAM       VKKG-----DVALVXXXXXXXXQIAVQLLKVYGCTVIGTCSSEEKAEFLKSIGCDHVINYKTESLDGRLH
QORL_ARATH      LVRTEFSAGKSILVLNGAGGVGSLVIQLAKVYGASKVAATASTEKLELVRSLGADLAIDY-TKENIEDLP
ADH1_KLUMA      LKSAHIKAGDWVAISGACGGLGSLAIQYAKAMGYRVLGIDAGDEKAKLFKELGGEYFIDFKTKDMVAEVI
ZDH1_STAEQ      ISKEPENKGKSLLIINGAGGVGSIATQIAKFYGLKVITTASREDTIKWSVNMGADVVLNHK-KDLSQQFK
FAS_CHICK       MKKG-----ESVLIHSGSGGVGQAAIAIALSMGCRVFATVGSAEKREYLQALDANSFASSRNTTFQQHIL
ADH1_EMENI      ------RPGQTVAIVXXXXXXXXXXXXYAKAMGIRVVAVDGGDEKRAMCESLGTETYVDFKSKDLVADVK
ADH1_NEUCR      R------PGQCVAIVGAGGGLGSMAIQYANAMGLHAIAIDGGEEKGKNCRELGAQAYVDFTTKDLVADVK
ZDH1_STAES      ISKEPENKGKSLLIINGAGGVGSIATQIAKFYGLKVITTASREDTIKWSVNMGADVVLNHK-KDLSQQFK
ADH_SULSR       -RKASLDPTKXXXXXXXXXXXXXXXXQIAKAVGGATII--GVDVREEAVETAGADYVINASVQDPLAEIR
ZADH2_MOUSE     XXK-------KVLVTAAAGGTGQFAVQLSKIAKCHVIGTCSSDEKAAFLKSIGCDRPINYRTEP-VETVL
QOR_YEAST       VKKG-----DYVLLFAAAGGVGLILNQLLKMKGAHTIAVASTDEKLKIAKEYGAEYLINASKEDILRQVL
ADH_SCHPO       LKESKVGPGEWICIPGAGGGLGHLAVQYAKAMAMRVVAIDTGDDKAELVKSFGAEVFLDFKKEDMIEAVK
ADH2_KLULA      LKSADLKAGDWVAISGACGGLGSLAIQYAKAMGYRVLGIDTGAEKAKLFKELGGEYFVDYASKDLIKEIV
PKS16_DICDI     F----MADKESILVHSATGGVGLATLNLLKSNDASIYATVGSKEKVDYLQEKYGDAIYNSRDTEYCDEIK
DHSO_BACHD      INKG------DLVVVTGPGPIGLLAAQVAKSHGGTVIITGLSNDRLKKAKEVGIDYAIDTQEVDIKELVS
PKS25_DICDI     LREG-----ESILIHSGSGGVGLSALEILKSNNHSIFVTVGSEEKKQLITGIYSTRDTNYQKQIKNKLIE
ZDH1_STAAC      ISTNPENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNHK-EDLVRQFK
ZDH1_STAAW      ISHNPENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNHK-EDLVRQFK
ZDH1_STAAS      ISHNPENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNHK-EDLVRQFK
ADH1_PICST      -------ALKTAQIQPGNXXXXXXXXQYAKAMGFRVIAIDGGEEKGEFVKSLGAEAYVDFTSKDIVKDIQ
ZDH1_STAAR      ISHNPENIGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNHK-EDLVRQFK
PKS21_DICDI     FNIDD---DEVILIHSATGGIGLATLEILKWKGHKIFVTVGSKDKEQLIDNYGSTGIYSSRNKNYVNEIK
ADH1_BACST      -----AKPGEWVAIY-GIGGLGHVAVQYAKAMGLNVVAVDLGDEKLELAKQLGADLVVNPKHDDAAQWIK
ZDH1_STAAN      ISHNPENVGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNHK-EDLVRQFK
ZDH1_STAAM      ISHNPENVGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGADIVLNHK-EDLVRQFK
TOXD_COCCA      LSTTPIEHAVPILIYGGSTATGTLAIQLAKLSGYRV-ITTCSPHHFELMKSLGADLVFDYHEITSADHIR
ADHA_RHIME      TVY--KGLKETEVRPGGIGGLGHMAVQYAKAMGMHVAAADIFPDKLALAEKLGADLVVDARAPDAVEEVQ
PKS18_DICDI     LSVSGN---ESILIHSGTGGVGLSALNILKWKGHKVFVTVGSKEKEKYLLDTYGDRNKNYVEQ-IKLKLK
ADH3_BACST      -----AKPGEWVAIY-GIGGLGHVAVQYAKAMGLNVVAVDIGDEKLELAKELGADLVVNPLKEDAAKFMK
QORH_SPIOL      IKLDGSGERKNILITAASGGVGHYAVQLAKLGNTHVTATCGARN-LDFVKGLGADEVLDYKTPEGASLTS
PKS2_DICDI      LSIEKK---ESVLIHGGTGGIGLACINLLKAKGFKLFVTVGSKEKENFLRTYGNFITGIYSSQDYLLEIK
ADH_SULSO       -RKASLDPTKXXXXXXXXXXXXXXXXQIAKAVGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPLAEIR
YJMD_BACSU      VEKG-----DTVLIQGAGP-IGICVLKMAKLAGAAVMMTDLNNERLAFAKENGADAVVNVQAEHVAERVL
INC11_TRIAT     VSEGQR-----VFIHGISGAVGQAVMYLSLLQGATVYGTA-SERNHAALKEAGAHPYL-YTNKDWIAAMK
ADH5_YEAST      VIPG-----QWVTISGACGGLGSLAIQYALAMGYRVIGIDGGNAKRKLFEQLGGEIFIDFEEKDIVGAII
ADH5_SACPS      VIPG-----QWVTISGACGGLGSLAIQYALAMGYRVIGIDGGNAKRKLFEQLGGEIFIDFEEKDIVGAII
PKS17_DICDI     F----IADKESILVHSATGGVGLASLNLLKSNDASIYATVGSKEKIDYLQEKYGDAIYNSRDTEYCDEIK
ADH3_KLULA      LKSANLKAGDWVXXXXXXXXXXXXXVQYAKAMGYRVVGIDGGEEKGKLVKQLGGEAFVDFKTKDMVAEIQ
ADH1_CANAL      LKTADLAAGQWVAIXXXXXXXXXXXVQYARAMGLRVVAIDGGDEKGEFVKSLGAEAYVDFKDKDIVEAVK
PKS19_DICDI     FNIDD---DEVILIHSATGGIGLATLEILKWKGHKIFVTVGSKDKEQLIDNYGSTGIYSSRNKNYVNEIK
PKS15_DICDI     FNIQDN---ESILIHSGTGGVGLSALNILKWKGHKLFVTVGSKEKEQYLIDTYGDGIYSTRNKDYVKQIK
ADH4_KLULA      LKTADLKPGQWVXXXXXXXXXXXXXVQYAKAMGLRVLGIDGGDGKEELFKQCGGEVFIDFKSKDMVADIQ
QORH_ARATH      LKLDGTGKKANILVTAASGGVGHYAVQLAKLANAHVTATCGARN-IEFVKSLGADEVLDYKTPEGAA-LK
YKM8_SCHPO      ---GKPKAGETIYISAASGAVGQMAGQLAKAMGLHVVGSVGSDEKFKICLDSGYDSVFNYKKE---SPFK
PKS41_DICDI     LKNN-----ETILIHSATGGVGLSTLEILKWKGHSIFVTVGSNEKEEYLRENYGDMIYSTRNKNFVKQIK
MECR_DROME      LCPG-----DTVIQNGANSAVGQAVHQLCRAWGISVGIVRDRPEIAELKQMLQCLGATEVLTEAEIRTSD
ADH1_ASPFN      R------PGQTVAIVXXXXXXXXXXXQYAKAMGIRVVAIDGGEEKQAMCEQLGAEAYVDFKTQDLVADVK
MECR1_CAEEL     LKKG-----DTVAQNGANSAVGKHVIQICRILGIKTVNVVRSRDNVKELKDLGADEVI---TQEELYSRK
ERYA2_SACER     LRAG-----QSVLIHXXXXXXXXXXXXXXXXXXXXXXXTAG-PAKHGTLRALGLDHIASSRETGFARKFR
YBJB_SCHPO      LSRGETKGSDIXXXXXXXXXXXXXXCQIAEDWGCKVITVSGSTD-------------INTVVDPELKRVH
PTGR1_CAVPO     LEVCGVKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEAL
PKS28_DICDI     LKSN-----ESILIHSAAGGIGISSLDLLKCKKHQIFLTVGSKDKLKKNYGSFITAIYSSRNKDYVNEIK
YBI2_SCHPO      VKPGTK-----LVIEGASGGVGTFAVALAKALECEV-TTISSTENLDLCKSLGATHTLDYKKDNL---VE
PKS40_DICDI     LKNN-----ETILIHSATGGVGLSTLEILKWKGHSIFVTVGSNEKEEYLRENYGDMIYSTRNKNFVKQIK
PKS1_DICDI      LSN-----EESILIHSATGGVGLASXXXXXXXXXNVYATVGSNEKKKFLNNLFKEDGENFSTRD--KEYS
TDH_PYRHO       --AGPISGKSVLIT--GAGPLGLLGIAVAKASGYPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVM
TDH_PYRAB       --AGPISGKSVLIT--GAGPLGLLGIAVAKASGYPVIVSEPSDFRRELAKKVGADYVINPFEEDVVKEVM
RSPB_ECOLI      PTEN-----DTVLVY-GAGPIGLTIVQVLKGVVKNVIVADRIDERLEKAKESGADWAIN-NSQTPLGEI-
TDH_THETN       VGKS--------VAVIGCGPIGMMAIPLLKRTGAAIFAIEPADYRRELAHKLGATRVINPLREDVVSIIK
TDH_SYMTH       SIQEPLGNAVHTALNGGCGPIGIMSVPVAKMAGAEIVMAMDINERLQLAGQLGADVLINPTKQDPVEVVR
TDH_PYRFU       --AGPIAGKSVLIT--GAGPLGLLGIAVAKASGYPVIVSEPSEFRRNLAKKVGADYVINPFEEDVVKEVM
ADH2_PICST      -------ALKTAQLQAGQXXXXXXXIQYAKAMGYRVVGIDGGADKGEFAKSLGAEVFVDFSSKDVVADVL
TDH_CHRVO       VG-------EDVLITGAGP-IGIMAVAIAKHVGARVVITDVNDYRLELAKKMGATRAVNVAREDLKAVMQ
TDH_ANADF       VG-------EDVLVTGAGP-IGVMAVSIARHVGARVVVTDVNDYRLGLARRMGATRAVNVAREDLRAVMK
PKS31_DICDI     LKSN-----ESILIHSAAGGIGISSLDLLKSKQHQIFLTVGSKDKEELINKYGSLITAIYRNKDYVYEIK
PHAS_MYCTU      IRAG-----DTVLIHSXXXXXXXXXXXXXXXXXXXXXXXXXXPQRRELLRNMGIEHVYDSRSIEFAEQIR
PHAS_MYCTA      IRAG-----DTVLIHSXXXXXXXXXXXXXXXXXXXXXXXXXXPQRRELLRNMGIEHVYDSRSIEFAEQIR
PHAS_MYCBP      IRAG-----DTVLIHSXXXXXXXXXXXXXXXXXXXXXXXXXXPQRRELLRNMGIEHVYDSRSIEFAEQIR
PHAS_MYCBO      IRAG-----DTVLIHSXXXXXXXXXXXXXXXXXXXXXXXXXXPQRRELLRNMGIEHVYDSRSIEFAEQIR
ADH2_CANAL      LKTAELEAGQWVXXXXXXXXXXXXXVQYAKAMGYRVLAIDGGEDKGEFVKSLGAETFIDFXXXXXXXXXX
PKS13_DICDI     LDIQDN---ESILIHSGTGGIGLSALNSLRWKGHKLFVTVSSKEKEQYLDNYGSFITGIYSNKDIKEKLN
ADH1_KLULA      LKSANLKAGDWVXXXXXXXXXXXXXVQYAKAMGYRVLGIDAGEEKAKLFKDLGGEYFIDFKSKNIPEEVI
TDH_THET2       AGSGVSG--KSVLIT-GAGPIGLMAAMVARASGAGPILVSDPNPYRLAFARPYADRLVNPLEEDLLEVVR
PKS5_DICDI      LNIEDN---ESILIHLGSDSFGLSTFEILKWKGFKLFVTVNSDEKQYLLNNYGDLITAIYSNTDYVSQIK
PKS39_DICDI     LKSN-----ESILIHSAAGGVGLSSLDLLKSKQHQIFLTVGSKDKEELINKYGSLITAIYRNKNYVYEIK
PKS45_DICDI     LKIENN---ESVLIHQASGGIGLACLNILKSCGFKLYVTVGSKEKTGIYSSRNTDFLENIKTDDDVDQIL
YHFP_BACSU      NGLSPE--KXXXXXXXXXXXXXXXXXXMLNKRGYDVVASTGNREAADYLKQLGASEVIS-REDVYDGTLK
PKS7_DICDI      LNIEDN---ESILIHLGSDGFGLSTFEILKWKGFKLFVTVNSDEKQYLLDRYGDFISGIYSNTDYVTEIK
ADH_STAAW       --KVSNVKPGQWLGVFGIGGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVM
ADH_STAAS       --KVSNVKPGQWLGVFGIGGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVM
ADH_STAAR       --KVSNVKPGQWLGVFGIGGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVM
ADH_STAAN       --KVSNVKPGQWLGVFGIGGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVM
ADH_STAAM       --KVSNVKPGQWLGVFGIGGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVM
ADH_STAAC       --KVSNVKPGQWLGVFGIGGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVM
ADH_STAAB       --KVSNVKPGQWLGVFGIGGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVM
ADH_STAA8       --KVSNVKPGQWLGVFGIGGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVM
ADH_STAA3       --KVSNVKPGQWLGVFGIGGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEVM
PKS3_DICDI      LKN-----YESILIHSASGGVGLSSLNILKWKGHYIFLTVGSPEKEKYLDTYGSLITGIYSTRDYVQKIK
TDH_THET8       AGSGVSG--KSVLIT-GAGPIGLMAAMVVRASGAGPILVSDPNPYRLAFARPYADRLVNPLEEDLLEVVR
TDH_THEON       --AGPIAGRSTLIT--GAGPLGLLGIAVAKASGYPVIVSEPSEFRRELAKKVGADYVVNPFEEDPVKFVM
YNN4_YEAST      TWKPSKAQRDQILFWGGATAVGQMLIQLAKKLGFSKIIVVASRKHEKLLKEYGADELFDYHDADVIEQIK
ADH1_YEAST      M------AGHWVXXXXXXXXXXXXXVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFKEKDIVGAVL
ADH2_YEAST      LKSANLRAGHWXXXXXXXXXXXXXXVQYAKAMGYRVLGIDGGPGKEELFTSLGGEVFIDFKEKDIVSAVV
ADH_RALEU       NANIRIGHTVAVFAQGP---IGLCATAGARLCGATTIIAIGNDHRLEIARKMGADVVLNFRNCDVVDEVM
TDH_PYRKO       --AGPIAGRSTLIT--GAGPLGLLGIAVAKASGYPVIVSEPSEFRRKLAKKVGADYVVNPFEEDPVKFVM
ADH_SULAC       LRLANLDPSKSVMXXXXXXXXXXXXVQIAKAIGSFIIGVDVSEEGLKLATNLGADYVTSKVDEE---EVR
PKS44_DICDI     LSIKNN---ESVLIHQASGGIGLACLNILKSCGFKLYVTVGSKEKTGIYSSRNTDFLENIKTDXXESNIK
PKS29_DICDI     LKSN-----ESILIHSAAGGVGISSLDLLKSKQHQIFLTVGSKDKEELINKYGSLITAIYRNKDYVYEIK
MECR_RAT        LQPG-----DSVIQNASNSGVGQAVIQIASALGLKTINVIRDRPDIKRLKDLGADYVL-------TEEEL
ETR1_YARLI      --------GDWFIQNGGNSGVGRAAIQIGHIRGLKISVVRDRPDLKKELTDLGATHVITEEEASFSKQIK
ADH2_KLUMA      LKTAEMKAGDWVXXXXXXXXXXXXXVQYAKAMGFRVLGIDGGEGKEELFKSLGGEVFIDFKSKDIVGEVI
DHSO_BACSU      LQPG-----STIAIMGGPVGLMXXXXXXXXXXG-TIIVTDLEPLRLEAAKKMGATHIINIREQDALEEIK
TDH_SACEN       VG-------EDVLITGAGP-IGLMAACVARHAGARVVITDVSEHRLELARRVGVDLAVNVAETGIADAQA
P2_ARATH        ---------ETVYVSAASGAVGQLVGQFAKMMGCYVVGSAGSKEKVDLLKTFGFDDAFNYKEESDLSAAL
MECR_HUMAN      LQPG-----DSVIQNASNSGVGQAVIQIAAALGLRINVVRDRPDIQKLSDSLGAEHVI------------
PTGR1_RABIT     LEICGAKSGDTVLVNXXXXXXXXXXXQIAKIKGCRVVGAAGSEEKVDYLKKIGFDFAFNYKTVKSLEETL
PKS32_DICDI     LKSN-----ESILIHSAAGGIGISSLDLLKSKQHQIFLTVGSKDKTKKYGSL-ITAIYSSRNKDYVYEIK
PKS22_DICDI     LGL--HGSTETVXXXXXXXXXXXXXXXXXQVYGFKLFVTVGSEEKKQFLK----DRYGNFITEIYLIELK
TDH_COXBU       VG-------EDVLITGAGP-VGLMSAAIARHVGARVVITDVNDYRLALAEKVGVTAAVNSTKTPLTETMK
TDH_COXBR       VG-------EDVLITGAGP-VGLMSAAIARHVGARVVITDVNDYRLALAEKVGVTAAVNSTKTPLTETMK
TDH_COXBN       VG-------EDVLITGAGP-VGLMSAAIARHVGARVVITDVNDYRLALAEKVGVTAAVNSTKTPLTETMK
TDH_COXB2       VG-------EDVLITGAGP-VGLMSAAIARHVGARVVITDVNDYRLALAEKVGVTAAVNSTKTPLTETMK
PKS8_DICDI      LNIEDN---ESILIHLGSDSFGLSTFEILKWKGFKLFVTVDLDEKQYLLDRYGDFITGIYSNTDYVTEIK
YFMJ_BACSU      ----PKXXXXXXXXXXXXXXXXXXX-QIAKIKGARVVGIAGSDEKIDYLQELQFDEAINYKTADDIQKAL
ADHP_ECOLI      LSKIRPGQWIAIY---GLGGLGNLALQYAKVFNAKVIAIDVNDEQLKLATEMGADLAINSHTED------
PTGR1_MOUSE     --------------------------QIAKLKGCKVVGTAGSDEKVAYLKKLGFDVAFNYKTVKSLEEAL
PKS6_DICDI      LNIEDN---ESILIHLGRDGFGLSTFEILKWKGFKLFVTVNSDTKQYLLKKYGDLITGIYSNTDYVAEXX
PKS14_DICDI     L-KIKRNEXXXXXXXXXXXXXXXXXXXKWKGHKSHIFVTVGSKEKEQYLINTYGDFITGYSTKDYSEEIK
MECR_DANRE      LKAG-----DTVIQNAANSGVGQAVIQIAAAKGITINVIRDRPDLRQLSDRLTAMGATHVITEETLPEMK
ADH1_ZYMMO      IQPG-----QWLAIY-GLGGLGNLALQYAKVFNAKVIAIDVNDEQLAFAKELGADMVINPKNED-AAKII
PKS9_DICDI      LNIEDN---ESILIHLGSDGFGLSTFEILKWKGFNLFVTVNSYETKRYLQDNYGDFITGYSNTDYVTEIN
TDH_BURXL       VG-------EDVLITGAGP-IGIMAVAIAKHVGARVVITDVNDYRLELARKMGATRAVNVSRESLRDVMA
TDH_BURS3       VG-------EDVLITGAGP-IGIMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVARESLRDVMS
TDH_BURPP       VG-------EDVLITGAGP-IGIMAVAIAKHVGARVVITDVNDYRLELARKMGATRAVNVSRESL-----
PKS38_DICDI     LKSN-----ESILIHSAAGGIGISSLDLLKSKQHQIFLTVGSKDKIKKYGSL-ITAIYSSRNKNYVKDIK
P1_ARATH        ---------ETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTFGFDDAFNYKEESDLTAAL
YDJJ_ECOLI      VGMHAAMLADVKIIILGAGCIGLMTLQACKCLGAEIAVVDVLEKRLAMAEQLGATVVINGAKEDTIARCQ
TDH_PROAC       L-------AEDVLVSGAGP-IGIMAALVAQFQGARVVVTDLSDERLELAQQLGLKNAVNVSREGLETVWD
TDH_LEGPA       -------VGEDVLXXXXXXXXXXXXXXVRHIGARHVVITDVNDHRLELARQMGVSRAVNVKYQKLIDVAN
TDH_BURCJ       VG-------EDVLITGAGP-IGIMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVARESLRDVMA
TDH_BURCH       VG-------EDVLITGAGP-IGIMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVARESLRDVMA
TDH_BURCC       VG-------EDVLITGAGP-IGIMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVARESLRDVMA
TDH_BURCA       VG-------EDVLITGAGP-IGIMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVARESLRDVMA
PKS33_DICDI     LKSN-----ESILIHSAAGGIGISSLDLLKSKQHQIFLTVGSKDKTKKYGSL-ITAIYSSRNKNYVKDIK
ADH3_YEAST      LKEADLKAGDWVXXXXXXXXXXXXXVQYATAMGYRVLGIDAXXXXXXXXXXXXXXVFIDFKTKNMVSDIQ
PKS34_DICDI     LKSN-----ESILIHSAAGGIGISSLDLLKSKQHQIFLTVSSKDKIKKYGSL-ITAIYSSRNKNYVKDIK
MECR_MOUSE      LQPG-----DSVIQNASNSGVGQAVIQIASALRLKTINVVRDRPDIKRLKDLGADYVLT-EEELRMPETK
MECR2_CAEEL     LQKG-----DYIIQNSANSGVGRSVIEMCKALGYK-----------------------------------
TDH_BURCM       VG-------EDVLITGAGP-IGVMAAAIAKHVGARVVITDINDYRLELARKMGATRAVNVSRESLRDVMA
TDH_BACLD       ---------------------------------------------------MGATDIISVEKEDPLKNVS
PKS27_DICDI     LKSNEXXXXXXXXXXXXXXXXDL--LKCKKHQGH-IFLTVGSKDKEDLIKNYGSFITAIYRNKDYVNEIK
PKS23_DICDI     LDL--YGSTETVXXXXXXXXXXXXXXXXXQVYGFKLFVTVGSEEKKQFLK----DRYGNFITEIYLIELK
ADH3_EMENI      R------PGQTVAIVXXXXXXXXXXXXYAKAMGLRTIAIDSGDEKKAMCEQLGAEVFIDFXXXXXXXXXX
TDH_YERPY       VGED--------VLVSGAGPIGIMAAAVCKHVGARVVITDVNEYRLDLARKMGVTRAVNVSKENLNDVMT
TDH_YERPS       VGED--------VLVSGAGPIGIMAAAVCKHVGARVVITDVNEYRLDLARKMGVTRAVNVSKENLNDVMT
TDH_YERPB       VGED--------VLVSGAGPIGIMAAAVCKHVGARVVITDVNEYRLDLARKMGVTRAVNVSKENLNDVMT
TDH_YERP3       VGED--------VLVSGAGPIGIMAAAVCKHVGARVVITDVNEYRLDLARKMGVTRAVNVSKENLNDVMT
TDH_BURA4       VG-------EDVLITGAGP-IGVMAAAIAKHVGARVVITDINDYRLELARKMGATRAVNVSRESLRDVMA
CIPB_EMENI      ------------------DDVGSNAIQLGVAAGYEVFTTA-SPKNFDYVKELGASQVFDYHSATVAQDLV
CADH3_ARATH     TKESGK-----RLGVNGLGGLGHIAVKIGKAFGLRVTVISRSSEKREAIDRLGADSFL------VTTDSQ
ADH2_EMENI      LKRSKAQPGQWIVISGAGGGLGHLAVQIAKGMGLRV-IGVDHGSKEELVKASGAEHFVDIKFEAISSHVK
TDH_BURP8       VG-------EDVLITGAGP-IGIMAVAIAKHVGARVVITDVNDYRLELARKMGATRAVNVSRETLRDVMR
TDH_SHEWM       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELAQKMGATRAVNVAKEDLKDVMS
TDH_SERP5       VGED--------VLVSGAGPIGIMAAAVCKHVGARVVITDVNEYRLDLARKMGVTRAVNVSKENLNDVMA
TDH_LEGPL       -------VGEDVLXXXXXXXXXXXXXXVRHIGARHVVITDVNDHRLELARKMGVSRAVNVKYQKLSDVAN
TDH_LEGPH       -------VGEDVLXXXXXXXXXXXXXXVRHIGARHVVITDVNDHRLELARQMGVSRAVNVKYQKLSDVAN
TDH_LEGPC       -------VGEDVLXXXXXXXXXXXXXXVRHIGARHVVITDVNDHRLELARQMGVSRAVNVKYQKLSDVAN
TDH_BURM1       VG-------EDVLITGAGP-IGIMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVSLRDVMADLR
TDH_BURPS       VG-------EDVLITGAGP-IGVMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVSRESLRDVMA
TDH_BURP6       VG-------EDVLITGAGP-IGVMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVSRESLRDVMA
TDH_BURP1       VG-------EDVLITGAGP-IGVMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVSRESLRDVMA
TDH_BURP0       VG-------EDVLITGAGP-IGVMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVSRESLRDVMA
TDH_BURMS       VG-------EDVLITGAGP-IGVMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVSRESLRDVMA
TDH_BURMA       VG-------EDVLITGAGP-IGVMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVSRESLRDVMA
TDH_BURM9       VG-------EDVLITGAGP-IGVMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVSRESLRDVMA
TDH_BURM7       VG-------EDVLITGAGP-IGVMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVSRESLRDVMA
TDH_BACSU       SIASPLGNAVHTVLESQPAG-GTTAVIGCGPIGLMXXXXXXNEYRLRLAKQMGATCTVSIEKEDPLKIVS
TDH_PSYIN       VG-------EDVLITGAGP-IGIMAAAVAKHAGARVVITDINEYRLDLARKMGVTRAVNVAQQKLEDVIA
TDH_BURVG       VG-------EDVLITGAGP-IGIMAVAIAKHVGARVVITDINDYRLELARKMGATRAVNVSLRDVMAELR
PKS30_DICDI     LKSN-----ESILIHSAAGGVGISSLDLLKSKQHQIFLTVGSKDKTKKYGSL-ITAIYSSRNKDYVYEIK
CADH2_ARATH     TKESGK-----RLGVNGLGGLGHIAVKIGKAFGLRVTVISRSSEKREAIDRLGADSFL------VTTDSQ
YL460_YEAST     LGLDLKWEPSTILLWGGATAVGQSLIQLANKLGFTKIIVVASRKHEKLLKEYGADELFDYHDIDVVEQIK
YDJL_ECOLI      FLPGQ----DVVVI--GTGPLGLFSVQMARIMGAVNIVVVGLQERFPVAKELGATAVVNGSTEDVVARCQ
TDH_BURTA       VG-------EDVLITGAGP-IGVMAVAIAKHVGARVVITDINDYRLDLARRMGATRAVNVSRESLRDVMA
MECR_DICDI      -----------VIIQNASNSVGLSVIQLAKARGIKTIIRDGSEDNVQRLKQLGGDIVVSEEYVRTPAFRK
YCZ2_YEAST      LGLNLKWEPSTILLWGGATAVGQSLIQLANKLGFTKIIVVASRKHEKLLKEYGADQLFDYHDIDVVEQIK
TDH_SHESH       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELANKMGATRAVNVAKESLEGVME
TDH_SHEAM       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVAKENLKDVMK
TDH_RHIL3       VG-------EDVLVTGAGP-IGIMGALVAKRSGAKVVITDINPHRLELARKLGIDHVVDASKENLADVMK
TDH_RHIEC       VG-------EDVLVTGAGP-IGIMGALVAKRSGAKVVITDINPHRLDLARKLGIDHVVDASKENLADVMK
TDH_RHIE6       VG-------EDVLVTGAGP-IGIMGALVAKRSGAKVVITDINPHRLDLARKLGIDHVVDASKENLADVMK
PTGR1_RAT       -----------------------------KLKGCKVVGTAGSDEKVAYLKKLGFDVAFNYKTVKSLEEAL
TDH_SHEFN       VG-------EDVLITGAGP-IGIMAAAVCKHVGARVVITDVNEYRLDLARKMGATRAVNVATENLKDVMK
TDH_ANADE       ----------------GAGPIGVMAAAIARHVGARVVVTDVNDYRLDLARRMGASRAVNVAREDLRAVMS
PTGR1_BOVIN     LDICGVKGGETVLXXXXXXXXXXXXXXXXKLKGCKVVGTAGSDEKVAWLKKHGFDVALNYKTVKSLEEAL
ETR1_SCHPO      LNKG-----DWFIQDGANSMVGIATIQLAKHFGYKINVVRNRPDIEKLKEQLKSLGATIVITDEELMDRK
CADH_SACOF      TTPGLRGAIL------GLGGVGHMGVKVAKAMGHHVTVISSSSKKAEAMDHLGAD---------------
TDH_SOLUE       LGE------DVLITGAGPIGIMXXXXXXXXXXXYTV-ITDLNPYRLELAAKLGVTRAVNVREQKLGDVQK
TDH_ANASK       ----------------GAGPIGVMAAAIARHVGARVVVTDVNDYRLDLARRMGASRAVNVAKEDLRAVMS
TDH_ANAD2       ----------------GAGPIGVMAAAIARHVGARVVVTDVNDYRLDLARRMGASRAVNVAKEDLRAVMS
PTGR1_PIG       -----------------------------KLKGCKVVGAAGSDEKVACLKKYGFDVAFNYKTIESLEETL
ADH_STAEQ       AVKVPENAASSITCAGVTSGIXXXXXQYAKVMGAKVVAFDINDDKLNFAKELGADAIINSTNVDPIEEVN
TDH_AGRRK       VG-------EDVLVTGAGP-IGIMGAMVAKRSGAKVVITDINPNRLALAHKLGIDHVVDASKENLADVMK
FADH_AMYME      VSRGDSVAVI------GCGAVGDAVIAGARLAGANKIIAVDRDKKLEWATELGATHTVNATETDVVEAVQ
TDH_VIBCM       VG-------EDVLITGAGP-IGIMAAAVAKHVGARVVITDVNEYRLDLARKMGVTRAVNVAEQNLEDVMK
TDH_VIBCH       VG-------EDVLITGAGP-IGIMAAAVAKHVGARVVITDVNEYRLDLARKMGVTRAVNVAEQNLEDVMK
TDH_VIBC3       VG-------EDVLITGAGP-IGIMAAAVAKHVGARVVITDVNEYRLDLARKMGVTRAVNVAEQNLEDVMK
TDH_SHESW       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVSKESLKDVMK
TDH_SHEPA       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELAEKMGATRAVNVAKENLEDVMQ
TDH_PSEHT       VG-------EDVLITGAGP-IGIMAAAVAKHVGARVVISDVNEYRLELARKMGATRAVNVANEKLEDVIK
PKS42_DICDI     LKKN-----ETXXXXXXXXXXXXXXXXXXKWKNHQIFATVGSEDKVKLTDTYGSFITGIYSSRDIKEKLK
DOIAD_STRKN     VAPGDRVAVM------GAGGIGLMLMQVARHLGGEVTVVSEPVAERRAAGQLGATELCSAEPGQ-LAELV
TDH_YERE8       VGED--------VLVSGAGPIGIMAAAVCKHVGARVVITDVNEYRLDLARKMGVTRAVNVNKENLNDVMA
TDH_SHESR       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVAQENLKDVMK
TDH_SHEPC       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVSKENLKDVMK
TDH_SHEB9       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVSKESLKDVMK
TDH_SHEB5       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVSKESLKDVMK
TDH_SHEB2       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVSKESLKDVMK
TDH_PSEA6       VG-------EDVLITGAGP-IGIMAAAVAQHVGARVVITDVNEYRLDLARKMGASRAVNVAKESLKDVMN
ADH_STAES       AVKVPENAASSITCAGVTSGIXXXXXQYAKVMGAKVVAFDINDDKLNFAKELGADAIINSTNVDPIEEVN
TDH_SHESM       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVAQESLKDVMK
TDH_SHESA       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVAQESLKDVMK
TDH_SHEHH       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELAQKMGATRAVNVKLEDVMQEL-
TDH_RHILW       VG-------EDVLVTGAGP-IGIMGALVAKRSGAKVVITDINPHRLALARKLGIDHVVDASSENLADVMK
TDH_PHOLL       VGED--------VLVSGAGPIGIMAAAVCKHVGARVVITDVNEYRLELARKMGVTRAVNVSQENLTDVMA
RT4I1_DICDI     PXXXXXXXXXXXLVNGGNGSVGFFILQLLK----------------------------------------
TDH_SHEON       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVAQENLKDVMK
TDH_EDWI9       VGED--------VLVSGAGPIGIMAAAVCRHVGARVVITDVNDYRLDLARKMGVTRAVNVSRESLPEVMQ
DHSO_HUMAN      VTLGHK------VLVCGAGPIGMVTLLVAKAMGAQVVVTDLSATRLSKAKEIGADLVLQI-SKESPQEIA
CADH4_ARATH     M------ASXXXXXXXXXXXXXXXXXXXAKAMGHHVTVISSSDKKKEAIEHLGAD---DYVVSSDPAEMQ
PTGR2_MOUSE     ------GSNQTMVVXXXXXXXXXXXXQIGHLLGCRVVGICGTQEKCLFLTSLGFDAAVNYKTGNVAEQLR
PTGR1_HUMAN     -----------------------------KLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETL
DHSO_MACFA      VTLGHR------VLVCGAGPIGVVSLLVAKAMGAQVVVTDLSAPRLSKAKEIGADLVLQI-SKESPQEIA
TDH_SHEB8       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVSKENLKDVMK
QORL1_HUMAN     LSPG-----KSVLIMDGASAFGTIAIQLAHHRGAKVISTACSDKQCLERFRPPIARVIDVSNGKVHVAES
QORL1_BOVIN     LSPG-----KSVLIMDGASALGTIAIQLAHHRGAKVISTACSLEDKQFLERFRPPIARVIDVSNGKAHVA
BDHA_BACSU      ----------------GCGPIGLLVIEALKAAGATIYAVELSPERQQKAEELGAIIVDPSKTDDVVAEIA
TDH_SALAR       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLTDVMA
TDH_ERWCT       VG-------EDVLITGAGP-IGMMAAAVCRHVGARVVITDVNAYRLELASKMGATRAVN------VAEEK
TDH_SALTY       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_SALSV       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_SALPK       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_SALPC       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_SALPB       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_SALPA       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_SALNS       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_SALHS       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_SALEP       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_SALDC       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_SALCH       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_SALA4       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_KLEP7       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKENLNDVMA
TDH_KLEP3       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKENLNDVMA
TDH_BACA2       LGNAVHTVLESSQLAGGSAGCGPIGLMXXXXXXXXXXXXXXXIDKLALAKKLGATITISADKEDPLEVID
PTGR2_PONAB     --------------------------QIGHLLGCRVVGICGTHEKCVLLTSLGFDAAINYK-KDNVAEQL
TDH_SILPO       LGE------DVLITGAGPIGIMXXXXXXXXXXXXXXITDINADRLKLAQHVVPRARTVDVTREDLGDVVH
TDH_SALG2       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_PROMH       VG-------EDVLVSXXXXXXXXXXXXCKHVGARHVVITDVNEYRLDLAKKMGVTRAVNVSKENLTDVMK
TDH_ALTMD       VG-------EDVLITGAGP-IGIMAAAVAKHVGARVVVTDINPYRLELAKKMGATRTVDVSKENLQDVMD
TDH_AERS4       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVSKEKLADVMS
QORL1_MOUSE     LSPG-----KSVLIMDGASAFGTIAIQLAHHRGAKVISTAHSLEDKQHLERLSIARVIDVSNGKVHVAES
DOIAD_STRRY     ----------------------------------------------------------------------
DHSO_PONAB      VTLGHK------VLVCGAGPIGMVTLLVAKAMGAQVVVTDLSATRLSKAKEIGADLVLQI-SKESPQEIA
CADH1_TOBAC     --------SXXXXXXXXXXXXXXXXVKIAKAMGHHVTVISSSNKKQEALEHLGADDYLVSSDTDKMQEA-
TDH_SHELP       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELAKKMGATRAVNVKLEDVMQDL-
TDH_MESSB       VG-------EDVLVTGAGP-IGIMGALVAQCVGAKVVITDINPGRLALAKKLGVRHVVNAREEKLTDVMR
TDH_ESCF3       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLEDVMA
TDH_ECOLI       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_ECODH       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_ECOBW       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
PTGR2_HUMAN     --------------------------QIGHFLGCRVVGICGTHEKCILLTSLGFDAAINYK-KDNVAEQL
CADH1_ORYSJ     PGKS--------LGVIGLGGLGHMAVKFGKAFGLKVTVISTSESKRKAIDLLGADNFVVSSDENQMETLK
ADH_CLOBE       -----------------------------KLRGAGRIIGVGSRPICEAAKFYGATDILNYKNGHIVDQVM
ADH1_ENTHI      ----------------GIGPVGLMSVAGANHLGARIFAVGSRKHCCDIALEYGATDIINYKNGDIVEQIL
YCJQ_SHIFL      --------------------IGQIAIQLAKRAGASVVI--GVDPRCDIARRHGADFCLNPIGTDVGKEIK
YCJQ_ECOLI      --------------------IGQIAIQLAKRAGASVVI--GVDPRCDIARRHGADFCLNPIGTDVGKEIK
TDH_SALTI       VGED--------VLVSGAGPIGVMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKESLNDVMA
TDH_ENTS8       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLSLARKMGVTRAVNVANESLQDVMN
YMN1_YEAST      LQEREEDYGKVYLISGAAGAVGTVCIQLALNVASKVIAIAGGPEKVAFVESFGDNVGVDYKDPSFKQKLI
TDH_SHISS       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_ECOLU       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVAKENLNDVMA
TDH_AERHH       VG-------EDVLITGAGP-IGIMAAAVCRHVGARVVITDVNEYRLELARKMGATRAVNVTKEQLSGVMS
YHDH_ECOLI      AGVRPQDG--EIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVL---PRDEFAESR
TDH_SHIFL       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_SHIF8       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_SHIBS       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_SHIB3       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_RHISN       VG-------EDVLVTGAGP-IGIMGALVAKRSGAKVVITDINPVRLDLARKLGIDHVVDASKENLADVMR
TDH_RHIME       VG-------EDVLVTGAGP-IGIMGAMVAKRCGAKVVITDINPVRLDLARKLGIDHVVDASKEKLADVMR
TDH_ECOUT       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMT
TDH_ECOSM       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMT
TDH_ECOSE       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_ECOLC       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_ECOL6       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMT
TDH_ECOL5       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_ECOK1       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMT
TDH_ECOHS       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_ECO8A       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_ECO81       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMT
TDH_ECO7I       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMT
TDH_ECO55       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_ECO45       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMT
TDH_ECO27       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMT
TDH_ECO24       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
PTGR2_RAT       ------GSNQTMVVXXXXXXXXXXXXQIGHLLGCRVVGICGTHEKCLFLTSLGFDAAVNYKTGN-VAEQL
DHB12_BOVIN     AGVGP-WLGEWAVVTGGTDGIGKSYAEELAKRGMKIVLISRSQDKLDQVSSEISEKAVDFTSEDIYDKIK
TDH_VIBPA       VG-------EDVLITGAGP-IGIMAAAVAKHVGARVVITDVNEYRLELARKMGVTRAVNVKLEDVMAEL-
TDH_PHOPR       VG-------EDVLITGAGP-IGIMAAAVAKHVGARVVITDVNEYRLDLARKMGVTRAVNVKLEDVMSEL-
NADE_NOCFA      -------------------------------------VQADEHDAAVAMEFIGPDRAVTVNVKPGVATAG
TDH_MARMS       IG-------EDVLXXXXXXXXXXXXXXXXXXXXRNVVITDVNDFRLDLAKKMGATRTVNVSRESLKDVMT
TDH_ECO5E       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
TDH_ECO57       VGED--------VLVSGAGPIGIMAAAVAKHVGARVVITDVNEYRLELARKMGITRAVNVAKENLNDVMA
DHB12_MACFA     AGVGP-GLGEWAVVTGGTDGIGKSYAEELAKRGMKVVLISRSQDKLDQVSSEIKEKAVDFTLEDIYDKIK


                         .         .         .         +         .         .         .:280
query           ALTEGKGVDVILDMVAGSYLARELSCIADDGRIVIIALLGGGKAEIPLGDILRRRITITGSTLRPRPASF
QORX_HUMAN      KFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLSKLLFKRGSLITSLLRSRDNKY
QOR_CAVPO       KSIGEKGVDVIIEMLANVNLSNDLKLLSCGGRVIIVGC--RGSIEINPRDTMAKESTISGVSL----FSS
QOR_HUMAN       KYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVG--SRGTIEINPRDTMAKESSIIGVTLFSSTKEE
QOR_PONAB       KYVGEKGIDVIIEMLANVNLNKDLSLLSHGGQVIVVG--SRGTIEINPRDTMAKESSIIGVTVFSSTKEE
QOR_MOUSE       MSVKDKGVDVIIEMLANENLSNDLKLLSH--XXXXXXXXXXXPIEINPRDTMAKETSIIGVSLSSSTKEE
QOR_RAT         TSAGDKGVDVIIEM--XXXXXXXXXXXXXXXXXXXXXXXXXXXXEINPRDTMAKETSIIGSSTKEEFQQF
QOR_BOVIN       KSVGEKGVDVIIEMXXXXXXXXXXXXXSHGGRVIVVG--SRGTIEINPRDTMTKESSIKGVTLFSSTKEE
QOR_LAMGU       KSVGEKGIDVIIEMXXXXXXXXXXXXXSQGGRVIIVG--SKGPVEINPRDTMTKESSIKGVTLFSSTKEE
QOR_PIG         KSVGEKGIDVIIEMXXXXXXXXXXXXXSHGGRVIIVG--SRGPIEINPRDTMTKGSSIKGVALY---SST
VAT1_DANRE      KISP-KGLDIVLDPLGGSDTHKGYNLLKPMGKLISYGLAGQKKNLFAVAKTWYQQFSVHTLSLIQGNRSV
QOR_SALTY       EITGGKKVRVVYDSVGKDTWEASLDCLQRRGLMVSFGNASGPVTGVNLG-ILNQK----GSLYATRP-SL
MCAS_MYCBO      RDTDGYGVDIVLNSLTGAAQRAGLELLAFGGRFVEI-----GKADVRLGLFFRRGLTFYYLDLALMSVTQ
FAS_RAT         LHTGGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEI-----GKFDLPLGAIFLKNVTFHGILL---DALF
QORL2_BOVIN     KLVGSGGVNVVIDMVGGDIFLEALRSLAYEGRIVVVGFAGGTIASVPANLLLLKNVSAMGLYWRYRQQNF
ADH_SULTO       RITQGKGADAVIDLNSEKTLSIYPYVLAKQGKYVMVGLFGADKYHAPL--ITLNEVQFIGS-LVGNQSDF
FAS_MOUSE       LHTGGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEI-----GKFDLSNNHPL-------GMAIFLKNVTF
QOR_PSEAE       ELTDGKKCPVVYDSVGKDTWETSLDCVAPRGLLVSFGNASGPVTGVNLGILSQK-----GSLYVTRPT--
QOR_ECOLI       EITGGKKVRVVYDSVGRDTWERSLDCLQRRGLMVSFGNSSGAVTGVNLG-ILNQK----GSLYVTRP-SL
FAS_HUMAN       WHTGGKGVDLVLNSLAEEKLQASVRCLATHGRFLEI-----GKFDLPLGAIFLKNVTFHGVLL---DAFF
FAS_BOVIN       WHTAGKGADLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSKNH-PLGAIFLKNVTFHGILL---DSLF
QORL2_RAT       KLVGSSGVNVAIDMVGGDVFLDSLRSLAWEGRIVVLGFAGGNIASVPSNLLLLKNISAMGRYQHQDFAVF
YOGA_BACSU      EQLQGKKIDVVLDSIGPALFSEYFRHVKPNGRIVSFGASSGDNLSFPVRSLFFPQVNVLGTSMG------
VAT1_MOUSE      KISP-KGVDIVMDPLGGSDTAKGYHLLKPMGKVVMANLLTGPKRNLAMARTWWNQFSVTALQLLQANRAV
QORL2_MOUSE     KLAGSGGVNVAIDMVGGDVFLESLRSLAWEGRIVVLGFAGGNIASVPSNLLLLKNISAMGLYWRYQHQDF
YGD6_SCHPO      KMTNGVGYHHVIEVGGEKTLPQSIACLAKDGMISMIGFV-ASEGTTPIGQILNRNANIRG--------IF
VAT1_HUMAN      KISP-KGVDIVMDPLGGSDTAKGYNLLKPMGKVVMANLLTGPKRNLALARTWWNQFSVTALQLLQANRAV
VAT1L_MOUSE     RIS-AEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGVTGETKSFFPIKLYEENKVIAGFSLLNLLFKQG
RT4I1_BOVIN     S---SKPFDFILDNVGGSTETWALKFLATYVTLVTPFLLNMDRLGIADG-MLQTGVTVGSKTLKHQGVHY
VAT1L_HUMAN     RIS-AEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGVTGETKSFFPIKLYEENKVIAGFSLLNLLFKQG
ADH2_BACST      AIDQVGGVHAAISVAVNKKAFEQAYQSVKRGGTLVVVGLPNADLPIPIFDTVLNGVSVKGSIVGTRKDM-
QORL2_NEMVE     ELTDGHGANVIMEAVGGDVFKQCLKCIAWNGYIIPVGFASGEIPQIPANILLVKNCSAVGAHSKHDPQLL
RT4I1_DANRE     NLEK---FDLILDSIGGETEKWALDLLKPWSGAKFVTLITQNTDRLGLADMMQSAVTVGCKVVKNLRKGF
PKS37_DICDI     VNTDGQGVDMVLNSLSGEYLEKSIQCLSQYGRFIEI-----GKKDIYSNSSIKNNLSFFAVDIAQMTENR
RT4I1_HUMAN     SL---KPFDFILDNVGGSTETWAPDFLATYVTLVTPFLLNMDRLGIADG-MLQTGVTVGSKALKHKGVHY
ZADH2_HUMAN     KQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGGLSPVKAGKLLKKSASVQGFFLNHYLSKY
ZADH2_BOVIN     RQEYPQGVDVVYESVGGAMFDLAVDALATRGRLIVIGFVSGGLSPVKAGKLLKKSASVQGFFLNHYLPEF
RT4I1_MOUSE     SL---KLFDFILDNVGGSTETWALNFLATYVTLVTPFLLNMDRLGVADG-MLQTGVTVGTKALKHQGVHY
VAT1_TORCA      KIAP-KGVDIVLDPLGGA----------------------------------------------------
QOR_SCHPO       DYTNGKGVDAAYDSVGIDTLSSSLDALRNGGTMVSFGNASGAIDAIPLKFLSARCLKFV------RPSLF
QOR_LEIAM       ELCP-KGVDVVYECVGGHTFNDXXXXXXXXXXXXIIGSISSYKSVVPFSDPSGTSVTM---LLLVKSASL
QORL_ARATH      -----DKYDVVFDAI--GMCDKAVKVIKEGGKVV--ALTG---AVTPPG--FRFVVTSNGDVLK------
ADH1_KLUMA      EATNGVAHAVINVSVSEAAISTSVLYTRSNGTVVLVGLPRDAQCKSDVFNQVVKSISIVGSYVGNR----
ZDH1_STAEQ      D-NHIEGVDYIFTFDTDMYYEMMVNLVKPRGHIATIVAF---NSQQDLNLLKSKSVTFTHEFMFSRPLHH
FAS_CHICK       RVTNGKGVSLVLNSLAEEKLQASLRCLAQHGRFLEI-----GKFDLSNNSQL-------GMALFLKNVAF
ADH1_EMENI      AATDGLGAHVILLAVSEKPFQQATEYVRSRGTIVAIGLPPDAYLKAPVINTVVRMITIKGSYVGNRQDGV
ADH1_NEUCR      AATDGLGPHVILLAVSEKPFHQAVDYVRSRGTIICIGLPAGAKFQAPVFDTVIRMITIKGSYVGNRQDT-
ZDH1_STAES      D-NHIEGVDYIFTFDTDMYYEMMVNLVKPRGHIATIVAF---NSQQDLNLLKSKSVTFTHEFMFSRPLHH
ADH_SULSR       RITEGKGVDAVIDLNSEKTLSVYPKALAKQGKYIMVGLFG--------ADLHFHAPLITLSEIQ-----F
ZADH2_MOUSE     KQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQSPTGLSPI---KAGVLPTKLLKKSASL
QOR_YEAST       KFTNGKGVDASFDSVGKDTFEISLAALKRKG---VFVSFGNASGLIPPFSITRKNITL----VRPQ---L
ADH_SCHPO       AATNGGAHGTLVLSTSPKSYEQAAGFARPGSTMVTVSMPAGAKLGADIFWLTVKMLKICGSHVGNRIDSI
ADH2_KLULA      DATNGGAHGVINVSVSEFAIEQSTNYVRSNGTVVLVGLPRDAKCKSDVFTQVVKSVSIVGSYVGNR----
PKS16_DICDI     QQSAQGGVDLILNTLSGDYLSANFRSLSQVGRIMDLSVTQ--LVENDSLDFSNFKYHVTYSTIDERATTY
DHSO_BACHD      ELTDGYGADVVLECSGAVPAAKQIDLLRKKGQYAQVGLFAQPEIQFNFEKIIQKEISVVGSRSQ-KPADW
PKS25_DICDI     LGYETHGVDLIINTLSSEFMDSNFKCLNPEGRIVDLTI--------------------------------
ZDH1_STAAC      EIPL---VDYIFTYNTDLYYNTMIELIKPLGHITTIVAF---NEDQDLNALKLKSITFTHEFMFARPIHR
ZDH1_STAAW      E-KEIPLVDYIFTYNTDLYYNTMIELIKPLGHITTIVAF---NEDQDLNALKLKSITFTHEFMFARPIHR
ZDH1_STAAS      E-KEIPLVDYIFTYNTDLYYNTMIELIKPLGHITTIVAF---NEDQDLNALKLKSITFTHEFMFARPIHR
ADH1_PICST      TATDGGPHAAINVSVSEKAIAQSCQYVRSTGTVVLVGLPAGAKVVAPVFDAVVKSISIRGSYVGNRADS-
ZDH1_STAAR      E-KEIPLVDYIFTYNTDLYYNTMIELIKPLGHITTIVAF---NEDQDLNALKLKSITFTHEFMFARPIHR
PKS21_DICDI     SKTTGKGVDLIINTLPNEFTHSNFLCLKERGKIIDLSITHXXXXXXXXXXXXXXXXSYHNIEL----MHI
ADH1_BACST      EKXXXXXXXXXXXXSKAAFESAYKS-IRRGGACVLVG-LPPEEIPIPIFDTVLNGVKIIGSIVGTRKDL-
ZDH1_STAAN      E-KEIPLVDYIFTYNTDLYYNTMIELIKPLGHITTIVAF---NEDQDLNALKLKSITFTHEFMFARPIHR
ZDH1_STAAM      E-KEIPLVDYIFTYNTDLYYNTMIELIKPLGHITTIVAF---NEDQDLNALKLKSITFTHEFMFARPIHR
TOXD_COCCA      RCTQNK-LKLVFDTISIDVSAR------------------------------------------------
ADHA_RHIME      RRTGGLH-GALVTAVSPKAMEQAYSMLRSKGTMALVG-LPPGQICLPVFDTVLKRITVRGSIVGTR----
PKS18_DICDI     QLGSNKGVDLILNTLSSDYMESNFKCLNTSGRIVDLSV-----THLXXXXXXXXXXXXXXXXXXXXELTF
ADH3_BACST      EKXXXXXXXXXXXXSKPAFQS-AYNSIRRGGACVLVG-LPPEEMPIPIFDTVLNGIKIIGSIVGTRKDL-
QORH_SPIOL      --PSGKKYDYVVHGASGIPWSTFEPNLSEAGKVIDLTPGPTAMMTFAWKKLTFSKKQLVPLLLIPKIPNF
PKS2_DICDI      KKIQKMGIDLIINTLSNEFMDANFNSLCQGGRIIDLSVTHMNSQDTT--DFRKFRYCISYSSVELLLNGF
ADH_SULSO       RITESKGVDAVIDLNSEKTLSVYPKALAKQGKYVMVGLFG--------ADLHYHAPLITLSEIQ-----F
YJMD_BACSU      EWTGNEGANVVIDAVCPETFALSIEAVSPAGHVVVLG-FDERAAQISQLPITKKEVTITGSRLQ------
INC11_TRIAT     DL---GGVHAVFDALGFESFDESYSILTPKERSVVVA---------------------------------
ADH5_YEAST      KATNGGSHGVINVSVSEAAIEASTRYCRPNGTVVLVGMPAHAYCNSDVFNQVVKSISIVGSCVGNR----
ADH5_SACPS      KATNGGSHGVINVSVSEAAIEASTRYCRPNGTVVLVGMPAHAYCNSDVFNQVVKSISIVGSCVGNR----
PKS17_DICDI     QQSAQGGVDLILNTLSGDYLSSNFRSLSQVGRIMDLSVTQ--LVENDSLDFSNFKYHVGYNTIDDRATKY
ADH3_KLULA      EITNGGPHGVINVSVSEAAMNASTQFVRPTGTVVLVGLPAGAVIKSEVFSHVVKSINIKGSYVGNR-ADT
ADH1_CANAL      KATDGGPHGAINVSVSEKAIDQSVEYVRPLGKVVLVGLPAHAKVTAPVFDAVVKSIEIKGSYVGNRKDT-
PKS19_DICDI     SKTTGKGVDLIINTLPNEFTHSNFLCLKERGKIIDLSITHXXXXXXXXXXXXXXXXSIEFMHINKRVVSL
PKS15_DICDI     LKSNKKGVDLILNTLSSDYLDSNFKCLECGGRIVDLSI--------------------------------
ADH4_KLULA      EATNGGPHGVINVSVSEAAISMSTEYVRPTGVVVLVGLPADAYVKSEVFSHVVKSISIKGSYVGNR----
QORH_ARATH      S-PSGKKYDAVVHCANGIPFSVFEPNLSENGKVIDITPGPNAMWTYAVKKITMSKKQLVPLLLIPKAENL
YKM8_SCHPO      ALPRPKGIDIYFENVGGETMDAVLENMNLQGRIIFCGAISQYNNPNPLGMVLVKSLTIQGFIV----ANI
PKS41_DICDI     SKISGKGVDFILNTLSSSYMDSNFKCLNMSGRIVDLSI--------------------------------
MECR_DROME      IFKSGKLKKPRLAFCVGGKSATEVSRHLDNGGVLV--TYGGMSREVATGPLIFKDIAFRGFWMRWSKENY
ADH1_ASPFN      AATEGLGAHVILLAVAEKPFQQAAEYVRSRGTVVAIGLPAGAFLRAPVFNTVVRMINIKGSYVGNRQDGV
MECR1_CAEEL     --KKFPGVKLALNCVGGRSSLFLASLLDHGGCMVTYGGMSKQPVDCPTGPLIFKDISLRG----------
ERYA2_SACER     ERTGGRGVDVVLNSLTGXXXXXXXXXXXXXGVFVEM-----GKTDLDAGD------------FRGRYAPF
YBJB_SCHPO      ELVE--KVDVVIDTVGDPLLMKSLNQLGIGGRLSYISAPKQGSIEFDMKQIYRKNLKIIG----------
PTGR1_CAVPO     KKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISNRMDQLPPGSIIYKQLRIEGFIV----YRW
PKS28_DICDI     GEVKQQGVDLILNTLSSEFMDSNFQCLNMSGRIVDLSV----THLTPNDYIANNHFKYNMGYNNVEMIDF
YBI2_SCHPO      RLADLGPYDFVFDCVNDNVLYRASSFVKPDGAFFGI---GGDITLSYVGSRLSR-------TLRPRVLGG
PKS40_DICDI     SKISGKGVDFILNTLSSSYMDSNFKCLNMSGRIVDLSI--------------------------------
PKS1_DICDI      NQLESK-IDVILNTLSGEFVESNFKSLRSFGRLILSATHVYANQQIGLGNF--KFDHLYSAVDLERLIDE
TDH_PYRHO       DITDGNGVDVFLEFSAPKALEQGLQAVTPAGRVSLLGLY-PGKVTIDFNNIIFKALTIYGIT--------
TDH_PYRAB       DITDGNGVDVFLEFSAPKALEQGLQAVTPAGRVSLLGLY-PGKVSIDFNNIIFKALTVYGIT--------
RSPB_ECOLI      -FTE-KGITLIIDAACHPSILKEAVTLASPAARIVLMGFSSEPSEVIQQGITGKELSIFSS---------
TDH_THETN       SETEGYGADVVLDFSGNPTAIRQLEYIAKGGR---MSILGLPDNEVPINNVVFKGITIQGITGRRMYDTW
TDH_SYMTH       SYTRGYGADVVLEMSGNPTAIRQGLKAARNGARISLLGLPGRPLELDLADVIMRGLVLQGITGR------
TDH_PYRFU       DITDGNGVDVFLEFSAPKALEQGLQAVTPAGRVSLLGLF-PGKVSIDFNNIIFKALTVYGIT--------
ADH2_PICST      KATNGGAHGVINVSVSERAMQQSVDYVRPTGTVVLVGLPAGAKXXXXXXXXXXRTIQIKGSYVGNRADS-
TDH_CHRVO       ELHMSEGFDVGLEMSGNPQAFRQMLETMNHGGKVALLGIPPSNTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_ANADF       DLGMKEGFDVGLEMSGNGRAFRQMLEAMNHGAKVALLGIMPGEEAIDWSQVVFKGLVLKGIYGREMYETW
PKS31_DICDI     VEQHQQGVDLILNTLSSEYMDSNFQCLNLSGRIVDLSI--------------------------------
PHAS_MYCTU      RDTNGRGVDVVLNSVTXXXXXXXXXXXXFRGRFVEI-----GKRDI-YGDTFRRNLSFYAVDLGLLSATH
PHAS_MYCTA      RDTNGRGVDVVLNSVTXXXXXXXXXXXXFRGRFVEI-----GKRDI-YGDTFRRNLSFYAVDLGLLSATH
PHAS_MYCBP      RDTNGRGVDVVLNSVTXXXXXXXXXXXXFRGRFVEI-----GKRDI-YGDTFRRNLSFYAVDLGLLSATH
PHAS_MYCBO      RDTNGRGVDVVLNSVTXXXXXXXXXXXXFRGRFVEI-----GKRDI-YGDTFRRNLSFYAVDLGLLSATH
ADH2_CANAL      XXTNGGPHGVINVSVSERAIGQSTEYVRTLGKVVLVGLPAGAKISTPVFDAVIKTIQIKGSYVGNRKDT-
PKS13_DICDI     QLGSNKGVDLILSSLPNGDDNLNFKCLAKNGRIIDLS------NNIDLFNISKSKIKKLLNTIND---GF
ADH1_KLULA      EATKGGAHGVINVSVSEFAIEQSTNYVRSNGTVVLVGLPRDAKCKSDVFNQVVKSISIVGSYVGNR-ADT
TDH_THET2       RVT-GSGVEVLLEFSGNEAAIHQ----------GLMALIPGGEARIPIGELVMRGITAFGIAGRRLWQTW
PKS5_DICDI      LIEQGSGVDLILNTLPSDFMDSNFQLLAINGRII------------------------------------
PKS39_DICDI     VEQHQQGVDLILNTLSSEFMSPNFQCLNLSGRIVDLSITHLTPNDYMTNSHYKFNMGYNNVNVE----DF
PKS45_DICDI     PFIHKKGVDLIINTLPFEFLDTNFLLLGQGGRIVDLSVNHLNNNDTT--DFSKFKWFIGYSTVE----IF
YHFP_BACSU      ALSKQQWQGAV-DPVGGKQLASLLSKIQYGGSVAVSGLTGGGEVPATVYPFILRGVSLLGIDSVYCPMDV
PKS7_DICDI      LGSKKKGVDLILNTLPSDFMDSNFELLTKNARII------------------------------------
ADH_STAAW       KLTDNKGLD-------------------------------------------------------------
ADH_STAAS       KLTDNKGLD-------------------------------------------------------------
ADH_STAAR       KLTDNKGLD-------------------------------------------------------------
ADH_STAAN       KLTDNKGLD-------------------------------------------------------------
ADH_STAAM       KLTDNKGLD-------------------------------------------------------------
ADH_STAAC       KLTDNKGLD-------------------------------------------------------------
ADH_STAAB       KLTDNKGLD-------------------------------------------------------------
ADH_STAA8       KLTDNKGLD-------------------------------------------------------------
ADH_STAA3       KLTDNKGLD-------------------------------------------------------------
PKS3_DICDI      DKSDKTGVDLILNTLSSDYMDSNFNCLSKSGRIVDLSI--------------------------------
TDH_THET8       RVT-GSGVEVLLEFSGNEAAIHQ----------GLMALIPGGEARIPIGELVMRGITAFGIAGRRLWQTW
TDH_THEON       DITDGAGVEVFLEFSAPKAFEQGLQAVTPGGRVSLLGL--------------------------------
YNN4_YEAST      --KKYNNIPYLVDCVSNTETIQQVKCAADDLDATVVQLTVLTEKDIKEED-RRQNVSIEGTLL-------
ADH1_YEAST      KATDGGAHGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNR----
ADH2_YEAST      KATNGGAHGIINVSVSEAAIEASTRYCRANGTVVLVGLPAGAKCSSDVFNHVVKSISIVGSYVGNR----
ADH_RALEU       KLTGGRGVDASIE---------------------------------------------------------
TDH_PYRKO       DITDGAGVEVFLEFSAPKALEQGLKAVTPGGRVSLLGL--------------------------------
ADH_SULAC       KITTGRGVDAIIDFVGSEFTTSNYTLLAKLGRYVKVGTYGGGLPHD------------AGLRLHSMGWQF
PKS44_DICDI     ELLDNKGVDLIINTLPFEFLDTNFLLLGQGGRIVDLSVTHLNNNDTT--DFSKFKWFIGYSTVE----IF
PKS29_DICDI     VEQHQQGVDLILNTLSSEYMDSNFQCLNLSGRIVDLSII-------------------------------
MECR_RAT        RMPETKNIDLPLPRLA-------LNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSMLIFKDLKL
ETR1_YARLI      SWTGGK-IKLALNCIGGKSATSIMRQLGAGGSIVTYGGMSKKPLTFPTGPFIFKDITAKG----------
ADH2_KLUMA      KATNGGAHGVINVSVSEKAIESSIEYCRSNGTVVLVGLPKDAKCKSDVFNQVVKSIHIVGS---------
DHSO_BACSU      TITNDRGVDVAWETAGNAALQSALASVRRGGKLAIVGL--PSQNEIPL----------------------
TDH_SACEN       KLGMSEGFDVAME-VSGSALRETIENMAHGGRIAMLGLPA-------------ERFQIDWSAVVLKMLTV
P2_ARATH        KRCFPKGIDMYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQLSNIIYKRIRIQGFVV----ADF
MECR_HUMAN      ----------------------------------------------------------------------
PTGR1_RABIT     KKAAPDGYDCYFDNVGGEFSNTVIRQMKKFGRVAICGAISNSTGQLPPGSVLYQEIRMEGFIFN----RW
PKS32_DICDI     VEQHQQGVDLILNTLSSEYMDSNFQCLNLSGRIVDLSITHLTPNDYMINNHYKFNMGYNNVEVVDFPSKF
PKS22_DICDI     APSQEYGVDLIINTLSADYMDANFNCLSQGGRIIDLSIT--HMXXXXXXXFYKFKNHIGYMTYESVIAGF
TDH_COXBU       NLGMTEGFDVGLEMSGNAEAFRSMLTVMNNGGKIAFLGIPPEPFAIDWNQVVFKSLLIKG--------IY
TDH_COXBR       NLGMTEGFDVGLEMSGNAEAFRSMLTVMNNGGKIAFLGIPPEPFAIDWNQVVFKSLLIKG--------IY
TDH_COXBN       NLGMTEGFDVGLEMSGNAEAFRSMLTVMNNGGKIAFLGIPPEPFAIDWNQVVFKSLLIKG--------IY
TDH_COXB2       NLGMTEGFDVGLEMSGNAEAFRSMLTVMNNGGKIAFLGIPPEPFAIDWNQVVFKSLLIKG--------IY
PKS8_DICDI      NESKKKGVDLILNTLPSDFMDSNFELLTKSGRII------------------------------------
YFMJ_BACSU      QNACPDGVDVYFDNVGGPISDAVMNLLNEFARIPVCGAISSYNAESEADDM-------------------
ADHP_ECOLI      ----------------------------------------------------------------------
PTGR1_MOUSE     RTASPDGYDCYFDNVGGEFSNAVILQMKTFGRIAI-----------------------------------
PKS6_DICDI      XXXXXXXVDLILNTLPSDFMDSNFKLLTKYGRII------------------------------------
PKS14_DICDI     LKSDKHGVDLILNTLSSDYMDSNFKCLNIGGRIVDLSI--------------------------------
MECR_DANRE      ELFKSPRPKLALNGVGGKSATELLRHLQSGGSLVTYGGMAKQPVTVPVSALIFKDVRVRG----------
ADH1_ZYMMO      QEKXXXXXXXXXXXXXKSAFNSAVEAIRAGGRVVAVG-LPPEKMDLSIPRLVLDGIEVLGSLVGTREDL-
PKS9_DICDI      XXXXXXXVDLILNTLPSDFMDSNFKLLAKYGRII------------------------------------
TDH_BURXL       DLHMAEGFDVGLEMSVPSAFTGMLEAMNHGGKIALLG-IPPAQTAIDWTQVIFKGLEIKGIYGREMFETW
TDH_BURS3       DLHMTEGFDVGLEMSVPSAFTSMLEAMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURPP       -----RDVMADLHMTEGFDVGLEMSGVPSAFTSMLEAMNHGGK--IALLGIPPAQTAIDWTQVIFKGLEI
PKS38_DICDI     NKLQQQGVDLILNTLSSEFMDSNFQCLNLSGRIVDLSI--------------------------------
P1_ARATH        KRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQLSNIIYKRIRIQGFVV----SDF
YDJJ_ECOLI      QFTEDMGADIVFETAGSAVTVKQAPLVMRGGKIMIVGTVPGDSA--------------------------
TDH_PROAC       RFDMKEGFDIGLEMSSGTALTSMIDNMTHGGR---IALLGTPSTDITLSKIIFNMITIQGVTGR---QIF
TDH_LEGPA       ELGMLEGFDVGLEMSGNPMALNDMMKAMNHGGHV--ALLGIPPQETPINQVIFKGLVIKGIYGREMFETW
TDH_BURCJ       DLHMTEGFDVGLEMSVPSAFTSLLEAMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURCH       DLHMTEGFDVGLEMSVPSAFTSLLEAMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURCC       DLHMTEGFDVGLEMSVPSAFTSLLEAMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURCA       DLHMTEGFDVGLEMSVPSAFTSLLEAMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
PKS33_DICDI     GEVEQQGVDLILNTLSSEYMDSNFQCLNLSGRIIDLSI--------------------------------
ADH3_YEAST      EATKGGPHGVINVSVSEAAISLSTEYVRPCGTVVLVGLPANAYVKSEVFSHVVKSINIKGSYVGNR----
PKS34_DICDI     GEVEQQGVDLILNTLSSEYMDSNFQCLNLSGRIVDLSI--------------------------------
MECR_MOUSE      TIFK----DLPLPRLA-------LNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSLLIFKDLKL
MECR2_CAEEL     ----------------------------------------------------------------------
TDH_BURCM       DLHMTEGFDVGLEMSVPSAFTSMLEAMNHGGKIALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BACLD       ALTNGEGADLVCEMSGHPTAIRQLKMAANGGRVHVLSLPEHPVCIDMTNDIVFKGLTVQGITGRKMFETW
PKS27_DICDI     GEVEQQGVDLILNTLSSEFMDSNFQCLNMSGRIVDLSVTHLTPNDYIVNNLFKYNMGYNNVEM----LYF
PKS23_DICDI     APSQEYGVDLIINTLSADYMDANFNCLSQGGRIIDLSIT--HMXXXXXXXFYKFRNHIGYMTYESVIAGF
ADH3_EMENI      XXXTPGGLGVILLAVAEKPFQQATEYVRSHGSVVAIGLPANAFLKAPVFTTVVRMINIKGSYVGNRKAPF
TDH_YERPY       ELGMTEGFDVGLEMSGAPPAFRSLNSMNHGGR---IAMLG-----IPPSD-----MSIDWNQVIFKGLFI
TDH_YERPS       ELGMTEGFDVGLEMSGAPPAFRSLNSMNHGGR---IAMLG-----IPPSD-----MSIDWNQVIFKGLFI
TDH_YERPB       ELGMTEGFDVGLEMSGAPPAFRSLNSMNHGGR---IAMLG-----IPPSD-----MSIDWNQVIFKGLFI
TDH_YERP3       ELGMTEGFDVGLEMSGAPPAFRSLNSMNHGGR---IAMLG-----IPPSD-----MSIDWNQVIFKGLFI
TDH_BURA4       DLHMTEGFDVGLEMSVPSAFTSMLEAMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
CIPB_EMENI      AALQGKTVAGAMDCIGFAATPLTVEVVSKSQGVKFVSTVKGG-FQAPEGVTVK---SVFGTTIK------
CADH3_ARATH     KMKEAVGMDFIIDTVSAEHALLPLSLLKVSGKLVALGLL-EKPLDLPIFPLVLGRKMVGGSQI-------
ADH2_EMENI      SLTKGLGAHAVIVCTASNIYAQSLLFLRYNGTMVCVGIPENEPQAIASGLFIQKHVHVTGSAVGNR----
TDH_BURP8       DLHMTEGFDVGLEMSVPSAFTSMLEAMNHGGKIALLG-IPPAQTAIDWTQVIFKGLEIKGIYGREMFETW
TDH_SHEWM       ELGMTEGFDVGLEMSVPSAFHSMLDTMNHGGKVAMLGIPGGDMA-IDWSKVIFKGLIIKG---------I
TDH_SERP5       ELGMTEGFDVGLEMSGAPPAFRTLNAMNHGGR---IAMLG-----IPPSD-----MSIDWNQVIFKGLFI
TDH_LEGPL       ELGMLEGFDVGLEMSGNPMALNDMMKAMNHGGHV--ALLGIPPQETPINQVIFKGLVIKGIYGREMFETW
TDH_LEGPH       ELGMLEGFDVGLEMSGNPMALNDMMKAMNHGGHV--ALLGIPPQETPINQVIFKGLVIKGIYGREMFETW
TDH_LEGPC       ELGMLEGFDVGLEMSGNPMALNDMMKAMNHGGHV--ALLGIPPQETPINQVIFKGLVIKGIYGREMFETW
TDH_BURM1       -MTEGFDVGLEMSGVPSAFTSL-LEAMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURPS       DLHMTEGFDVGLEMSVPSAFTSLLESMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURP6       DLHMTEGFDVGLEMSVPSAFTSLLESMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURP1       DLHMTEGFDVGLEMSVPSAFTSLLESMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURP0       DLHMTEGFDVGLEMSVPSAFTSLLESMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURMS       DLHMTEGFDVGLEMSVPSAFTSLLESMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURMA       DLHMTEGFDVGLEMSVPSAFTSLLESMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURM9       DLHMTEGFDVGLEMSVPSAFTSLLESMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BURM7       DLHMTEGFDVGLEMSVPSAFTSLLESMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
TDH_BACSU       ALTSGEGADLVCEMSGPSAIAQGLAMAANGGRFHILSL-----PEHPVTIDLTNKVVFKGLTIQ----GI
TDH_PSYIN       QLGMTEGFDVGLEM-SGAPVASMLKNMSHGGK---IALLG-----IPPSDM----------SIDWNMVIF
TDH_BURVG       -MTEGFDVGLEMSGVPSAFTSL-LEAMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
PKS30_DICDI     VEQNQQGVDIILNTLSSEYMDSNFQCLNMSGCIVDLSI--------------------------------
CADH2_ARATH     KMKEAVGMDFIIDTVSAEHALLPLSLLKVNGKLVALG-LPEKPLDLPIFSLVLGRKMVGGSQI-------
YL460_YEAST     --HKYNNISYLVDCVANDTLQQVYKCAADKQDATIVEL--------------------------------
YDJL_ECOLI      QICGKDNLGLVIECSANIALKQAIEMLRPNGEVVRVG-MGFKPLDFSINDITAWNKSIIGHM--------
TDH_BURTA       DLHMTEGFDVGLEMSVPSAFTSLLESMNHGGKVALLG-IPPAQTAIDWNQVIFKGLEIKGIYGREMFETW
MECR_DICDI      LISDLPSPKLALNAVGGQSATELSRILADNGTLVTYGGMSREPVTIPTSQLIFRNIQIRGFWLNKWFEQH
YCZ2_YEAST      --HKYNNISYLVDCVANNTLQQVYKCAADKQDATVVEL--------------------------------
TDH_SHESH       ELGMTEGFDVGLEMSVPSAFHSMLDTMNHGGKIAMLGIPGGEMA-IDWSKVI-----------------F
TDH_SHEAM       DLGMTEGFDVGLEMVPAAFHAM-LDTMNHGGKIAMLGIPGGEMA-IDWSKVIFKGLIIKG---------I
TDH_RHIL3       AIGMTEGFDVGLEMSGAAPAFRDIDKMNNGGKIAILGIAPAG-FEIDWNKVIFKMLNL------------
TDH_RHIEC       AIGMTEGFDVGLEMSGAAPAFRDIDKMNNGGKIAILGIAPAG-FEIDWNKVIFKMLNL------------
TDH_RHIE6       AIGMTEGFDVGLEMSGAAPAFRDIDKMNNGGKIAILGIAPAG-FEIDWNKVIFKMLNL------------
PTGR1_RAT       RTASPDGYDCYFDNVGGEFSNTVILQMKTFGRIAI-----------------------------------
TDH_SHEFN       ELGMTEGFDVGLEMVPSAFHAM-LDTMNHGGKIAMLGIPGGEMA--------------------------
TDH_ANADE       ELGMREGFDVGLEMSGNGRAFRQLEVMNHGGRIALLGIMPGPE-------------PIDWSQVVFKGLQL
PTGR1_BOVIN     KEAAPEGYDCYFDNVGGEFSNVAITQMKKFGRIAICGAISVYNRTSPLSPIIFKELHLQGFVV----YRW
ETR1_SCHPO      TMKQ-----KVPEWIQGGEVKLGIDCVSGRVAAEMAKYMSKGATMATFGGMSRQPLPVPVSLLIFKNLKF
CADH_SACOF      ----------------------------------------------------------------------
TDH_SOLUE       ELGMTEGFDVGLEMSGNPAGFRDM--LANMSHGAKIAMLG-----IPAGE-----MAIDWRTVIFNMLTI
TDH_ANASK       ELGMREGFDVGLEMSGNGRAFRQLLEVMNHGGKVALLGIMAGPEPVDWSQVVFKGLQLKGVYGREMYETW
TDH_ANAD2       ELGMREGFDVGLEMSGNGRAFRQLLEVMNHGGKVALLGIMAGPEPIDWSQVVFKGLQLKGVYGREMYETW
PTGR1_PIG       KKASPEGYDCYFDNVGGEFSNAVTSQMKKFGRIAI-----------------------------------
ADH_STAEQ       RLTNNKGLD-------------------------------------------------------------
TDH_AGRRK       SIGMTEGFDVGLEMSGAAPAFRDIDKMNNGGKIAILGIAPAG-FEIDWNKVIFKMLNL------------
FADH_AMYME      ALTGGFGADVVIDAVGQAFYARDLA-----GTVVLVGVTPDMRLEMPLLDFFSR----------------
TDH_VIBCM       ELGMTEGFDVGLEMSVPSAFSAMLKTMNHGGRIALLGIPPSSMA-IDWNQVIFKGLVIKG---------I
TDH_VIBCH       ELGMTEGFDVGLEMSVPSAFSAMLKTMNHGGRIALLGIPPSSMA-IDWNQVIFKGLVIKG---------I
TDH_VIBC3       ELGMTEGFDVGLEMSVPSAFSAMLKTMNHGGRIALLGIPPSSMA-IDWNQVIFKGLVIKG---------I
TDH_SHESW       ELGMTEGFDVGLEMVPSAFHAM-LDTMNHGGKIAMLGIPGGEMA-IDWSKVIFKGLVIKG---------I
TDH_SHEPA       ELGMTEGFDVGLEMSVPSAFHSMLDTMNHGGKIAMLGIPGGDMA-IDWSKVIFKGLIIKG---------I
TDH_PSEHT       ELGMTEGFDIGLEM--------------------------------------------------------
PKS42_DICDI     SLIDHQGVDLILNTLSVEYMDSNFKCLNQKGRCIDLSI--------------------------------
DOIAD_STRKN     ARRPELTPDVVLE--ASGYLQEAIEVVRPGGRIGLI----GYRVE-ETGPMSPQHIAVKALTLR------
TDH_YERE8       ELGMTEGFDVGLEMSGAPPAFRALNSMNHGGR---IAMLG-----IPPSD-----MSIDWNQVIFKGLFI
TDH_SHESR       ELGMTEGFDVGLEMVPSAFHAM-LDTMNHGGKIAMLGIPGGEMA-IDWSKVIFKGLVIKG---------I
TDH_SHEPC       ELGMTEGFDVGLEMVPSAFHAM-LDTMNHGGKVAMLGIPGGEMA-IDWSKVIFKGLVIKG---------I
TDH_SHEB9       ELGMTEGFDVGLEMVPSAFHAM-LDTMNHGGKVAMLGIPGGEMA-IDWSKVIFKGLVIKG---------I
TDH_SHEB5       ELGMTEGFDVGLEMVPSAFHAM-LDTMNHGGKVAMLGIPGGEMA-IDWSKVIFKGLVIKG---------I
TDH_SHEB2       ELGMTEGFDVGLEMVPSAFHAM-LDTMNHGGKVAMLGIPGGEMA-IDWSKVIFKGLVIKG---------I
TDH_PSEA6       DLGMSEGFDVGLEMSGVPAAFRDMLDKMNHGGKV--AMLG-----IPSGDV----------AVDWNKVIF
ADH_STAES       RLTNNKGLD-------------------------------------------------------------
TDH_SHESM       ELGMTEGFDVGLEMVPSAFHAM-LDTMNHGGKIAMLGIPGGEMA-IDWSKVIFKGLVIKG---------I
TDH_SHESA       ELGMTEGFDVGLEMVPSAFHAM-LDTMNHGGKIAMLGIPGGEMA-IDWSKVIFKGLVIKG---------I
TDH_SHEHH       GMTEGFDVGLEMSGVPSAFHSM-LDTMNHGGKIAMLGIPGGEMA-IDWSKVIFKGLIIKG---------I
TDH_RHILW       SIGMTEGFDVGLEMSGAAPAFRDIDKMNNGGKIAILGIAPAG-FEIDWNKVIFKMLNL------------
TDH_PHOLL       ELGMTEGFDVGLEMSGAPAAFRTLNTMNHGGR---VALLG-----IPPSD-----MAIDWNQVIFKGLFI
RT4I1_DICDI     ----------------------------------------------------------------------
TDH_SHEON       ELGMTEGFDVGLEMSGVPSAFRAMLDTMNHGGKIAMLGIPGGEMAIDWSKVIFKGLVIKG---------I
TDH_EDWI9       ALGMSEGFDVGLEMSAPPAFHTMLDTMNHGGK---IAMLG-----IPPGDM----------AIDWNQVIF
DHSO_HUMAN      RKVEG-----------------------------------------------------------------
CADH4_ARATH     RLAD--SLDYIIDTVPVFHLDPYLACLKLDGKLILMGVINTPLQFVTPLVILGRKV-ISGS---------
PTGR2_MOUSE     EACPG-GVDVYFDNVGGDISNAVISQMNENSHIIL-----------------------------------
PTGR1_HUMAN     KKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAI-----------------------------------
DHSO_MACFA      GKVEG-----------------------------------------------------------------
TDH_SHEB8       ELGMTEGFDVGLEMVPSAFHAM-LDTMNHGGK---VAMLG-----IPSGE-----MAIDWSKVIFKGLVI
QORL1_HUMAN     CLEEGLGVDIVLD--AGVRLYSK-----DDEPAVKLQLLPHKHDIITLLGVGGHWVTTEENLQLDPPDSL
QORL1_BOVIN     ESTGGLGVDIVLD---------------------------------------------------------
BDHA_BACSU      ERT-GGGVDVAFEVTGVPVVLRQIQSTTIAGETVIVSIWEKG-AEIHPNDIVIKERTVKG----------
TDH_SALAR       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPAD-----MSIDWTKVIFKGLFI
TDH_ERWCT       -LTD---VMIELGMTEGFDIGLEMSGAPSAFRAMLKAMNHGGR--IAMLGIPHEPMSIDWGEVIFKGLFI
TDH_SALTY       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SALSV       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SALPK       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SALPC       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SALPB       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SALPA       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SALNS       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SALHS       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SALEP       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SALDC       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SALCH       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SALA4       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_KLEP7       ELGMTEGFDVGLEMSGAPPAFRSLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_KLEP3       ELGMTEGFDVGLEMSGAPPAFRSLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_BACA2       TLTGGEGIDLVCEMSGPAAIAQGLKMAANGGRFHMLSLPERPVTVDLTNDVVFKGLTVQGITGRKMFETW
PTGR2_PONAB     RESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVP-----------------------
TDH_SILPO       ELGLKQGFDVGLEM-SGSQAALDVEALVMGGKIALLG-IPPGKSPVDWSRIVFKAITIKGVYGREMFETW
TDH_SALG2       ELGMTEGFDVGLEMSAPPAFCTMLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_PROMH       ELGMTEGFDVGLEMSGAPPAFRTLSTMNHGGRIALLGIPPSDMA-IDWGQVIFKGLFIKGIYGREMFETW
TDH_ALTMD       ELGMSEGFDVGLEMSGVPVAFRDMLNKMNHGG--KIAMLG-----IPPQDV----------AVDWNQVIF
TDH_AERS4       ALGMTEGFDVGLEM--------------------------------------------------------
QORL1_MOUSE     CLEEGLGVDIVIDAGVRLYSKDDEPAVKLPHKHDIITLLGVGGHWVTTEENLQ---------LDPPDSHL
DOIAD_STRRY     ----------------------------------------------------------------------
DHSO_PONAB      RKVEG-----------------------------------------------------------------
CADH1_TOBAC     ----SDSLDYIIDTVVGHPLEPYLSLLKIDGKLILMGVINTPLQFISPMVMLGRK-SITGS---------
TDH_SHELP       GMTEGFDVGLEMSGVPAAFHSM-LDTMNHGGKIAMLGIPGGDMA-IDWSKVIFKGLIIKG---------I
TDH_MESSB       KLGMTEGFDVGLEMSGSASAFRDMIDVMNNGGKIAILGIAPTGFEIDWNKVIFKMLHLKGIYGREMFETW
TDH_ESCF3       ELGMTEGFDVGLEMSGAPAAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECOLI       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECODH       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECOBW       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
PTGR2_HUMAN     RESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVP-----------------------
CADH1_ORYSJ     S-----SLNFIIDTASGDH---------------------------------------------------
ADH_CLOBE       KLTNGKGVDRVIMAGGGSTLSQAVSMVKPGGIISNINYHGSGDA--------------------------
ADH1_ENTHI      KATDGKGVDKVV----------------------------------------------------------
YCJQ_SHIFL      TLTGKQGADVIIETSGADALQSALRGLAYGGTISYVAFAKPFAEGFNLGHFNNAKIVFSRACSEPNP-DY
YCJQ_ECOLI      TLTGKQGADVIIETSGADALQSALRGLAYGGTISYVAFAKPFAEGFNLGHFNNAKIVFSRACSEPNP-DY
TDH_SALTI       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ENTS8       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWNKVIFKGLFI
YMN1_YEAST      EAAGGENVDYFIDNVGSNVL--------------------------------------------------
TDH_SHISS       ELGMAEGFDIGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECOLU       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_AERHH       ELGMTEGFDVGLEMSGVPSAFQDMIDKMNHGGKIAMLGIPPATMAIDWGKVIFKGLFIKG---------I
YHDH_ECOLI      PLEKAGAIDTVGDKVLAKVLAQ------------------------------------------------
TDH_SHIFL       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SHIF8       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SHIBS       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_SHIB3       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_RHISN       SIGMTEGFDVGLEMSGAAPAFRDIDKMNNGGKIAILGIAPAG-FEIDWNKVIFKMLNL------------
TDH_RHIME       VIGMTEGFDVGLEMSGAAPAFRDIDKMNNGGKIAILGIAPAG-FEIDWNKVIFKMLNL------------
TDH_ECOUT       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECOSM       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECOSE       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECOLC       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECOL6       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECOL5       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECOK1       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECOHS       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECO8A       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECO81       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECO7I       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECO55       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECO45       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECO27       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECO24       ELGMTEGFDVGLEMPGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
PTGR2_RAT       REACPDGVDVYFDNVGGDISNAVISQMNQNSHIIL-----------------------------------
DHB12_BOVIN     ASLAGLNIGVLVNNVGMSY---------------------------------------------------
TDH_VIBPA       GMTE--GFDVGLEMSGNAAFNSMLTTMNHGGR---IALLG-----IPPSDM----------GIDWNQVIF
TDH_PHOPR       GMTEGFDVGLEMSGVPSAFNGM-LASMNHGGKVALLGI--------------------------------
NADE_NOCFA      AVAEGLGLDALRDFVRGNIKARE-----------------------------------------------
TDH_MARMS       EIDMHEGFDVGLEMSGNDMAFRSLECMNHGGKIAMLG-IPGKDTLIDWNQVIFKGLIIKGIYGREMYETW
TDH_ECO5E       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
TDH_ECO57       ELGMTEGFDVGLEMSGAPPAFRTLDTMNHGGR---IAMLG-----IPPSD-----MSIDWTKVIFKGLFI
DHB12_MACFA     TGLAGLEIGILVNNVGMSY---------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KGAIAQALHQNVWPLLASGKIKPVIHKVFPAAQAADAHRLMESSEHIGKIVLTW
QORX_HUMAN      KQMLVNAFTEQILPHFSTQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVL--
QOR_CAVPO       TKEEFQQFASTIQAGMELGWVKPVIGSQYPLEKASQAHNIIHSSGTVGKTVL--
QOR_HUMAN       FQQYAAALQAG----MEIGWLKPVIGSQYPLEKVAEAHNIIHGSGATGKMIL--
QOR_PONAB       FQQYAAALQAG----MEIGWLKPVIGSQYPLEKVAEAHNIIHGSGATGKMIL--
QOR_MOUSE       FQQFAGLLQAGI----EKGWVKPVIGSEYPLEKAAQAHEIIHGSGKTGKMIL--
QOR_RAT         AGILQAGIEK--------GWVKPVIGSEYPLEKAAQAHEIIHSSGKMGKMIL--
QOR_BOVIN       XXXXXXXXXXG----MEIGWLRPVIGPQYLLEKATQAHNIIHSSGATGKMIL--
QOR_LAMGU       XXXXXXXXXXG----MEIGWLRPVIGSQYPLEKVAQAHELTHSSGAAGKVVL--
QOR_PIG         KEEFXXXXXXXXXG-MEVGWLRPVIGPVYPLEKAAQAHEIIHSRGATGKMIL--
VAT1_DANRE      CGLIDQAM-TAVMDLYRQGKVKPRIDSTYHLEQVGDAMRRMQERNNIGKIILT-
QOR_SALTY       QGYITTEASNELFSLIASGVIKVDVNQRYALKDARRAHEVLESRATQGSSLL--
MCAS_MYCBO      PDRVRELL-ATVFKLTADGVLTAPQCTHYPLAEAADAIRAMSNAEHTGKLVL--
FAS_RAT         EGAVAELLKAGI----RDGVVKPLKCTVFPKAQVEDAFRYMAQGKHIGKVLV--
QORL2_BOVIN     P-VFSRSL-SSALQYCQEGRIQPHIGEVFELEEVNDAFLHVTQRKSTGKVLLS-
ADH_SULTO       LG---------IMSLAEAGKVKPMVTKTMKLEEANEAIDNLENFKAVGRQVL--
FAS_MOUSE       HGILLDALFEEAWREVAAGVVKPLKCTVFPKAQVEDAFRYMAQGKHIGKVLV--
QOR_PSEAE       LGSYAQAMADELFGLIERGDIRIEINQRF-------------------------
QOR_ECOLI       QGYITTEASNELFSLIASGVIKVDVQQKYPLKDAQRAHEILESRATQGSSLL--
FAS_HUMAN       NESSAD--WREVWALIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVV--
FAS_BOVIN       EE--NNTMWQEVSTLLKAGVVQPLKRTVFPRTQAEDAFRYMAQGKHIGKVVI--
QORL2_RAT       SKSMSTALQ-----YCQQGLIHPHTGAVFKLEKVNDAFLHVMQRKSTGKVLLS-
YOGA_BACSU      SGEEFQAM----LAFIDKHKLRPVIDRIYPLEKACEAYKRMQEGRQFGNI----
VAT1_MOUSE      CGELVNSVVTRLVALYNQGHIKPRIDSVWPFEKVADAMKQMQEKKNIGKVLL--
QORL2_MOUSE     --AVFSKSMSTAMQYCQQGLIHPHTGAVFKLEKINDAFLHVMQRKSTGKVLLS-
YGD6_SCHPO      VGSV--SMFRDMVACIEAKDIHPVVDKVFPFDQLKEAYEYQWSQAHIGKVVL--
VAT1_HUMAN      CGELVSGVVARLLALYNQGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLL--
VAT1L_MOUSE     RSGLIRGVVEKLIGLYNQKKIKPVVDSLWALEEVKEAMQRIHDRGNIGKLIL--
RT4I1_BOVIN     RWAFFMASGDDIAELVEAGKIQPVIEKTFPFSKVPEAFLKVERGHARGKTVI--
VAT1L_HUMAN     RAGLIRGVVEKLIGLYNQKKIKPVVDSLWALEEVKEAMQRIHDRGNIGKLIL--
ADH2_BACST      ---------QEALDFAARGKVRPIV-ETAELEEINEVFERMEKGKINGRIVL--
QORL2_NEMVE     RESVDKTLE-----YFKNGKLKPYISASFGLDKVNEAFQMILQRKSTGKVVI--
RT4I1_DANRE     FAPSGSALDE-VSEMVDAGKVRPVVEEVFSFAQVPEAFQKVEQGHARGKTVVS-
PKS37_DICDI     RDYLREIMIDQLLPCFKNGSLKPLNQHCFNSCDLVKAIRFMSSGNHIGKILINW
RT4I1_HUMAN     RWAFFMASGDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVI--
ZADH2_HUMAN     QAAMSHLLEMCV------------------------------------------
ZADH2_BOVIN     RGAMDHLL----------------------------------------------
RT4I1_MOUSE     RWAFFMAYLDEIAELVDAGKIRPVIERTFPFSEVPEAFLKVERGHARGKTVV--
VAT1_TORCA      ------------------------------------------------------
QOR_SCHPO       GHAVFEGYVSRLWKEILDNNLNIAIHHIFKLSEAKEAHDAIESRATTGKLLL--
QOR_LEIAM       NGFFLPQFHDNLLQYLKAGQVKLFVKKVFHGSSVADAVDHLYSGANYGKVLV--
QORL_ARATH      ----------KLNPYIESGKVKPVVDPPFPFSRVADAFSYLETNHATGKVVV--
ADH1_KLUMA      ------ADTREALDFFSRGLVKAPI-KILGLSELASVYDKMVKGQIVGRIVV--
ZDH1_STAEQ      TDDVIKEYLKDITEKVEQGYYQPTTTKVIDGLDVYEAHQILESHSMIGKLVI--
FAS_CHICK       HGILLDSIFEQEWEVVSDGVVKPLRTTVFGKEEVEAAFRFMAQGKHIGKVMI--
ADH1_EMENI      EAL----------DFFARGLIKAPF-KTAPLKDLPKIYELMEQGRIAGRYVL--
ADH1_NEUCR      ---------QEALDFFARGLIKVPI-KTVGLSKLQEVYDLMEEGKIVGRYVV--
ZDH1_STAES      TDDVIKEYLKDITEKVEQGYYQPTTTKVIDGLDVYEAHQILESHSMIGKLVI--
ADH_SULSR       VGSLVQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAVGRQVL--
ZADH2_MOUSE     RG----------------------------------------------------
QOR_YEAST       YGYIAKYYSDEFFGLVNSKKLNIKIYKTYPLRDYRTAAADIESRKTVGKLVL--
ADH_SCHPO       EAL----------EYVSRGLVKP-YYKVQPFSTLPDVYRLMHENKIAGRIVL--
ADH2_KLULA      ------ADTREALDFFARGLVHAPI-KIVGLSELADVYDKMVKGEIVGRYVV--
PKS16_DICDI     NSKIVRDILTEVFDAISDGSLENIPVKVFPATQVKTAIEYINERVHIGKIVV--
DHSO_BACHD      EPALSLLNEKKV-------NAKTLVTHEYTISEWDKAYHAIKSGEAI-KVLLT-
PKS25_DICDI     ------------------------------------------------------
ZDH1_STAAC      TPDMIKQHEEDITKNIESGHYQPTTTQVFEGLSPENAHQLLEKQSMIGKLVI--
ZDH1_STAAW      TPDMIKQHEEDITKNIESGHYQPTTTQVFEGLSPENAHQLLEKQSMIGKLVI--
ZDH1_STAAS      TPDMIKQHEEDITKNIESGHYQPTTTQVFEGLSPENAHQLLEKQSMIGKLVI--
ADH1_PICST      ----AEAI-----DFFTRGLIKCPI-KVVGLSELPKVYELMEAGKVIGRYVV--
ZDH1_STAAR      TPDMIKQHEEDITKNIESGHYQPTTTQVFEGLSPENAHLLLEKQSMIGKLVI--
PKS21_DICDI     NKKVVSRLLKSISNALNENKLKPIPITTFQIEDVKEAIEYINQRKHIGKIVL--
ADH1_BACST      ---------QEALQFAAEGKVKTIV-EVQPLENINDVFDRMLKGQINGRVVL--
ZDH1_STAAN      TPDMIKQHEEDITKNIELGHYQPTTTQVFEGLSPENAHQLLEKQSMIGKLVI--
ZDH1_STAAM      TPDMIKQHEEDITKNIELGHYQPTTTQVFEGLSPENAHQLLEKQSMIGKLVI--
TOXD_COCCA      ------------------------------------------------------
ADHA_RHIME      ------------------------------------------------------
PKS18_DICDI     KFLIQKSL-KKIKIGIESGELKLIPITAYSNSNAKEAIEFINQRKHIGKIVL--
ADH3_BACST      ---------QEALQFAAEGKVKTII-EVQPLEKINEVFDRMLKGQINGRVVLT-
QORH_SPIOL      ---------EYVVNLVKEKKLKTVIDSKHPLSKGEDAWSRIMGGHATGKIII--
PKS2_DICDI      ER--NKLILQEVMDMFVNENLALLPIKEYSVKDIKEAIEFIAERKHIGKIVV--
ADH_SULSO       VGSLVQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAIGRQVL--
YJMD_BACSU      ------------------------------------------------------
INC11_TRIAT     ------------------------------------------------------
ADH5_YEAST      ------ADTREALDFFARGLIKSPIH-LAGLSDVPEIFAKMEKGEIVGRYVV--
ADH5_SACPS      ------ADTREALDFFARGLIKSPIH-LAGLSDVPEIFAKMEKGEIVGRYVV--
PKS17_DICDI     NSKIIRDILTEVFDAISDGSLENIPVKVFPAIQVKTAIEYINERVHIGKIVV--
ADH3_KLULA      REAI---------NFFANGHVHSPI-KVVGLSELPKVYELMEQGKILGRYVV--
ADH1_CANAL      ----AEAI-----DFFSRGLIKCPI-KIVGLSDLPEVFKLMEEGKILGRYVL--
PKS19_DICDI     LKSISNALNEN--------KVKLIPITTFQIENVKEAIEYINQRKHIGKIVL--
PKS15_DICDI     ------------------------------------------------------
ADH4_KLULA      ------ADTREATDFFTRGLVKSPI-KIIGLSELPEAYELMEQGKILGRFVV--
QORH_ARATH      EFMV---------NLVKEGKVKTVIDSKHPLSKAEDAWAKSIDGHATGKIIV--
YKM8_SCHPO      LPQYQEQYFEEMPKLIAEGKIK--------------------------------
PKS41_DICDI     ------------------------------------------------------
MECR_DROME      SSPERSKMFKEIFELMEQGKFVAPNHEMVPLAKFKD------------------
ADH1_ASPFN      EAV----------DFFARGLIKAPF-KTAPLQDLPKIFELMEQGKIAGRYVL--
MECR1_CAEEL     ------------------------------------------------------
ERYA2_SACER     DLGEAGEILREVVGLLGAGELDRLPVSAWELGSAPAALQHMSRGRHVGKLVLT-
YBJB_SCHPO      ------------------------------------------------------
PTGR1_CAVPO     QGDVREKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVT-
PKS28_DICDI     NGKMVRSYLKKIIKMINSNKLEPIIE--YSNNQFKDAIEYINQRKHIGKIIV--
YBI2_SCHPO      SSHVDQEMLRDFVDFVMKHNIKTVIDSVYDFEDTVEAFNRLMTHRCKGKVII--
PKS40_DICDI     ------------------------------------------------------
PKS1_DICDI      KPKLLQSILQRITNSIVNGSLEKIPITIFPSTETKDAIELLSKRSHIGKVVV--
TDH_PYRHO       -GRHLWETWYTVSRLLQSGKLNPIIHKYKGFDKYEEAFELMRAGK-TGKVV---
TDH_PYRAB       -GRHLWETWYTVSRLLQSGKLNPIIHKYKGFDKYEEAFELMRAGK-TGKVV---
RSPB_ECOLI      ------RLNANKFPILSKGLIKPLITHTFDFQHVADAISLFEQDQHCCKVLLTF
TDH_THETN       KGLLKSGLAED---------LKPIITHTFPLTEYQKGMELMIKGQ-CGKVVL--
TDH_SYMTH       --RMWQTWYQ-VRSLYRAGRLRPLVTHRMPLEQIDAAMELMGSGQS-GKIVL--
TDH_PYRFU       -GRHLWETWYTVSRLLQSGKIDPIIHKYKGFDKYEEAFELMRAGK-TGKVV---
ADH2_PICST      ----AEAI-----DFFTRGLIKCPI-KIVGLSELASVYELMEQGKILGRYVV--
TDH_CHRVO       YKMVA---------LIQSGDISPIITHHFKVDEFEQGFAAMLSGQS-GKVILDW
TDH_ANADF       YKMVA---------MLQSGDISPVITHRFPIDEFQQGFDVMRSGQS-GKVVLDW
PKS31_DICDI     ------------------------------------------------------
PHAS_MYCTU      PEELRDLLG-TVYRLTAAGELPMPQSTHYPLVEAATAIRVMGNAEHTGKLVL--
PHAS_MYCTA      PEELRDLLG-TVYRLTAAGELPMPQSTHYPLVEAATAIRVMGNAEHTGKLVL--
PHAS_MYCBP      PEELRDLLG-TVYRLTAAGELPMPQSTHYPLVEAATAIRVMGNAEHTGKLVL--
PHAS_MYCBO      PEELRDLLG-TVYRLTAAGELPMPQSTHYPLVEAATAIRVMGNAEHTGKLVL--
ADH2_CANAL      ----AEAV-----DFFTRGLIKCPI-KIVGLSELPEVYKLMEEGKILGRYVL--
PKS13_DICDI     ESGELQVI--------------PIIE--FSNSNIRDAIEFINERQHIGKIVIS-
ADH1_KLULA      REAI---------DFFSRGLVKAPIH-VVGLSELPSIYEKMEKGAIVGRYVV--
TDH_THET2       MQGTA---------LVYSGRVSPLITHRLPLSRYREAFGLLASGQAV-KVIL--
PKS5_DICDI      ------------------------------------------------------
PKS39_DICDI     PGKLIKSYLKKIIEMINSNELEPIIE--YSNNQFKDAIEYINQRKHIGKIIV--
PKS45_DICDI     YNGFEKSKHQLIIDMIKNKELPLIPIKEYPINQIKDAIEFIGQRKHIGKIVI--
YHFP_BACSU      RAAVWERMSSDLKP----------------------------------------
PKS7_DICDI      ------------------------------------------------------
ADH_STAAW       ------------------------------------------------------
ADH_STAAS       ------------------------------------------------------
ADH_STAAR       ------------------------------------------------------
ADH_STAAN       ------------------------------------------------------
ADH_STAAM       ------------------------------------------------------
ADH_STAAC       ------------------------------------------------------
ADH_STAAB       ------------------------------------------------------
ADH_STAA8       ------------------------------------------------------
ADH_STAA3       ------------------------------------------------------
PKS3_DICDI      ------------------------------------------------------
TDH_THET8       MQGTA---------LVYSGRVSPLLTHRLPLSRYREAFGLLASGQAV-KVIL--
TDH_THEON       ------------------------------------------------------
YNN4_YEAST      ------------------------------------------------------
ADH1_YEAST      ------ADTREALDFFARGLVKSPI-KVVGLSTLPEIYEKMEKGQIVGRYVV--
ADH2_YEAST      ------ADTREALDFFARGLVKSPI-KVVGLSSLPEIYEKMEKGQIAGRYVV--
ADH_RALEU       ------------------------------------------------------
TDH_PYRKO       ------------------------------------------------------
ADH_SULAC       IGTLTGNRKDEVLELAENGKIKPMITKVLSLEEANDALDNLEKGKVSGRQVL--
PKS44_DICDI     YNGFEKSKHQLITDMIKNKELPLIPIKEYPINQIKDAIDFIGQRKHIGKIVI--
PKS29_DICDI     ------------------------------------------------------
MECR_RAT        RG----------------------------------------------------
ETR1_YARLI      ------------------------------------------------------
ADH2_KLUMA      ------------------------------------------------------
DHSO_BACSU      ------------------------------------------------------
TDH_SACEN       KGIYGREMFETWYSLLQSGDLSPVITHRFPCTRHVEAFETARAG-RCGKVILDW
P2_ARATH        YDKYPKFL-ELVLPRIKEGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVV--
MECR_HUMAN      ------------------------------------------------------
PTGR1_RABIT     KGEVGQKALKELLTWVLEGKIQYREFVIEGFENMPAAFMRMLKGENVGK-----
PKS32_DICDI     KGYL-----KKIIKMANSNKLEPIIE--YSNNQFKDAIEYINQRKHIGKIIV--
PKS22_DICDI     RK--HKHVLKIIVDLLASGKLKTIPFNVYPVTKIKEAIESLGDRKHIGKNIVNF
TDH_COXBU       GRRMFETWYKMTNLLLSGLDISPIITHEFPMKDFQQAFDVMLSGK-TGKVILNW
TDH_COXBR       GRRMFETWYKMTNLLLSGLDISPIITHEFPMKDFQQAFDVMLSGK-TGKVILNW
TDH_COXBN       GRRMFETWYKMTNLLLSGLDISPIITHEFPMKDFQQAFDVMLSGK-TGKVILNW
TDH_COXB2       GRRMFETWYKMTNLLLSGLDISPIITHEFPMKDFQQAFDVMLSGK-TGKVILNW
PKS8_DICDI      ------------------------------------------------------
YFMJ_BACSU      ------------------------------------------------------
ADHP_ECOLI      ------------------------------------------------------
PTGR1_MOUSE     ------------------------------------------------------
PKS6_DICDI      ------------------------------------------------------
PKS14_DICDI     ------------------------------------------------------
MECR_DANRE      ------------------------------------------------------
ADH1_ZYMMO      ---------KEAFQFAAEGKVKPKVTK----RKVEEINQIFDEMEH--------
PKS9_DICDI      ------------------------------------------------------
TDH_BURXL       YKMVA---------MLQSGDLSPILTHHFKVDDYREAFATMLSGES-GKVILDW
TDH_BURS3       YKMVA---------MLQSGDLSPIITHRFAADDYEKGFAAMLSGES-GKVILDW
TDH_BURPP       KGIYGREMFETWYKMVASGDLSPILTHHFKVDDYQEAFATMLSGES-GKVILDW
PKS38_DICDI     ------------------------------------------------------
P1_ARATH        YDKYSKFL-EFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVV--
YDJJ_ECOLI      ------------------------------------------------------
TDH_PROAC       ETWYTMA------SLIRSGDISGIITDRYPITEFREAFD-VAGSGHGGKVVMNW
TDH_LEGPA       YKMIA---------MLQSGNISPVITHNFPVDEYQHAFQIMASGQS-GKVILNW
TDH_BURCJ       YKMVA---------MLQSGDLSPIITHRFAADDYEQGFAAMLSGES-GKVILDW
TDH_BURCH       YKMVA---------MLQSGDLSPIITHRFAADDYEQGFAAMLSGES-GKVILDW
TDH_BURCC       YKMVA---------MLQSGDLSPIITHRFAADDYEQGFAAMLSGES-GKVILDW
TDH_BURCA       YKMVA---------MLQSGDLSPIITHRFAADDYEQGFAAMLSGES-GKVILDW
PKS33_DICDI     ------------------------------------------------------
ADH3_YEAST      ------ADTREALDFFSRGLIKSPI-KIVGLSELPKVYDLMEKGKILGRYVV--
PKS34_DICDI     ------------------------------------------------------
MECR_MOUSE      RG----------------------------------------------------
MECR2_CAEEL     ------------------------------------------------------
TDH_BURCM       YKMVA---------MLQSGDLSPIITHRFAADDYEKGFAAMLSGES-GKVILDW
TDH_BACLD       R---------QVSGLLQSGQIKPVITHRFPMEEFEKGFELMRKGQ-CGKVVL--
PKS27_DICDI     NGKMVRSYLKKIIKMINSNKLEPIIE--YSNNQFKDAIEYVNQGKHIGKIIV--
PKS23_DICDI     RK--HKHVLKIIVDLLASGKLKTIPFNVYPVTKIKEAIESLGDRKHIGKNIVNF
ADH3_EMENI      KKAPLQDLPQ-IFELMGQGKI---------------------------------
TDH_YERPY       KGIYGREMFETWYALIQSGDLTPIITHRFPIDEFQQGFDAMRSGKS-GKVVLSW
TDH_YERPS       KGIYGREMFETWYALIQSGDLTPIITHRFPIDEFQQGFDAMRSGKS-GKVVLSW
TDH_YERPB       KGIYGREMFETWYALIQSGDLTPIITHRFPIDEFQQGFDAMRSGKS-GKVVLSW
TDH_YERP3       KGIYGREMFETWYALIQSGDLTPIITHRFPIDEFQQGFDAMRSGKS-GKVVLSW
TDH_BURA4       YKMVA---------MLQSGDLSPIITHRFAADDYEKGFAAMLSGES-GKVILDW
CIPB_EMENI      DNQVGKAIYEDYLPALKAGSFIP-------------------------------
CADH3_ARATH     ------------------------------------------------------
ADH2_EMENI      ------------------------------------------------------
TDH_BURP8       YKMVA---------MLQSGDLSPILTHRFAVDDYEKAFATMLSGES-GKVILDW
TDH_SHEWM       YGREMFETWYKMASLIQSGDISPIIYKVDEFQQGFDAMRSGQS----GKVILNW
TDH_SERP5       KGIYGREMFETWYALIQSGDLTPIITHRFTIDQFQQGFDAMRSGQS-GKVVLSW
TDH_LEGPL       YKMIA---------MLQSGNISPVITHNFPVDEYQHAFQIMASGQS-GKVILNW
TDH_LEGPH       YKMIA---------MLQSGNISPVITHNFPVDEYQHAFQIMASGQS-GKVILNW
TDH_LEGPC       YKMIA---------MLQSGNISPVITHNFPVDEYQHAFQIMASGQS-GKVILNW
TDH_BURM1       YKMVA---------MLQSGDLSPIITHRFAADDYEKGFAAMLSGES-GKVILDW
TDH_BURPS       YKMVA---------MLQSGDLSPIITHRFAVDDYEKGFAAMLSGES-GKVILDW
TDH_BURP6       YKMVA---------MLQSGDLSPIITHRFAVDDYEKGFAAMLSGES-GKVILDW
TDH_BURP1       YKMVA---------MLQSGDLSPIITHRFAVDDYEKGFAAMLSGES-GKVILDW
TDH_BURP0       YKMVA---------MLQSGDLSPIITHRFAVDDYEKGFAAMLSGES-GKVILDW
TDH_BURMS       YKMVA---------MLQSGDLSPIITHRFAVDDYEKGFAAMLSGES-GKVILDW
TDH_BURMA       YKMVA---------MLQSGDLSPIITHRFAVDDYEKGFAAMLSGES-GKVILDW
TDH_BURM9       YKMVA---------MLQSGDLSPIITHRFAVDDYEKGFAAMLSGES-GKVILDW
TDH_BURM7       YKMVA---------MLQSGDLSPIITHRFAVDDYEKGFAAMLSGES-GKVILDW
TDH_BACSU       TGRKMFSTWRQVSQLISSNMIAPVITHQFPLEEFEKGFELMRSGQ-CGKVIL--
TDH_PSYIN       KGLVIKGIYGETWSLIQSGDLDPIITHTFPVDKFQEGFDMMRSGKS-GKVILDW
TDH_BURVG       YKMVA---------MLQSGDLSPIVTHRFAVDDYEKGFAAMLSGES-GKVILDW
PKS30_DICDI     ------------------------------------------------------
CADH2_ARATH     ------------------------------------------------------
YL460_YEAST     ------------------------------------------------------
YDJL_ECOLI      --AYDSTSWRNAIRLLASGKVKPMITHRIGLSQWREGFDAMVDKTAI-KVIMTY
TDH_BURTA       YKMVA---------MLQSGDLSPIITHRFAVDDYEKGFAAMLSGES-GKVILDW
MECR_DICDI      TDSEKQSVYDAIFDLIRKKQFKLLIEK-HKFSEFDQALLKSQQSGHGRKIVL--
YCZ2_YEAST      ------------------------------------------------------
TDH_SHESH       KGLILKGIYGETWSLIQSGDISPIIFKIDDFQQGFDAMRSGQS----GKVILNW
TDH_SHEAM       YGREMFETWYKMASLLQSGDLSPIVFKVDDFQQGFDAMRSGQS----GKVILSW
TDH_RHIL3       KGIYGREMFETWYKMIAFVQLAPIITHRIGIDDFRDGFEAMRSG-NSGKVVMDW
TDH_RHIEC       KGIYGREMFETWYKMIAFVQLSPIITHRIKIDDFRDGFEAMRSG-NSGKVVMDW
TDH_RHIE6       KGIYGREMFETWYKMIAFVQLSPIITHRIKIDDFRDGFEAMRSG-NSGKVVMDW
PTGR1_RAT       ------------------------------------------------------
TDH_SHEFN       ------------------------------------------------------
TDH_ANADE       KGVYGREMYETWYKMVASGDLSAVVTHRFSIDDFQQGFDVMRSGRS-GKVVLDW
PTGR1_BOVIN     QGEVRQKALRDLLKWVSEGKIQYHEHVTEGFENMPAAFIGLLKGENLGKAIV--
ETR1_SCHPO      HG----------------------------------------------------
CADH_SACOF      ------------------------------------------------------
TDH_SOLUE       KGIYGREMYETWYKMLQSGDISPVITHRYHYTDFEKGFEVM-SSGNSGKVILSW
TDH_ANASK       YKMVA---------MLQSGDLSAVVTHRFSIDDFQQGFDVMRSGRS-GKVVLDW
TDH_ANAD2       YKMVA---------MLQSGDLTAVVTHRFSIDDFQQGFDVMRSGRS-GKVVLDW
PTGR1_PIG       ------------------------------------------------------
ADH_STAEQ       ------------------------------------------------------
TDH_AGRRK       KGIYGREMFETWYKMIAFVQVSPVITHRIGIDDFREGFEAMRSG-NSGKVVMDW
FADH_AMYME      ------------------------------------------------------
TDH_VIBCM       YGREMFETWYKMASLIQSGDISPIITHHFKVDDFQKGFDIMRSGAS-GKVILDW
TDH_VIBCH       YGREMFETWYKMASLIQSGDISPIITHHFKVDDFQKGFDIMRSGAS-GKVILDW
TDH_VIBC3       YGREMFETWYKMASLIQSGDISPIITHHFKVDDFQKGFDIMRSGAS-GKVILDW
TDH_SHESW       YGREMFETWYKMASLIQSGDISPIITHHFKIDDFQQGFDAMGSGQS-GKVILSW
TDH_SHEPA       YGREMFETWYKMASLIQSGDISPIIYSIDEFQQGFDAMRSGQS----GKVILNW
TDH_PSEHT       ------------------------------------------------------
PKS42_DICDI     ------------------------------------------------------
DOIAD_STRKN     ------------------------------------------------------
TDH_YERE8       KGIYGREMFETWYALIQSGDLTPIITHRFSIDEFQQGFDAMRSGKS-GKVILNW
TDH_SHESR       YGREMFETWYKMASLIQSGDISPIIYKIDDFQKGFDA----MGSGQSGKVILSW
TDH_SHEPC       YGREMFETWYKMASLIQSGDISPIIYKIDDFQKGFDA----MGSGQSGKVILSW
TDH_SHEB9       YGREMFETWYKMASLIQSGDISPIITHHFKIDDFQQGFDAMGSGQS-GKVILSW
TDH_SHEB5       YGREMFETWYKMASLIQSGDISPIITHHFKIDDFQQGFDAMGSGQS-GKVILSW
TDH_SHEB2       YGREMFETWYKMASLIQSGDISPIITHHFKIDDFQQGFDAMGSGQS-GKVILSW
TDH_PSEA6       KGLVIKGIYGETWYKMASLNLAPIITHQFNIDEFQQGFDTMGSGQS-GKVILNW
ADH_STAES       ------------------------------------------------------
TDH_SHESM       YGREMFETWYKMASLIQSGDISPIIYKIDDFQKGFDA----MGSGQSGKVILSW
TDH_SHESA       YGREMFETWYKMASLIQSGDISPIIYKIDDFQKGFDA----MGSGQSGKVILSW
TDH_SHEHH       YGREMFETWYKMASLIQSGDISPIITHHFSIDEFQQGFDAMRSGQS-GKVILNW
TDH_RHILW       KGIYGREMFETWYKMIAFVQLAPIITHRIGIDEFRDGFEAMRSG-NSGKVVMDW
TDH_PHOLL       KGIYGREMFETWYTLIQSGDLTPIITHRFSIDDFQKGFDIMRSGQS-GKVILNW
RT4I1_DICDI     ------------------------------------------------------
TDH_SHEON       YGREMFETWYKMASLIQSGDISPIIYKIDDFQKGFDA----MGSGQSGKVILSW
TDH_EDWI9       KGLLIKGIYGETWALIQSGDLTPIITHQYAIDDFQKGFDVMRSG-HSGKVILNW
DHSO_HUMAN      ------------------------------------------------------
CADH4_ARATH     ------------------------------------------------------
PTGR2_MOUSE     ------------------------------------------------------
PTGR1_HUMAN     ------------------------------------------------------
DHSO_MACFA      ------------------------------------------------------
TDH_SHEB8       KGIYGREMFETWYSLIQSGDISPIITHHFKIDDFQQGFDAMGSGQS-GKVILSW
QORL1_HUMAN     KGATLAFLNDEVWNL---------------------------------------
QORL1_BOVIN     ------------------------------------------------------
BDHA_BACSU      ------------------------------------------------------
TDH_SALAR       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ERWCT       KGIYGREMFETWYALIQSGDLSPIITHRFHIDEFQKGFDAMRSGQS-GKVILNW
TDH_SALTY       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SALSV       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SALPK       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SALPC       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SALPB       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SALPA       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SALNS       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SALHS       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SALEP       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SALDC       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SALCH       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SALA4       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_KLEP7       KGIYGREMFETWYALIQSGDLSPIITHRFGIDDFQKGFDAMRSGQS-GKVVLSW
TDH_KLEP3       KGIYGREMFETWYALIQSGDLSPIITHRFGIDDFQKGFDAMRSGQS-GKVVLSW
TDH_BACA2       R----QVSH-----LLESGDLTPVITHQLPLEDFEKGFDLMRKGQ-CGKVIL--
PTGR2_PONAB     ------------------------------------------------------
TDH_SILPO       YKMIA---------MLQNGDVSRVITHRFGVDEFREGFAAMKSGLS-GKVVLDW
TDH_SALG2       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_PROMH       YKMAA---------LIQSGDLSPIITHQFPIDEFQKGFDIMRSGQS-GKVILDW
TDH_ALTMD       KGLVIKGIYGETWSLLQSGDLSPIITHTFSIDDFQKGFDTM-GSGHSGKVILDW
TDH_AERS4       ------------------------------------------------------
QORL1_MOUSE     KGATVAFLNDEVWNLLSAGVFRPLLDEPIPLYEAKVSMEVVQKNQERKKQVV--
DOIAD_STRRY     ------------------------------------------------------
DHSO_PONAB      ------------------------------------------------------
CADH1_TOBAC     ------------------------------------------------------
TDH_SHELP       YGREMFETWYKMASLIQSGDISPIITHHYNVDDFQAGFDAMRSGQS-GKVILSW
TDH_MESSB       YKMI--ALVQG--PLDISGLI---THRI-SADDYREGFAAMRSGE-AGKVVMDW
TDH_ESCF3       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECOLI       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECODH       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECOBW       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
PTGR2_HUMAN     ------------------------------------------------------
CADH1_ORYSJ     ------------------------------------------------------
ADH_CLOBE       ------------------------------------------------------
ADH1_ENTHI      ------------------------------------------------------
YCJQ_SHIFL      PRWSRKRIEETCWELLMNG-----------------------------------
YCJQ_ECOLI      PRWSRKRIEETCWELLMNG-----------------------------------
TDH_SALTI       KGIYGREMFETWYALIQSGDLSPIITHRFSVDDFQKGFDAMCSGQS-GKVILSW
TDH_ENTS8       KGIYGREMFETWYALIQSGDLSPIITHRFTIDDFQKGFDAMRSGQS-GKVILSW
YMN1_YEAST      ------------------------------------------------------
TDH_SHISS       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECOLU       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_AERHH       YGREMFETWYKMASLIQSGDLSPIITHRFHIDDFQQGFDAMRSGQS-GKVILSW
YHDH_ECOLI      ------------------------------------------------------
TDH_SHIFL       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SHIF8       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SHIBS       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_SHIB3       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_RHISN       KGIYGREMFETWYKMIAFVQLAPVITHRIGIDAFRDGFEAMRSG-NSGKVVMDW
TDH_RHIME       KGIYGREMFETWYKMIAFVQLSPIITHRIGIDDFRDGFEAMRSG-NSGKVVMDW
TDH_ECOUT       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECOSM       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECOSE       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECOLC       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECOL6       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECOL5       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECOK1       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECOHS       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECO8A       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECO81       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECO7I       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECO55       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECO45       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECO27       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
TDH_ECO24       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMRSGQS-GKVILSW
PTGR2_RAT       ------------------------------------------------------
DHB12_BOVIN     ------------------------------------------------------
TDH_VIBPA       KGLVIKGIYGETWSLIQSGDLSPIITHHYKIDDFQEGFDVMRSGMS-GKVILDW
TDH_PHOPR       ------------------------------------------------------
NADE_NOCFA      ------------------------------------------------------
TDH_MARMS       YKMVA---------MLQSGDISPIITHRFKVDEFQQGFDTMGSGLS-GKVILDW
TDH_ECO5E       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMCSGQS-GKVILSW
TDH_ECO57       KGIYGREMFETWYALIQSGDLSPIITHRFSIDDFQKGFDAMCSGQS-GKVILSW
DHB12_MACFA     ------------------------------------------------------