[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07859.1

[Show Plain Result]


## Summary of Sequence Search
    1::259
    6::255     1e-31  32%  257 aa  ECHH_RHIME RecName: Full=Probable enoyl-CoA hydratase;       
   47::285     7e-31  32%  288 aa  ECHM_CAEEL RecName: Full=Probable enoyl-CoA hydratase,
    6::254     1e-30  31%  257 aa  ECHA8_MYCTU RecName: Full=Probable enoyl-CoA hydratase echA8;      
    6::254     1e-30  31%  257 aa  ECHA8_MYCBO RecName: Full=Probable enoyl-CoA hydratase echA8;      
   16::254     3e-29  30%  257 aa  ECHA8_MYCLE RecName: Full=Probable enoyl-CoA hydratase echA8;      
   49::288     4e-29  30%  290 aa  ECHM_HUMAN RecName: Full=Enoyl-CoA hydratase, mitochondrial;       
    6::254     5e-29  29%  261 aa  CRT_CLOAB RecName: Full=3-hydroxybutyryl-CoA dehydratase;       
   49::288     7e-29  30%  290 aa  ECHM_MOUSE RecName: Full=Enoyl-CoA hydratase, mitochondrial;       
   36::274     1e-28  30%  277 aa  ECHM_DICDI RecName: Full=Probable enoyl-CoA hydratase,
   49::288     3e-28  30%  290 aa  ECHM_RAT RecName: Full=Enoyl-CoA hydratase, mitochondrial;       
   49::288     3e-28  29%  290 aa  ECHM_PONAB RecName: Full=Enoyl-CoA hydratase, mitochondrial;       
   49::288     7e-28  29%  290 aa  ECHM_BOVIN RecName: Full=Enoyl-CoA hydratase, mitochondrial;       
   28::290     5e-26  31%  293 aa  ECH1_DICDI RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA
    5::259     1e-25  30%  262 aa  PAAG_ECOLI RecName: Full=Probable enoyl-CoA hydratase paaG;        
   52::289     1e-24  29%  294 aa  ECHD3_XENLA RecName: Full=Enoyl-CoA hydratase domain-containing
   59::296     5e-24  30%  300 aa  ECHD3_RAT RecName: Full=Enoyl-CoA hydratase domain-containing
   50::296     3e-23  28%  303 aa  ECHD3_HUMAN RecName: Full=Enoyl-CoA hydratase domain-containing
    6::258     4e-23  26%  260 aa  YNGF_BACSU RecName: Full=Putative enoyl-CoA hydratase/isomerase
   59::296     7e-23  29%  300 aa  ECHD3_MOUSE RecName: Full=Enoyl-CoA hydratase domain-containing
    1::259     1e-22  29%  261 aa  CAID_ECO57 RecName: Full=Carnitinyl-CoA dehydratase;       
   12::264     2e-22  29%  271 aa  MENB_BACSU RecName: Full=Naphthoate synthase;       
    1::259     3e-22  29%  261 aa  CAID_SHIFL RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     3e-22  27%  261 aa  CAID_SALAR RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     3e-22  28%  261 aa  CAID_ECOSM RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     3e-22  29%  261 aa  CAID_ECOLI RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     3e-22  29%  261 aa  CAID_ECOLC RecName: Full=Carnitinyl-CoA dehydratase;       
   17::265     4e-22  30%  272 aa  MENB_STAS1 RecName: Full=Naphthoate synthase;       
    1::259     4e-22  28%  261 aa  CAID_ECOL6 RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     4e-22  28%  261 aa  CAID_ECOL5 RecName: Full=Carnitinyl-CoA dehydratase;       
   44::253     5e-22  32%  255 aa  PAAF_ECOLI RecName: Full=Probable enoyl-CoA hydratase paaF;        
   25::265     5e-22  32%  272 aa  MENB_STAHJ RecName: Full=Naphthoate synthase;       
    6::241     5e-22  29%  243 aa  ECHA6_MYCTU RecName: Full=Probable enoyl-CoA hydratase echA6;      
    6::241     5e-22  29%  243 aa  ECHA6_MYCBO RecName: Full=Probable enoyl-CoA hydratase echA6;      
   48::258     8e-22  31%  261 aa  MMCD_ECOLI RecName: Full=Methylmalonyl-CoA decarboxylase;       
    1::259     8e-22  27%  261 aa  CAID_CITK8 RecName: Full=Carnitinyl-CoA dehydratase;       
   25::265     1e-21  31%  272 aa  MENB_STAES RecName: Full=Naphthoate synthase;       
   25::265     1e-21  31%  272 aa  MENB_STAEQ RecName: Full=Naphthoate synthase;       
    1::259     1e-21  26%  261 aa  CAID_SALG2 RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     1e-21  26%  261 aa  CAID_SALEP RecName: Full=Carnitinyl-CoA dehydratase;       
   26::278     1e-21  29%  285 aa  MENB_PASMU RecName: Full=Naphthoate synthase;       
   32::279     1e-21  30%  289 aa  ECHD3_DANRE RecName: Full=Enoyl-CoA hydratase domain-containing
    1::259     1e-21  26%  261 aa  CAID_SALTI RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     1e-21  26%  261 aa  CAID_SALPK RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     1e-21  26%  261 aa  CAID_SALPC RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     1e-21  26%  261 aa  CAID_SALPA RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     1e-21  26%  261 aa  CAID_SALCH RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     1e-21  26%  261 aa  CAID_SALA4 RecName: Full=Carnitinyl-CoA dehydratase;       
   32::278     2e-21  30%  285 aa  MENB_ECOLI RecName: Full=Naphthoate synthase;       
   32::278     2e-21  30%  285 aa  MENB_ECOL6 RecName: Full=Naphthoate synthase;       
    1::259     2e-21  26%  261 aa  CAID_SALTY RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     2e-21  26%  261 aa  CAID_SALSV RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     2e-21  26%  261 aa  CAID_SALPB RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     2e-21  26%  261 aa  CAID_SALNS RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     2e-21  26%  261 aa  CAID_SALHS RecName: Full=Carnitinyl-CoA dehydratase;       
    1::259     2e-21  26%  261 aa  CAID_SALDC RecName: Full=Carnitinyl-CoA dehydratase;       
   26::266     2e-21  31%  273 aa  MENB_STAAN RecName: Full=Naphthoate synthase;       
   26::266     2e-21  31%  273 aa  MENB_STAAM RecName: Full=Naphthoate synthase;       
   26::266     3e-21  31%  273 aa  MENB_STAAW RecName: Full=Naphthoate synthase;       
   26::266     3e-21  31%  273 aa  MENB_STAAS RecName: Full=Naphthoate synthase;       
   26::266     3e-21  31%  273 aa  MENB_STAAR RecName: Full=Naphthoate synthase;       
   26::266     3e-21  31%  273 aa  MENB_STAAC RecName: Full=Naphthoate synthase;       
   49::293     3e-21  29%  296 aa  ECHD2_MOUSE RecName: Full=Enoyl-CoA hydratase domain-containing
   12::259     3e-21  26%  261 aa  CAID_PROSL RecName: Full=Carnitinyl-CoA dehydratase;       
   12::259     3e-21  26%  261 aa  CAID_PROMH RecName: Full=Carnitinyl-CoA dehydratase;       
   32::278     7e-21  29%  285 aa  MENB_HAEIN RecName: Full=Naphthoate synthase;       
  261::463     3e-20  30%  506 aa  CDYL2_HUMAN RecName: Full=Chromodomain Y-like protein 2;       
   18::263     4e-20  32%  268 aa  MENB_CYACA RecName: Full=Naphthoate synthase;       
   57::312     4e-20  27%  314 aa  AUHM_MOUSE RecName: Full=Methylglutaconyl-CoA hydratase,
   49::293     1e-19  29%  296 aa  ECHD2_BOVIN RecName: Full=Enoyl-CoA hydratase domain-containing
   82::337     2e-19  27%  339 aa  AUHM_HUMAN RecName: Full=Methylglutaconyl-CoA hydratase,
   59::301     2e-19  26%  303 aa  AUHM_DICDI RecName: Full=Methylglutaconyl-CoA hydratase,
   68::296     2e-19  30%  328 aa  ECH1_PONAB RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA
  344::585     2e-19  26%  589 aa  CDYL_RAT RecName: Full=Chromodomain Y-like protein;       
  348::550     2e-19  30%  593 aa  CDYL_MOUSE RecName: Full=Chromodomain Y-like protein;       
   68::296     3e-19  30%  328 aa  ECH1_HUMAN RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA
  353::555     4e-19  29%  598 aa  CDYL1_HUMAN RecName: Full=Chromodomain Y-like protein;       
   45::289     5e-19  28%  292 aa  ECHD2_HUMAN RecName: Full=Enoyl-CoA hydratase domain-containing
  297::497     5e-19  27%  540 aa  CDY1_HUMAN RecName: Full=Testis-specific chromodomain protein Y 1; 
   48::207     8e-19  32%  716 aa  FADB_SHESH RecName: Full=Fatty acid oxidation complex subunit
  146::349     1e-18  27%  391 aa  PECI_MOUSE RecName: Full=Peroxisomal 3,2-trans-enoyl-CoA isomerase;
   37::290     4e-18  23%  299 aa  CRTL_DICDI RecName: Full=3-hydroxybutyryl-CoA dehydratase-like
  298::498     4e-18  26%  541 aa  CDY2_HUMAN RecName: Full=Testis-specific chromodomain protein Y 2; 
   48::207     2e-17  31%  716 aa  FADB_SHEWM RecName: Full=Fatty acid oxidation complex subunit
   48::207     4e-17  29%  717 aa  FADB_SHEHH RecName: Full=Fatty acid oxidation complex subunit
   48::203     6e-17  29%  717 aa  FADB_SHEPA RecName: Full=Fatty acid oxidation complex subunit
  151::349     8e-17  26%  391 aa  PECI_RAT RecName: Full=Peroxisomal 3,2-trans-enoyl-CoA isomerase;  
   48::207     1e-16  29%  717 aa  FADB_SHEPW RecName: Full=Fatty acid oxidation complex subunit
   14::256     1e-16  27%  258 aa  FADB_BACSU RecName: Full=Probable enoyl-CoA hydratase;       
    4::154     1e-16  32%  155 aa  CRT_CLODI RecName: Full=3-hydroxybutyryl-CoA dehydratase;       
  148::352     2e-16  27%  394 aa  PECI_HUMAN RecName: Full=Peroxisomal 3,2-trans-enoyl-CoA isomerase;
   51::224     2e-16  28%  763 aa  ECHA_MOUSE RecName: Full=Trifunctional enzyme subunit alpha,
   51::224     3e-16  28%  763 aa  ECHA_RAT RecName: Full=Trifunctional enzyme subunit alpha,
   48::202     4e-16  28%  729 aa  FADB_SERP5 RecName: Full=Fatty acid oxidation complex subunit
   10::193     4e-16  26%  726 aa  ECHP_CAVPO RecName: Full=Peroxisomal bifunctional enzyme;       
   32::252     4e-16  30%  285 aa  ECH12_MYCBO RecName: Full=Probable enoyl-CoA hydratase echA12;     
   32::252     6e-16  30%  285 aa  ECH12_MYCTU RecName: Full=Probable enoyl-CoA hydratase echA12;     
   81::299     1e-15  25%  322 aa  ECHD1_MOUSE RecName: Full=Enoyl-CoA hydratase domain-containing
   14::191     2e-15  29%  726 aa  MFP_ORYSJ RecName: Full=Peroxisomal fatty acid beta-oxidation
   48::207     3e-15  28%  716 aa  FADB_SHEB8 RecName: Full=Fatty acid oxidation complex subunit
   15::254     4e-15  25%  255 aa  YHAR_BACSU RecName: Full=Putative enoyl-CoA hydratase/isomerase
   16::210     4e-15  26%  725 aa  MFPA_CUCSA RecName: Full=Glyoxysomal fatty acid beta-oxidation
   10::171     4e-15  29%  718 aa  ECHP_DANRE RecName: Full=Peroxisomal bifunctional enzyme;       
   48::200     5e-15  27%  729 aa  FADB_ENTS8 RecName: Full=Fatty acid oxidation complex subunit
    6::212     7e-15  28%  255 aa  YKB4_CAEEL RecName: Full=Uncharacterized protein B0272.4;
   51::190     9e-15  28%  719 aa  FADB_PSYWF RecName: Full=Fatty acid oxidation complex subunit
   50::203     9e-15  31%  715 aa  FADB_PSEMY RecName: Full=Fatty acid oxidation complex subunit
   26::208     2e-14  27%  249 aa  PKSI_BACSU RecName: Full=Putative polyketide biosynthesis enoyl-CoA
   48::200     3e-14  27%  729 aa  FADB_YERE8 RecName: Full=Fatty acid oxidation complex subunit
   48::198     4e-14  27%  729 aa  FADB_YERPY RecName: Full=Fatty acid oxidation complex subunit
   48::198     4e-14  27%  729 aa  FADB_YERPS RecName: Full=Fatty acid oxidation complex subunit
   48::198     4e-14  27%  729 aa  FADB_YERPP RecName: Full=Fatty acid oxidation complex subunit
   48::198     4e-14  27%  729 aa  FADB_YERPN RecName: Full=Fatty acid oxidation complex subunit
   48::198     4e-14  27%  729 aa  FADB_YERPG RecName: Full=Fatty acid oxidation complex subunit
   48::198     4e-14  27%  729 aa  FADB_YERPE RecName: Full=Fatty acid oxidation complex subunit
   48::198     4e-14  27%  729 aa  FADB_YERPB RecName: Full=Fatty acid oxidation complex subunit
   48::198     4e-14  27%  729 aa  FADB_YERPA RecName: Full=Fatty acid oxidation complex subunit
   48::198     4e-14  27%  729 aa  FADB_YERP3 RecName: Full=Fatty acid oxidation complex subunit
   67::317     4e-14  24%  327 aa  ECH1_RAT RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase,
   52::207     5e-14  26%  716 aa  FADB_SHELP RecName: Full=Fatty acid oxidation complex subunit
   51::221     6e-14  26%  763 aa  ECHA_HUMAN RecName: Full=Trifunctional enzyme subunit alpha,
   47::199     1e-13  27%  716 aa  FADB_SHEAM RecName: Full=Fatty acid oxidation complex subunit
   48::200     1e-13  27%  729 aa  FADB_ENTCL RecName: Full=Fatty acid oxidation complex subunit
   42::191     1e-13  27%  723 aa  ECHP_PONAB RecName: Full=Peroxisomal bifunctional enzyme;       
    5::188     1e-13  28%  715 aa  FADJ_CITK8 RecName: Full=Fatty acid oxidation complex subunit
   48::171     1e-13  31%  716 aa  FADB_SHEB9 RecName: Full=Fatty acid oxidation complex subunit
   50::203     1e-13  27%  721 aa  FADB_PSE14 RecName: Full=Fatty acid oxidation complex subunit
   12::209     2e-13  27%  708 aa  FADJ_IDILO RecName: Full=Fatty acid oxidation complex subunit
   48::171     2e-13  30%  716 aa  FADB_SHEB5 RecName: Full=Fatty acid oxidation complex subunit
   15::200     3e-13  25%  729 aa  FADB_SHIDS RecName: Full=Fatty acid oxidation complex subunit
   48::200     3e-13  27%  729 aa  FADB_KLEP3 RecName: Full=Fatty acid oxidation complex subunit
   15::200     3e-13  24%  729 aa  FADB_ERWCT RecName: Full=Fatty acid oxidation complex subunit
   65::283     3e-13  22%  306 aa  ECHD1_BOVIN RecName: Full=Enoyl-CoA hydratase domain-containing
   48::200     4e-13  27%  729 aa  FADB_SHIFL RecName: Full=Fatty acid oxidation complex subunit
   48::200     4e-13  27%  729 aa  FADB_SHIF8 RecName: Full=Fatty acid oxidation complex subunit
   48::203     4e-13  25%  720 aa  FADB_PHOPR RecName: Full=Fatty acid oxidation complex subunit
   48::200     4e-13  27%  729 aa  FADB_KLEP7 RecName: Full=Fatty acid oxidation complex subunit
   15::200     4e-13  25%  729 aa  FADB_ECOUT RecName: Full=Fatty acid oxidation complex subunit
   48::200     4e-13  27%  729 aa  FADB_ECOSM RecName: Full=Fatty acid oxidation complex subunit
   48::200     4e-13  27%  729 aa  FADB_ECOHS RecName: Full=Fatty acid oxidation complex subunit
   48::200     4e-13  27%  729 aa  FADB_ECO5E RecName: Full=Fatty acid oxidation complex subunit
   48::200     4e-13  27%  729 aa  FADB_ECO57 RecName: Full=Fatty acid oxidation complex subunit
   15::200     4e-13  25%  729 aa  FADB_ECO45 RecName: Full=Fatty acid oxidation complex subunit
   48::171     5e-13  29%  716 aa  FADB_SHEB2 RecName: Full=Fatty acid oxidation complex subunit
   48::200     5e-13  27%  729 aa  FADB_ECOLU RecName: Full=Fatty acid oxidation complex subunit
   48::200     5e-13  27%  729 aa  FADB_ECOL6 RecName: Full=Fatty acid oxidation complex subunit
   48::200     5e-13  27%  729 aa  FADB_ECOL5 RecName: Full=Fatty acid oxidation complex subunit
   48::200     5e-13  27%  729 aa  FADB_ECO81 RecName: Full=Fatty acid oxidation complex subunit
   48::200     5e-13  27%  729 aa  FADB_ECO7I RecName: Full=Fatty acid oxidation complex subunit
   48::200     5e-13  27%  729 aa  FADB_ECO27 RecName: Full=Fatty acid oxidation complex subunit
   48::200     5e-13  25%  729 aa  FADB_CITK8 RecName: Full=Fatty acid oxidation complex subunit
   42::191     5e-13  26%  723 aa  ECHP_HUMAN RecName: Full=Peroxisomal bifunctional enzyme;       
   49::276     5e-13  24%  299 aa  ECHD1_RAT RecName: Full=Enoyl-CoA hydratase domain-containing
   51::221     5e-13  25%  763 aa  ECHA_PIG RecName: Full=Trifunctional enzyme subunit alpha,
    5::211     7e-13  26%  715 aa  FADJ_SALTI RecName: Full=Fatty acid oxidation complex subunit
   48::175     7e-13  30%  716 aa  FADB_SHESA RecName: Full=Fatty acid oxidation complex subunit
   48::200     7e-13  26%  729 aa  FADB_SALTY RecName: Full=Fatty acid oxidation complex subunit
   48::200     7e-13  26%  729 aa  FADB_SALTI RecName: Full=Fatty acid oxidation complex subunit
   48::200     7e-13  26%  725 aa  FADB_SALPK RecName: Full=Fatty acid oxidation complex subunit
   48::200     7e-13  26%  729 aa  FADB_SALPB RecName: Full=Fatty acid oxidation complex subunit
   48::200     7e-13  26%  725 aa  FADB_SALPA RecName: Full=Fatty acid oxidation complex subunit
   48::200     7e-13  26%  729 aa  FADB_SALG2 RecName: Full=Fatty acid oxidation complex subunit
   48::200     7e-13  26%  729 aa  FADB_SALEP RecName: Full=Fatty acid oxidation complex subunit
   48::200     7e-13  26%  729 aa  FADB_SALCH RecName: Full=Fatty acid oxidation complex subunit
   48::200     7e-13  26%  729 aa  FADB_SALA4 RecName: Full=Fatty acid oxidation complex subunit
   48::187     7e-13  29%  729 aa  FADB_ECO24 RecName: Full=Fatty acid oxidation complex subunit
   48::175     9e-13  29%  716 aa  FADB_SHESR RecName: Full=Fatty acid oxidation complex subunit
   48::175     9e-13  29%  716 aa  FADB_SHESM RecName: Full=Fatty acid oxidation complex subunit
   48::200     9e-13  25%  729 aa  FADB_SALSV RecName: Full=Fatty acid oxidation complex subunit
   51::186     9e-13  26%  719 aa  FADB_PSYCK RecName: Full=Fatty acid oxidation complex subunit
   15::202     9e-13  23%  728 aa  FADB_PHOLL RecName: Full=Fatty acid oxidation complex subunit
    5::211     1e-12  26%  715 aa  FADJ_SALSV RecName: Full=Fatty acid oxidation complex subunit
   48::187     1e-12  29%  729 aa  FADB_SHISS RecName: Full=Fatty acid oxidation complex subunit
   48::187     1e-12  29%  729 aa  FADB_SHIB3 RecName: Full=Fatty acid oxidation complex subunit
   48::200     1e-12  26%  729 aa  FADB_SALNS RecName: Full=Fatty acid oxidation complex subunit
   51::186     1e-12  26%  719 aa  FADB_PSYA2 RecName: Full=Fatty acid oxidation complex subunit
   48::187     1e-12  29%  729 aa  FADB_ESCF3 RecName: Full=Fatty acid oxidation complex subunit
   48::187     1e-12  29%  729 aa  FADB_ECOLI RecName: Full=Fatty acid oxidation complex subunit
   48::187     1e-12  29%  729 aa  FADB_ECOLC RecName: Full=Fatty acid oxidation complex subunit
   48::187     1e-12  29%  729 aa  FADB_ECODH RecName: Full=Fatty acid oxidation complex subunit
   48::187     1e-12  29%  729 aa  FADB_ECOBW RecName: Full=Fatty acid oxidation complex subunit
   48::187     1e-12  29%  729 aa  FADB_ECO8A RecName: Full=Fatty acid oxidation complex subunit
   48::187     1e-12  29%  729 aa  FADB_ECO55 RecName: Full=Fatty acid oxidation complex subunit
    5::211     1e-12  26%  715 aa  FADJ_SALTY RecName: Full=Fatty acid oxidation complex subunit
    5::211     1e-12  26%  715 aa  FADJ_SALPB RecName: Full=Fatty acid oxidation complex subunit
    5::211     1e-12  26%  715 aa  FADJ_SALNS RecName: Full=Fatty acid oxidation complex subunit
    5::211     1e-12  26%  715 aa  FADJ_SALHS RecName: Full=Fatty acid oxidation complex subunit
    5::211     1e-12  26%  715 aa  FADJ_SALG2 RecName: Full=Fatty acid oxidation complex subunit
    5::211     1e-12  26%  715 aa  FADJ_SALEP RecName: Full=Fatty acid oxidation complex subunit
    5::211     1e-12  26%  715 aa  FADJ_SALDC RecName: Full=Fatty acid oxidation complex subunit
    5::211     1e-12  26%  715 aa  FADJ_SALCH RecName: Full=Fatty acid oxidation complex subunit
    5::211     1e-12  26%  715 aa  FADJ_SALA4 RecName: Full=Fatty acid oxidation complex subunit
   52::207     1e-12  24%  723 aa  FADB_VIBSL RecName: Full=Fatty acid oxidation complex subunit
   48::234     1e-12  26%  716 aa  FADB_SHEFN RecName: Full=Fatty acid oxidation complex subunit
   50::203     1e-12  28%  715 aa  FADB_PSEU5 RecName: Full=Fatty acid oxidation complex subunit
   48::187     1e-12  26%  729 aa  FADB_ENT38 RecName: Full=Fatty acid oxidation complex subunit
   48::189     1e-12  25%  726 aa  FADB_ALISL RecName: Full=Fatty acid oxidation complex subunit
    5::211     3e-12  26%  715 aa  FADJ_SALPK RecName: Full=Fatty acid oxidation complex subunit
    5::211     3e-12  26%  715 aa  FADJ_SALPA RecName: Full=Fatty acid oxidation complex subunit
   48::170     3e-12  28%  716 aa  FADB_SHESW RecName: Full=Fatty acid oxidation complex subunit
   48::170     3e-12  28%  716 aa  FADB_SHEPC RecName: Full=Fatty acid oxidation complex subunit
   57::203     3e-12  28%  721 aa  FADB_PSESM RecName: Full=Fatty acid oxidation complex subunit
   52::198     3e-12  25%  725 aa  FADB_VIBF1 RecName: Full=Fatty acid oxidation complex subunit
   48::187     3e-12  28%  729 aa  FADB_ECOSE RecName: Full=Fatty acid oxidation complex subunit
   10::187     3e-12  22%  722 aa  ECHP_RAT RecName: Full=Peroxisomal bifunctional enzyme;       
   16::215     4e-12  24%  725 aa  MFPA_BRANA RecName: Full=Glyoxysomal fatty acid beta-oxidation
   52::198     4e-12  24%  725 aa  FADB_VIBFM RecName: Full=Fatty acid oxidation complex subunit
    6::245     4e-12  25%  247 aa  ECHA6_MYCLE RecName: Full=Probable enoyl-CoA hydratase echA6;      
   48::170     6e-12  28%  716 aa  FADB_SHEON RecName: Full=Fatty acid oxidation complex subunit
   48::206     6e-12  23%  715 aa  FADB_AERHH RecName: Full=Fatty acid oxidation complex subunit
   52::246     7e-12  23%  715 aa  FADB_AERS4 RecName: Full=Fatty acid oxidation complex subunit
   32::183     1e-11  32%  382 aa  HIBCH_DANRE RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
   60::278     1e-11  23%  301 aa  ECHD1_PONAB RecName: Full=Enoyl-CoA hydratase domain-containing
   66::284     1e-11  23%  307 aa  ECHD1_HUMAN RecName: Full=Enoyl-CoA hydratase domain-containing
   67::317     1e-11  24%  327 aa  ECH1_MOUSE RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA
   47::198     2e-11  30%  385 aa  HIBCH_XENTR RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
   57::203     2e-11  29%  721 aa  FADB_PSEU2 RecName: Full=Fatty acid oxidation complex subunit
   50::159     2e-11  26%  717 aa  FADB_ACIBY RecName: Full=Fatty acid oxidation complex subunit
   50::159     2e-11  26%  717 aa  FADB_ACIBC RecName: Full=Fatty acid oxidation complex subunit
   50::159     2e-11  26%  717 aa  FADB_ACIB5 RecName: Full=Fatty acid oxidation complex subunit
   50::159     2e-11  26%  717 aa  FADB_ACIB3 RecName: Full=Fatty acid oxidation complex subunit
   50::189     2e-11  31%  718 aa  FADB_IDILO RecName: Full=Fatty acid oxidation complex subunit
   50::159     2e-11  26%  717 aa  FADB_ACIBS RecName: Full=Fatty acid oxidation complex subunit
   36::187     3e-11  30%  386 aa  HIBCH_BOVIN RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
   52::198     3e-11  21%  723 aa  FADB_VIBCM RecName: Full=Fatty acid oxidation complex subunit
   52::198     3e-11  21%  723 aa  FADB_VIBCH RecName: Full=Fatty acid oxidation complex subunit
   52::198     3e-11  21%  723 aa  FADB_VIBC3 RecName: Full=Fatty acid oxidation complex subunit
   52::207     4e-11  23%  723 aa  FADB_VIBVY RecName: Full=Fatty acid oxidation complex subunit
   52::207     4e-11  23%  723 aa  FADB_VIBVU RecName: Full=Fatty acid oxidation complex subunit
   53::190     4e-11  28%  722 aa  FADB_COLP3 RecName: Full=Fatty acid oxidation complex subunit
   10::186     4e-11  21%  718 aa  ECHP_MOUSE RecName: Full=Peroxisomal bifunctional enzyme;       
    5::203     6e-11  28%  714 aa  FADJ_ECOSM RecName: Full=Fatty acid oxidation complex subunit
    5::203     8e-11  28%  714 aa  FADJ_ECO7I RecName: Full=Fatty acid oxidation complex subunit
    5::228     1e-10  26%  715 aa  FADJ_ENT38 RecName: Full=Fatty acid oxidation complex subunit
   53::159     2e-10  26%  717 aa  FADB_ACIAD RecName: Full=Fatty acid oxidation complex subunit
    5::203     3e-10  27%  714 aa  FADJ_ECOUT RecName: Full=Fatty acid oxidation complex subunit
    5::203     3e-10  27%  714 aa  FADJ_ECOL5 RecName: Full=Fatty acid oxidation complex subunit
    5::203     3e-10  27%  714 aa  FADJ_ECOK1 RecName: Full=Fatty acid oxidation complex subunit
    5::209     3e-10  26%  714 aa  FADJ_ECO8A RecName: Full=Fatty acid oxidation complex subunit
    5::203     3e-10  27%  714 aa  FADJ_ECO81 RecName: Full=Fatty acid oxidation complex subunit
    5::209     3e-10  25%  714 aa  FADJ_ECO5E RecName: Full=Fatty acid oxidation complex subunit
    5::209     3e-10  25%  714 aa  FADJ_ECO57 RecName: Full=Fatty acid oxidation complex subunit
    5::209     3e-10  26%  714 aa  FADJ_ECO55 RecName: Full=Fatty acid oxidation complex subunit
    5::203     3e-10  27%  714 aa  FADJ_ECO45 RecName: Full=Fatty acid oxidation complex subunit
    5::203     3e-10  27%  714 aa  FADJ_ECO27 RecName: Full=Fatty acid oxidation complex subunit
    5::209     4e-10  25%  714 aa  FADJ_SHISS RecName: Full=Fatty acid oxidation complex subunit
    5::209     4e-10  25%  714 aa  FADJ_SHIFL RecName: Full=Fatty acid oxidation complex subunit
    5::203     4e-10  25%  714 aa  FADJ_ECOLU RecName: Full=Fatty acid oxidation complex subunit
    5::209     4e-10  25%  714 aa  FADJ_ECOHS RecName: Full=Fatty acid oxidation complex subunit
   13::255     4e-10  24%  258 aa  DCH_THAAR RecName: Full=Cyclohexa-1,5-dienecarbonyl-CoA hydratase; 
    5::209     5e-10  25%  714 aa  FADJ_SHIB3 RecName: Full=Fatty acid oxidation complex subunit
    9::209     5e-10  25%  714 aa  FADJ_ECOSE RecName: Full=Fatty acid oxidation complex subunit
    9::209     5e-10  25%  714 aa  FADJ_ECO24 RecName: Full=Fatty acid oxidation complex subunit
   10::244     5e-10  22%  723 aa  FADB_VIBPA RecName: Full=Fatty acid oxidation complex subunit
    5::209     9e-10  26%  714 aa  FADJ_ECOLI RecName: Full=Fatty acid oxidation complex subunit
    5::209     9e-10  26%  714 aa  FADJ_ECODH RecName: Full=Fatty acid oxidation complex subunit
    5::209     9e-10  26%  714 aa  FADJ_ECOBW RecName: Full=Fatty acid oxidation complex subunit
   10::243     9e-10  21%  723 aa  FADB_VIBHB RecName: Full=Fatty acid oxidation complex subunit
   50::201     9e-10  26%  715 aa  FADB_PSEPF RecName: Full=Fatty acid oxidation complex subunit
    4::202     1e-09  26%  714 aa  FADJ_KLEP7 RecName: Full=Fatty acid oxidation complex subunit
    5::197     1e-09  26%  714 aa  FADJ_ECOLC RecName: Full=Fatty acid oxidation complex subunit
    5::203     1e-09  26%  714 aa  FADJ_ECOL6 RecName: Full=Fatty acid oxidation complex subunit
   33::279     1e-09  25%  294 aa  ECH12_MYCLE RecName: Full=Probable enoyl-CoA hydratase echA12;     
   35::186     2e-09  24%  385 aa  HIBCH_CHICK RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
    5::203     2e-09  25%  714 aa  FADJ_SHIDS RecName: Full=Fatty acid oxidation complex subunit
    5::209     2e-09  24%  714 aa  FADJ_SHIBS RecName: Full=Fatty acid oxidation complex subunit
   50::201     2e-09  26%  715 aa  FADB_PSEFS RecName: Full=Fatty acid oxidation complex subunit
    5::209     3e-09  24%  714 aa  FADJ_SHIF8 RecName: Full=Fatty acid oxidation complex subunit
   15::181     3e-09  23%  254 aa  ECH17_MYCTU RecName: Full=Probable enoyl-CoA hydratase echA17;     
   15::181     3e-09  23%  254 aa  ECH17_MYCTA RecName: Full=Probable enoyl-CoA hydratase echA17;     
   15::181     3e-09  23%  254 aa  ECH17_MYCBP RecName: Full=Probable enoyl-CoA hydratase echA17;     
   15::181     3e-09  23%  254 aa  ECH17_MYCBO RecName: Full=Probable enoyl-CoA hydratase echA17;     
   50::199     3e-09  26%  715 aa  FADB_PSEPG RecName: Full=Fatty acid oxidation complex subunit
   45::223     4e-09  26%  500 aa  HIBCH_YEAST RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
    5::212     4e-09  23%  714 aa  FADJ_ESCF3 RecName: Full=Fatty acid oxidation complex subunit
   50::203     4e-09  25%  715 aa  FADB_PSEOL RecName: Full=Fatty acid oxidation complex subunit
   50::199     8e-09  26%  715 aa  FADB_PSEP1 RecName: Full=Fatty acid oxidation complex subunit
   50::191     8e-09  27%  715 aa  FADB_PSEF5 RecName: Full=Fatty acid oxidation complex subunit
   17::183     8e-09  24%  256 aa  ECH14_MYCTU RecName: Full=Probable enoyl-CoA hydratase echA14;     
   17::183     8e-09  24%  256 aa  ECH14_MYCBO RecName: Full=Probable enoyl-CoA hydratase echA14;     
   50::191     1e-08  26%  715 aa  FADB_PSEPU RecName: Full=Fatty acid oxidation complex subunit
   50::191     1e-08  26%  715 aa  FADB_PSEE4 RecName: Full=Fatty acid oxidation complex subunit
   22::238     1e-08  24%  381 aa  HIBCH_DICDI RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
   50::191     1e-08  26%  715 aa  FADB_PSEPW RecName: Full=Fatty acid oxidation complex subunit
   50::199     1e-08  26%  715 aa  FADB_PSEPK RecName: Full=Fatty acid oxidation complex subunit
    4::202     3e-08  25%  714 aa  FADJ_KLEP3 RecName: Full=Fatty acid oxidation complex subunit
   16::254     4e-08  21%  257 aa  ECHH_RHOCA RecName: Full=Probable enoyl-CoA hydratase;       
   50::172     6e-08  27%  715 aa  FADB_PSEAE RecName: Full=Fatty acid oxidation complex subunit
   50::172     6e-08  27%  715 aa  FADB_PSEAB RecName: Full=Fatty acid oxidation complex subunit
   50::172     6e-08  27%  715 aa  FADB_PSEA8 RecName: Full=Fatty acid oxidation complex subunit
   58::207     1e-07  23%  429 aa  HIBCH_SCHPO RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
   16::182     2e-07  24%  259 aa  PKSH_BACSU RecName: Full=Probable polyketide biosynthesis enoyl-CoA
   50::172     2e-07  27%  715 aa  FADB_PSEFR RecName: Full=Fatty acid oxidation complex subunit
   34::273     5e-07  27%  385 aa  HIBCH_RAT RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
   11::197     5e-07  22%  280 aa  ECI1_YEAST RecName: Full=3,2-trans-enoyl-CoA isomerase;       
   27::201     7e-07  22%  727 aa  FADJ_PHOLL RecName: Full=Fatty acid oxidation complex subunit
  122::273     2e-06  32%  385 aa  HIBCH_MOUSE RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
  101::268     3e-06  27%  271 aa  DCI1_YEAST RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA
   19::206     5e-06  25%  727 aa  FADJ_PECCP RecName: Full=Fatty acid oxidation complex subunit
   18::187     5e-06  20%  257 aa  ECH17_MYCPA RecName: Full=Probable enoyl-CoA hydratase echA17;     
   18::187     5e-06  20%  257 aa  ECH17_MYCA1 RecName: Full=Probable enoyl-CoA hydratase echA17;     
   23::215     6e-06  22%  731 aa  FADJ_ERWCT RecName: Full=Fatty acid oxidation complex subunit
  533::624     1e-05  31%  789 aa  FADN_BACSU RecName: Full=Probable 3-hydroxyacyl-CoA dehydrogenase; 
  132::186     1e-05  36%  385 aa  HIBCH_XENLA RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
   59::172     2e-05  26%  715 aa  FADB_PSEA7 RecName: Full=Fatty acid oxidation complex subunit
  133::187     3e-05  36%  386 aa  HIBCH_HUMAN RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
   57::187     5e-05  27%  687 aa  FADJ_VIBF1 RecName: Full=Fatty acid oxidation complex subunit
   79::161     5e-05  32%  555 aa  BOXC_AZOEV RecName: Full=Benzoyl-CoA-dihydrodiol lyase;       
   13::190     2e-04  22%  715 aa  FADJ_SERP5 RecName: Full=Fatty acid oxidation complex subunit
  358::457     6e-04  32%  615 aa  SPPA_HAEIN RecName: Full=Protease 4;         EC=3.4.21.-;AltName:
    1::259

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTAQLLSERVDSTLVLTISNPEARNALHPDIYXXXXXXXXXXXRDDSIRAVILTGADGVFCAGGNLNRLL
ECHH_RHIME      ----LLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFDADRAVGAIVLAGSEKAFAAGADIKEMQ
ECHM_CAEEL      --------------LIKLNRPKALNALCAQLMTELADALEVLDTDKSVGAIVITGSERAFAAGADIKEMT
ECHA8_MYCTU     ----ILVERDQRVGIITLNRPQALNALNSQVMNEVTSAATELDDDPDIGAIIITGSAKAFAAGADIKEMX
ECHA8_MYCBO     ----ILVERDQRVGIITLNRPQALNALNSQVMNEVTSAATELDDDPDIGAIIITGSAKAFAAGADIKEMX
ECHA8_MYCLE     --------------IITLNRPQALNALNSQMMNEITNAAKELDIDPDVGAILITGSPKVFAAGADIKEMX
ECHM_HUMAN      --------------LIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQ
CRT_CLOAB       ----VILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAEKSFVAGADISEM-
ECHM_MOUSE      --------------LIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQ
ECHM_DICDI      --------------LVTLNRPKSLNALSDGLISEINSAVKLFQEDKDVGSIIITGSEKAFAAGADIKEM-
ECHM_RAT        --------------LIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQ
ECHM_PONAB      --------------LIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQ
ECHM_BOVIN      --------------LIQLNRPKALNALCNGLIVELNQALQAFEEDPAVGAIVLTGGEKVFAAGADIKEMQ
ECH1_DICDI      -------EKNDSTFVLVLCRPKQYNSMDDDFYNEFISIYDEIQNDSKIRCVILRGEGKGLTAGLNLGKLI
PAAG_ECOLI      ----ILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQDLNRNV
ECHD3_XENLA     ---------------IILNNPQQRNALSLPMIQSLQKDILHEADDPNLRVIIISAEGNVFSSGHNLKELT
ECHD3_RAT       ---------------IVLSNPRRRNALSLAMLKSLRSDILHEAESEDLKVIIISAEGPVFSSGHDLKELT
ECHD3_HUMAN     ------ARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKEL-
YNGF_BACSU      ----LFTVKNEHMALITLNRPQAANALSAEMLRNLQMIIQEIEFNSNIRCVILTGTEKAFCAGADLKERI
ECHD3_MOUSE     ---------------IVLSNPRRRNALSLAMLKSLRSDILHEAESEDLKVIIISAEGPVFSSGHDLKELT
CAID_ECO57      MSESLHLTRNGSILEITLDRPKA-NAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAEKFFSAGWDLKAAA
MENB_BACSU      ---EILYETYNGIAKITINRPEVHNAFTPKTVAEMIDAFADARDDQNVGVIVLAGADKAFCSGGD-QKVR
CAID_SHIFL      MSESLHLTRNGSILEITLDRPKA-NAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAEKFFSAGWDLKAAA
CAID_SALAR      MSESLRLTRNGPILEITLDRPKA-NAIDARTSFAMGEAFLSFRDDPHLRVAIITGAEKFFSAGWDLKAAA
CAID_ECOSM      MSESLHLTRNGSILEITLDRPKA-NAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAEKFFSAGWDLKAAA
CAID_ECOLI      MSESLHLTRNGSILEITLDRPKA-NAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAEKFFSAGWDLKAAA
CAID_ECOLC      MSESLHLTRNGSILEITLDRPKA-NAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAEKFFSAGWDLKAAA
MENB_STAS1      -------ELYDGIAKVTINRPEVRNAFTPNTVQEMIDAFTRARDDQRISVIILTGGDKAFCSGGD-QKVR
CAID_ECOL6      MSESLHLTRNGSILEITLDRPKA-NAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAEKFFSAGWDLKAAA
CAID_ECOL5      MSESLHLTRNGSILEITLDRPKA-NAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAEKFFSAGWDLKAAA
PAAF_ECOLI      --------------------------------------------DTSISVCVITGNARFFAAGADLNEM-
MENB_STAHJ      ---------------VTINRPEVRNAFTPKTVAEMIDAFSRARDDQNISVIILTGGDKAFCSGGDQKK--
ECHA6_MYCTU     --------QAEAVLTIELQRPERRNALNSQLVEELTQAIRKAG-DGSARAIVLTGQGTAFCAGADLSG--
ECHA6_MYCBO     --------QAEAVLTIELQRPERRNALNSQLVEELTQAIRKAG-DGSARAIVLTGQGTAFCAGADLSG--
MMCD_ECOLI      -----------------------------------------------IRCIILRAPSGVFSAGHDIHELP
CAID_CITK8      MSESLHFTRHGPILEITLDRPKA-NAIDAKTSFEMGEVFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
MENB_STAES      ---------------VTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLTGGDKAFCSGGDQKK--
MENB_STAEQ      ---------------VTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLTGGDKAFCSGGDQKK--
CAID_SALG2      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
CAID_SALEP      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
MENB_PASMU      ----LYHKSLDGIAKITINRPEVRNAFRPQTVKEMIQAFADARFDEQIGVIVLTGGEKAFCSGGDQKVRG
ECHD3_DANRE     -----LTEQQGGIRRIILNNPRKRNALSLQMLESLRENILTDADNPELHVIIISAVGPVFSSGHDLQELS
CAID_SALTI      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
CAID_SALPK      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
CAID_SALPC      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
CAID_SALPA      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
CAID_SALCH      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
CAID_SALA4      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
MENB_ECOLI      ----------DGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDNIGVIILTGADKAFCSGGDQKVRG
MENB_ECOL6      ----------DGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDNIGVIILTGADKAFCSGGDQKVRG
CAID_SALTY      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
CAID_SALSV      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
CAID_SALPB      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
CAID_SALNS      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
CAID_SALHS      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
CAID_SALDC      MSESLHLTRNGPILEITLDRPKA-NAIDAKTSFAMGEAFLNFRDDPELRVAIITGGEKFFSAGWDLKAAA
MENB_STAAN      ---------------VTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLTGGDLAFCSGGDQKK--
MENB_STAAM      ---------------VTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLTGGDLAFCSGGDQKK--
MENB_STAAW      ---------------VTINRPEVRNAFTPKTVSEMIDAFSRARDDQNVSVIVLTGGDLAFCSGGDQKK--
MENB_STAAS      ---------------VTINRPEVRNAFTPKTVSEMIDAFSRARDDQNVSVIVLTGGDLAFCSGGDQKK--
MENB_STAAR      ---------------VTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLTGGDLAFCSGGDQKK--
MENB_STAAC      ---------------VTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLTGGDLAFCSGGDQKK--
ECHD2_MOUSE     ---------------ILMNRPNARNALGNVFVSELLEALAQLREDQQVRVLLFRSAKGVFCAGADLKE--
CAID_PROSL      -----------SVLEIILDRPKA-NAIDAKTSHEMGEVFMRFRDDPSLRVAIITGAERFFCAGWDLKXXX
CAID_PROMH      -----------SVLEIILDRPKA-NAIDAKTSHEMGEVFMRFRDDPSLRVAIITGAERFFCAGWDLKXXX
MENB_HAEIN      ----------DGIAKITINRPEVRNAFRPQTVKEMMTAFSDARFDENIGVIVLTGGEKAFCSGGDQKVRG
CDYL2_HUMAN     ------------THILLSSQTSDNNALTPEIMKEVRRALCNAATDDS-KLLLLSAVGSVFCSGLDYSYLI
MENB_CYACA      ----------DQISEIIISRPQVLNAFRPRTINEIIAAFYDSREDSSIGVVILSGGSRAFCVGGD-QKIR
AUHM_MOUSE      -----LEEENRGIVVLGINRAYGKNALSKNLLKMLSKAVDALKSDKKVRTIIIRSVPGIFCAGADLKERA
ECHD2_BOVIN     ---------------ILMNRPSARNALGNVFVSQLLEALAQLREDRQVRVLIFSGVKGVFCAGADLKE--
AUHM_HUMAN      -----LEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSVPGIFCAGADLKERA
AUHM_DICDI      --------------VISFNRGHVKNALGKNLMNQFRSHLNELRFCPDTRVVIVRSVDGVFCSGADLKE--
ECH1_PONAB      -------------LHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGVDLMDMA
CDYL_RAT        ------------THILLSTKSSENNSLNPEVMKEVQSALSTAAADDS-KLVLLSAVGSVFCCGLDIRRLT
CDYL_MOUSE      ------------THILLSTKSSENNSLNPEVMKEVQSALSTAAADDS-KLVLLSAVGSVFCCGLDIRRLT
ECH1_HUMAN      -------------LHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMA
CDYL1_HUMAN     ------------THILLSTKSSENNSLNPEVMREVQSALSTAAADDS-KLVLLSAVGSVFCCGLDIRRLT
ECHD2_HUMAN     ---------------ILMNRPSARNALGNVFVSELLETLAQLREDRQVRVLLFSGVKGVFCAGADLKE--
CDY1_HUMAN      -------------IVLSTRSTE-KNALNTEVIKEIVNALNSAAADDS-KLVLFSAAGSVFCCGLDFGYFV
FADB_SHESH      -------------------------------------------QDSHIQALVLTSAKGAFIVGADITEFL
PECI_MOUSE      ----------DGITKITFNRPTKKNAISFQMYRDIILALKNASTDNTVMAVF-TGTGDYYCSGNDLTNFT
CRTL_DICDI      ----LVNGKYTGIQIVKLNKPKQLNALTFEMGVDYKKVVDTLAEDKDLKCVVLTGEGKAFSAGGDLDFLI
CDY2_HUMAN      -------------IVLSTRSTE-KNALNTEVIKEMVNALNSAAADDS-KLVLFSAAGSVFCCGLDFGYFV
FADB_SHEWM      -------------------------------------------QDTNIQGLVLTSGKGAFIVGADITEFL
FADB_SHEHH      -------------------------------------------QDTSIKALMLSSAKDAFIVGADITEFL
FADB_SHEPA      -------------------------------------------QDSSIKALMLSSAKDAFVVGADITEFL
PECI_RAT        ---------------ITFNRPSKKNAITFQMYQDIILALKNASTDDTV-ITVFTGAGDYYSSGNDLTNFT
FADB_SHEPW      -------------------------------------------QNNSIKGLMLTSAKPAFIVGADITEFL
FADB_BACSU      --------------VLTIHNPPA-NALSSRILEELSSCLDQCETDAGVRSIIIHGEGRFFSAGADIKEFT
CRT_CLODI       ----------------------------------------------------------------------
PECI_HUMAN      ----------DGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSI-ITVLTGNGDYYSSGNDLTNFT
ECHA_MOUSE      --------------VIRINSPNSKNTLNKEVQSEFIEVMNEIWANDQIRAVLISSKPGCFVAGADIN-ML
ECHA_RAT        --------------VIRINSPNSKNTLNKEVQSEFVEVMNEIWANDQIRAVLISSKPGCFVAGADINMLA
FADB_SERP5      -------------------------------------------KQTELKGLLLRSTKAAFIVGADITEFL
ECHP_CAVPO      -----------SLALIRLRNPPV-NAISPAVIHGIKEGLQKAMSDYTIKGIVISGANNIFCAGADIHGF-
ECH12_MYCBO     ---------------ITLNRPERMNSMAFDVMVPLKEALAQVSYDNSVRVVVLTGAGRGFSSGAD-HKSA
ECH12_MYCTU     ---------------ITLNRPERMNSMAFDVMVPLKEALAQVSYDNSVRVVVLTGAGRGFSPGAD-HKSA
ECHD1_MOUSE     --------------ILTLNNPNKMNAFSGVMMLQLLERVIELENWTEGKGLIIHGAKNTFCSGSDLNAVK
MFP_ORYSJ       ----------DGVAVVTICNPPV-NALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAGGKFCGGFDINHKT
FADB_SHEB8      -------------------------------------------QDSNIKALVLTSSKDTFIVGADITEFL
YHAR_BACSU      ---------------IILNRPDAHHALNEQMLSELKEAVEMAAASEAL-IVLLRGSGKGFSAGGDI-RMM
MFPA_CUCSA      ----------DGVAIITIINPPV-NSLSFDVLFSLRDSYEQALRRDDVKAIVVTGAKGKFSGGFDITALQ
ECHP_DANRE      -----------SVALITLTNPPV-NALSSAVRHAISKTMERALSDPKVTAVVICGENGRFCGGADIREFA
FADB_ENTS8      -------------------------------------------KQHDLKALLLRSEKAAFIVGADITEFL
YKB4_CAEEL      ----ILTERKNNVLWVTLNRPKKFNALTRQMFLDLCTXXXXXXXXXXXXXXXXTGGKGYYCAGSDFSP--
FADB_PSYWF      ---------------------------------------------DNVKGLIVTSSKGVFIAGADITEFV
FADB_PSEMY      --------------------------------------------DGSIKGVIVTSGKDVFIVGADITEFV
PKSI_BACSU      -----------------------KNAFSQELTDDLIQAFEYIRQNPKYKAVILTGYDNYFASGGTQEGLL
FADB_YERE8      -------------------------------------------KQSELKGLLLRSAKAAFIVGADITEFL
FADB_YERPY      -------------------------------------------KQSELKGLLLRSAKTALIVGADITEFL
FADB_YERPS      -------------------------------------------KQSELKGLLLRSAKTALIVGADITEFL
FADB_YERPP      -------------------------------------------KQSELKGLLLRSAKTALIVGADITEFL
FADB_YERPN      -------------------------------------------KQSELKGLLLRSAKTALIVGADITEFL
FADB_YERPG      -------------------------------------------KQSELKGLLLRSAKTALIVGADITEFL
FADB_YERPE      -------------------------------------------KQSELKGLLLRSAKTALIVGADITEFL
FADB_YERPB      -------------------------------------------KQSELKGLLLRSAKTALIVGADITEFL
FADB_YERPA      -------------------------------------------KQSELKGLLLRSAKTALIVGADITEFL
FADB_YERP3      -------------------------------------------KQSELKGLLLRSAKTALIVGADITEFL
ECH1_RAT        -------------LHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMA
FADB_SHELP      -----------------------------------------------VKGLMLTSGKDAFIVGADITEFL
ECHA_HUMAN      --------------VVRINSPNSKNTLSKELHSEFSEVMNEIWASDQIRAVLISSKPGCFIAGADINMLA
FADB_SHEAM      -------------------------------------------KDSDAKAAVLTSGKDTFIVGADITEFL
FADB_ENTCL      -------------------------------------------KQPELKGMLLRSNKAAFIVGADITEFL
ECHP_PONAB      --------------------------------------------DHTIKAIVICGAEGKFSAGADIHGFS
FADJ_CITK8      -SAFTLNVRLDNVAVVSIDVPEKMNTLKAEFATQVRAILKQIRENKALRGVVFISAKDNFIAGADIN-MI
FADB_SHEB9      -------------------------------------------QDSNIKALVLTSSKDTFIVGADITEFL
FADB_PSE14      --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
FADJ_IDILO      --------RDDGVAVITIDVPESMNTLKDSFAEEVGSLMNRLESDDSVKGVVISGKPGSFIAGADINMID
FADB_SHEB5      -------------------------------------------QDSNIKALVLTSSKDTFIVGADITEFL
FADB_SHIDS      ----------DGIAELVFDAPSSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSNKAAFIVGADITEFL
FADB_KLEP3      -------------------------------------------KQNDLKGLLLRSEKAAFIVGADITEFL
FADB_ERWCT      ----------DGIAELVFSAPGSVNTLDTRTVASLGKALDVLAEQPNLKGLLLRSDKPAFIVGADITEFL
ECHD1_BOVIN     --------------ILTLNNPSKMNAFSGVMMLQLLEKVIELENWTEGKGLIIRGAKNTFSSGSDLNKAL
FADB_SHIFL      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_SHIF8      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_PHOPR      -------------------------------------------QQSDLKGLLITSDKDAFIVGADITEFL
FADB_KLEP7      -------------------------------------------KQSDLKGLLLRSEKAAFIVGADITEFL
FADB_ECOUT      ----------DGIAELVFDTPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECOSM      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECOHS      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECO5E      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECO57      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECO45      ----------DGIAELVFDTPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSNKAAFIVGADITEFL
FADB_SHEB2      -------------------------------------------QDSNIKALVLTSSKDTFIVGADITEFL
FADB_ECOLU      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECOL6      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECOL5      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECO81      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECO7I      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECO27      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_CITK8      -------------------------------------------KQTDLKGLLLRSNKAAFIVGADITEFL
ECHP_HUMAN      --------------------------------------------DHTIKAIVICGAEGKFSAGADIRGFS
ECHD1_RAT       -----LQKKQNGIGILTLNNSNKMNAFSGAMMLQLLERVIELENWTEGKGLIVHGAKNTFCSGSDLNAVK
ECHA_PIG        --------------VIRINSPNSKNTLGQELHSEFIEVMNEVWSSSQIRAVLISSKPGCFIAGADINMLS
FADJ_SALTI      -SAFMLSVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-MI
FADB_SHESA      -------------------------------------------QQSNIQALVLTSGKDTFIVGADITEFL
FADB_SALTY      -------------------------------------------KQHDLKGLLLRSNKAAFIVGADITEFL
FADB_SALTI      -------------------------------------------KQHDLKGLLLRSNKAAFIVGADITEFL
FADB_SALPK      -------------------------------------------KQHDLKGLLLRSNKAAFIVGADITEFL
FADB_SALPB      -------------------------------------------KQHDLKGLLLRSNKAAFIVGADITEFL
FADB_SALPA      -------------------------------------------KQHDLKGLLLRSNKAAFIVGADITEFL
FADB_SALG2      -------------------------------------------KQHDLKGLLLRSNKAAFIVGADITEFL
FADB_SALEP      -------------------------------------------KQHDLKGLLLRSNKAAFIVGADITEFL
FADB_SALCH      -------------------------------------------KQHDLKGLLLRSNKAAFIVGADITEFL
FADB_SALA4      -------------------------------------------KQHDLKGLLLRSNKAAFIVGADITEFL
FADB_ECO24      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_SHESR      -------------------------------------------QQSNIQALVLTSGKDTFIVGADITEFL
FADB_SHESM      -------------------------------------------QQSNIQALVLTSGKDTFIVGADITEFL
FADB_SALSV      -------------------------------------------KQHDLKGLLLRSNKAAFIVGADITEFL
FADB_PSYCK      ---------------------------------------------DDIKGLIVTSSKGVFIAGADITEFV
FADB_PHOLL      ----------DGIAELVFNAPAAINKLDTKTVASLDKAIASLEQQTGLKGVLLRSEKTAFIVGADITEFL
FADJ_SALSV      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-MI
FADB_SHISS      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_SHIB3      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_SALNS      -------------------------------------------KQHDLKGLLLRSNKAAFIVGADITEFL
FADB_PSYA2      ---------------------------------------------DDVKGLIVTSSKGVFIAGADITEFV
FADB_ESCF3      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECOLI      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECOLC      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECODH      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECOBW      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECO8A      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADB_ECO55      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
FADJ_SALTY      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFATQVRAILKQIRENKALQGVVFISAKADFIAGADIN-MI
FADJ_SALPB      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-MI
FADJ_SALNS      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-MI
FADJ_SALHS      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-MI
FADJ_SALG2      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-MI
FADJ_SALEP      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-MI
FADJ_SALDC      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-MI
FADJ_SALCH      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-MI
FADJ_SALA4      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-MI
FADB_VIBSL      -----------------------------------------------LRGLILTSNKDAFIVGADITEFL
FADB_SHEFN      -------------------------------------------QNTNIKALLLTSAKSTFIVGADITEFL
FADB_PSEU5      --------------------------------------------DASVKGVIVTSGKDVFIVGADITEFV
FADB_ENT38      -------------------------------------------KQSDLKGLLLRSEKAAFIVGADITEFL
FADB_ALISL      -------------------------------------------KQKDLQALLLSSGKSAFIVGADITEFL
FADJ_SALPK      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-II
FADJ_SALPA      -SAFMLNVRLDNVAVVAIDVPEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADFIAGADIN-II
FADB_SHESW      -------------------------------------------QNSNIKALVLTSSKDTFIVGADITEFL
FADB_SHEPC      -------------------------------------------QNSNIKALVLTSSKDTFIVGADITEFL
FADB_PSESM      ---------------------------------------------------IVTSGKDVFIVGADITEFV
FADB_VIBF1      -----------------------------------------------LQGLLLSSDKSAFIVGADITEFL
FADB_ECOSE      -------------------------------------------QQSDLKGLLLRSNKAAFIVGADITEFL
ECHP_RAT        -----------SLAMIRLCNPPV-NAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIH---
MFPA_BRANA      ----------DGVAVITLINPPVNSLSFDVLYSLKSNYEEALSRND-VKAIVVTGAKGKFSGGFDISEIQ
FADB_VIBFM      -----------------------------------------------LQGLLLSSDKSAFIVGADITEFL
ECHA6_MYCLE     --------QAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSTRVIVLTGQGTVFCAGADLSG--
FADB_SHEON      -------------------------------------------QQSNIQALVLTSGKDTFIVGADITEFL
FADB_AERHH      -------------------------------------------QERELKGLILTSGKDAFIVGADITEFL
FADB_AERS4      -----------------------------------------------LKGLILTSGKDAFIVGADITEFL
HIBCH_DANRE     --SEVLFEKVGKAGVITLNRPKALNALTLNMIRHIYPQLKKWDKDSETDIVIIKGAEKAFCAGGDIRAIA
ECHD1_PONAB     --------------ILTLNNPSKMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVK
ECHD1_HUMAN     --------------ILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVK
ECH1_MOUSE      -------------LHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMA
HIBCH_XENTR     --------------VITLNRPKALNALNLGMIRLIYPQLGLWEEDPETYLVIIKGVGGAFCAGGDIRAVT
FADB_PSEU2      ---------------------------------------------------IVTSGKDSFIVGADITEFV
FADB_ACIBY      --------------------------------------------NNDIKGLVVTSGKSTFIVGADITEFG
FADB_ACIBC      --------------------------------------------NNDIKGLVVTSGKSTFIVGADITEFG
FADB_ACIB5      --------------------------------------------NNDIKGLVVTSGKSTFIVGADITEFG
FADB_ACIB3      --------------------------------------------NNDIKGLVVTSGKSTFIVGADITEFG
FADB_IDILO      ---------------------------------------------DDLRGVIVTSSKSTFIVGADITEFL
FADB_ACIBS      --------------------------------------------NNDIKGLVVTSGKSTFIVGADITEFG
HIBCH_BOVIN     --AEVLLERKGCAGVITLNRPRFLNTLTLGMIRQIYAQLKKWEQDPKTFLIIIKGAEKAFCAGGDIRALS
FADB_VIBCM      -----------------------------------------------VKGLLLSSDKEAFIVGADITEFL
FADB_VIBCH      -----------------------------------------------VKGLLLSSDKEAFIVGADITEFL
FADB_VIBC3      -----------------------------------------------VKGLLLSSDKEAFIVGADITEFL
FADB_VIBVY      -----------------------------------------------LKGVMLTSDKEAFIVGADITEFL
FADB_VIBVU      -----------------------------------------------LKGVMLTSDKEAFIVGADITEFL
FADB_COLP3      ------------------------------------------------KGVIVTSGKSTFIVGADITEFL
ECHP_MOUSE      -----------SLAMIRLCNPPV-NAISPTVITEVRNGLQKASLDHTVRAIVICGANDNFCAGADIHGF-
FADJ_ECOSM      -SAFTLNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECO7I      -SAFTLNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFISAKDNFIAGADIN-MI
FADJ_ENT38      -SAFTLNVRLDNIAVVTIDVPEKMNTLKAEFGVQVRSILKQVRDNKNIRGLIFISAKSDFIAGADINMIA
FADB_ACIAD      -----------------------------------------------VKGLIVTSAKSTFIVGADITEFG
FADJ_ECOUT      -SAFTLNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQIRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECOL5      -SAFTLNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECOK1      -SAFTLNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQIRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECO8A      -SAFTLNVRLDNIAVITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECO81      -SAFTLNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECO5E      -SAFTLNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECO57      -SAFTLNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECO55      -SAFTLNVRLDNIAVITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECO45      -SAFTLNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQIRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECO27      -SAFTLNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQIRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_SHISS      -SAFTLNVRLDNIAIITIDVPDEKNTLKAEFASQVRAIIKQLRENKELRGVVFISAKDNFIAGADIN-MI
FADJ_SHIFL      -SAFTLNVRLDNIAIITIDVPDEKNTLKAEFASQVRAIIKQLRENKELRGVVFISAKDNFIAGADIN-MI
FADJ_ECOLU      -SAFTLNVRLDNIAVITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECOHS      -SAFTLNVRLDNIAIITIDVPDEKNTLKAEFASQVRAIIKQLRENKELRGVVFISAKDNFIAGADIN-MI
DCH_THAAR       -------ERDGSLLRLRLARPKA-NIVDAAMIAAMRQALGEHLQAPALRAVLLDAEGPHFSFGASVDEHM
FADJ_SHIB3      -SAFTLNVRLDNIAIITIDVPDEKNTLKAEFASQVRAIIKQLRENKELRGVVFISAKDNFIAGADIN-MI
FADJ_ECOSE      -----LNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECO24      -----LNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADB_VIBPA      -----VKEIQDGIAELSFCSPKSVNKLDLATLESLDKALDALTSHQGLKGLMLTSDKDAFIVGADITEFL
FADJ_ECOLI      -SAFTLNVRLDNIAVITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECODH      -SAFTLNVRLDNIAVITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_ECOBW      -SAFTLNVRLDNIAVITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADB_VIBHB      -----VKEVQDGIAELSFCSPKSVNKLDLATLESLDKALDALKAHQGLKGLMLTSDKDAFIVGADITEFL
FADB_PSEPF      --------------------------------------------DASIKGVIVSSGKDVFIVGADITEFV
FADJ_KLEP7      VSAFKLEVRADKIAVITIDAPEKMNTLKAEFGSQVRGLIRQLRDDKSVRGVVFISAKADFIAGADINMIA
FADJ_ECOLC      -SAFTLNVRLDNIAIITIDVPDEKNTLKAEFASQVRAIIKQLRENKELRGVVFISAKDNFIAGADIN-MI
FADJ_ECOL6      -SAFTLNVRLDNIAVITIDVPEKMNTLKAEFASQVRAIIKQLRENKDLRGVVFISAKDNFIAGADINMIA
ECH12_MYCLE     --------------LITLNRPGRMNSMALDLMKSLKQVLKRITYDHSVRVVVLTGAGRGFCSGADVPQVE
HIBCH_CHICK     --ADVLLQKQGGAGIITLNRPKVLNALSFKMIQQIYPQIKAWEQDPETFLIIIKGTEKAFCAGGDVRAIA
FADJ_SHIDS      -SAFTLNVRLDNIAIITIDVPEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKDNFIAGADIN-MI
FADJ_SHIBS      -SAFTLNVRLDNIAIITIDVPDEKNTLKAEFASQVRAIIKQLRENKELRGVVFISAKDNFIAGADIN-MI
FADB_PSEFS      --------------------------------------------DASIKGVIVSSGKDVFIVGADITEFV
FADJ_SHIF8      -SAFTLNVRLDNIAIITIDVPDEKNTLKAEFASQVRAIIKQLRENKELRGVVFISAKDNFIAGADIN-MI
ECH17_MYCTU     ----------DAGLAMLLLSRPPTNAMTRQVYREVVAAANELGRRDDVAAVILYGGHEIFSAGDDMPELR
ECH17_MYCTA     ----------DAGLAMLLLSRPPTNAMTRQVYREVVAAANELGRRDDVAAVILYGGHEIFSAGDDMPELR
ECH17_MYCBP     ----------DAGLAMLLLSRPPTNAMTRQVYREVVAAANELGRRDDVAAVILYGGHEIFSAGDDMPELR
ECH17_MYCBO     ----------DAGLAMLLLSRPPTNAMTRQVYREVVAAANELGRRDDVAAVILYGGHEIFSAGDDMPELR
FADB_PSEPG      --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
HIBCH_YEAST     ----------DTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPFCAGGDVATVA
FADJ_ESCF3      -SAFTLNVRLDHIAVVTIDVPEKMNTLKAEFAAQVRAILKEIRENKEIRGVVFISAKADFIAGADINMID
FADB_PSEOL      --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
FADB_PSEP1      --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
FADB_PSEF5      --------------------------------------------DASIKGVIVSSGKDVFIVGADITEFV
ECH14_MYCTU     --------------LITVNDPDRRNAVTDEMSAQLRAAIQRAEGDPDVHAVVVTGAGKAFCAGADLSALV
ECH14_MYCBO     --------------LITVNDPDRRNAVTDEMSAQLRAAIQRAEGDPDVHAVVVTGAGKAFCAGADLSALV
FADB_PSEPU      --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
FADB_PSEE4      --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
HIBCH_DICDI     -TEEVLFEKKGKCLKVLLNRPKALNALNPNVKILTPKYLEMKTKKDGEGVIVMKGAEKAFCAGGDIRAIL
FADB_PSEPW      --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
FADB_PSEPK      --------------------------------------------DASVKGVIVRSGKDVFIVGADITEFV
FADJ_KLEP3      VSAFKLEVRADKIAVITIDAPEKMNTLKAEFGNQVRGLIRQVRDDKSVRGVVFISAKDNFIAGADINMIA
ECHH_RHOCA      --------------VITLDRPEVMNALNAAMRHELTAALHRARGE--ARAIVLTGSGRAFCSGQDLGDGA
FADB_PSEAE      --------------------------------------------DASVKGVIVTSGKDVFIVGADITEFV
FADB_PSEAB      --------------------------------------------DASVKGVIVTSGKDVFIVGADITEFV
FADB_PSEA8      --------------------------------------------DASVKGVIVTSGKDVFIVGADITEFV
HIBCH_SCHPO     ----VLYESKNGARIFTLNRPKVLNAINVDMIDSILPKLVSLEESNLAKVIILKGNGRSFSSGGDI----
PKSH_BACSU      -----------SVCYITFHRPEANNTIN-DTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIY
FADB_PSEFR      --------------------------------------------DASVKGVIVSSGKDVFIVGADITEFV
HIBCH_RAT       -TAEVLLERRGCAGVITLNRPKLLNALSLNMIRQIYPQLKKWERDDTFLXXXXXXXXXXXXXXXDIKALS
ECI1_YEAST      -----ISYRIEGPFIIHLMNPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIA
FADJ_PHOLL      --------RPDKIGIITINVPEKVNTLKAEFVDQFLNVFKQAQQSSGLKGLILSGKPDTFIAGADISMIA
HIBCH_MOUSE     ----------------------------------------------------------------------
DCI1_YEAST      ----------------------------------------------------------------------
FADJ_PECCP      -----LTIRPDNIGVIGIDVPEKVNTLKSEFAQQILSVFEQARQHATLRGLILISSKDSFIAGADITMLN
ECH17_MYCPA     ----------DAGLAMLLVSRPPTNALSRQVYREVIAAADELGRRDDVAAVILFGGHEIFSAGDDMPEL-
ECH17_MYCA1     ----------DAGLAMLLVSRPPTNALSRQVYREVIAAADELGRRDDVAAVILFGGHEIFSAGDDMPEL-
FADJ_ERWCT      -----LTIRPDNIGVISIDVPGERNTLKSEFAEQILSVFELARQHATLRGLIFISAKDSFIAGADITML-
FADN_BACSU      -----------------------------------------------------------FCVGANLAMIL
HIBCH_XENLA     ----------------------------------------------------------------------
FADB_PSEA7      -----------------------------------------------------TSGKDVFIVGADITEFV
HIBCH_HUMAN     ----------------------------------------------------------------------
FADJ_VIBF1      --------------------------------------------------VIQSGKPDNFIAGADINMIA
BOXC_AZOEV      -----------------------------------------------VRTVVVTGKPKIFCSGANIYMLL
FADJ_SERP5      -----LTIRPDNIGVITIDVPEKVNTLKAEFVEQVNDVLIRAQQHPALEGVIVSGKPDSFIAGADITMIA
SPPA_HAEIN      --------------------------------------------DNSVKAVIL-----------------


                         .         .         *         .         .         .         .:140
query           GNRSQPPSVQADSIEVLNQWIESFHAFPKPIIAAVEGPAAGAGFSLVLACDFVVAASDAKFVMAYVKVGL
ECHH_RHIME      GL----DFVDGYLADFLGGWEHVANA-RKPMIAAVSGFALGGGCELAMMCDFIIASETAKFGQPEITLGV
ECHM_CAEEL      NNEF----ATTFSGSFLSNWT-AVSDVKKPVIAAVNGFALGGGNELAMMCDIIYAGEKARFGQPEINIGT
ECHA8_MYCTU     XXXXXXXXXXXXXXX----W-GKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGV
ECHA8_MYCBO     XXXXXXXXXXXXXXX----W-GKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGV
ECHA8_MYCLE     XXXXXXXXXXXXXXX----W-GKLAAVRTPMIAAVAGYALGGGCELAMMCDLLIAADTAKFGQPEIKLGV
ECHM_HUMAN      NLSFQ----DCYSSKFLKHW-DHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGT
CRT_CLOAB       ---KEMNTIEGRKFGILNKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNARFGQPEVGLGI
ECHM_MOUSE      NRTFQ----DCYSSKFLSHW-DHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
ECHM_DICDI      ---EKVTLPDAYNNDLLAQW-HDLTKIRKPIIAAVNGYALGGGCELAMMCDIIIAGEKAVFGQPEIKLGT
ECHM_RAT        NRTFQ----DCYSGKFLSHW-DHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
ECHM_PONAB      NLSFQ----DCYSSKFLKHW-DHLTQIKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGT
ECHM_BOVIN      SLTFQ----NCYSGGFLSHW-DQLTRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILIGT
ECH1_DICDI      TGDSEVSQSQLDLFKMIRRWLDKINKCSKPTIALIHGACIGGGVDMITACDIRLCSSDAKFSIRETKLSI
PAAG_ECOLI      DPTGPAPDLGMSVERFYNPLVRRLAKLPKPVICXXXXXXXXXXXXXXXXXDIVIAARSAKFVMAFSKLGL
ECHD3_XENLA     AEYGKDYHMEV--FNTCAKLMTLFQTLPVPVIAEVNGLATAAGCQLVASCDIAVASDKSRFATPGVNVGL
ECHD3_RAT       G--AQGRDYHTEVFQTCSEVMMLIRNHPVPIVAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGL
ECHD3_HUMAN     -TEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGL
YNGF_BACSU      KLKEDQV---LESVSLIQRTAALLDALPQPVIAAINXXXXXXXXXXXXXCDLRIATEAAVLGLPETGLAI
ECHD3_MOUSE     D--AQGRDYHAEVFQTCSEVMMLIRNHPVPILAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGL
CAID_ECO57      EGEAPDPGGFAGLTEIFN--------LDKPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGI
MENB_BACSU      GHGGYVGDDQIPRLNVLDLQ-RLIRVIPKPVVAMVSGYAIGGGHVLHIVCDLTIAADNAIFGQTGPKVGS
CAID_SHIFL      EGEAPDPGGFAGLTEIFN--------LDKPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGI
CAID_SALAR      EGEAPDADFGPGGFAGLTELFD----LNKPVIAAVNXXXXXXXXXXXXXXDFIICADHASFALPEAKLGI
CAID_ECOSM      EGEAPDPGGFAGLTEIFN--------LDKPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGI
CAID_ECOLI      EGEAPDPGGFAGLTEIFN--------LDKPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGI
CAID_ECOLC      EGEAPDPGGFAGLTEIFN--------LDKPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGI
MENB_STAS1      GHGGYVGDDQIPRLNVLDLQ-RLIRVIPKPVVAMVRGYAIGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
CAID_ECOL6      EGEAPDPGGFAGLTEIFN--------LDKPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGI
CAID_ECOL5      EGEAPDPGGFAGLTEIFN--------LDKPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGI
PAAF_ECOLI      --------AEKDLAATLNQLWARLQAFNKPLIAAVNGYXXXXXXXXXXXXDVVVAGENARFGLPEITLGI
MENB_STAHJ      --RGHGGYVGEDQIPRLNDLQRLIRVIPKPVIAMVRGYAIGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
ECHA6_MYCTU     ------DAFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGL
ECHA6_MYCBO     ------DAFAADYPDRLIELHKAMDASPMPVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGL
MMCD_ECOLI      SGGRDPLSYD----DPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV
CAID_CITK8      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGI
MENB_STAES      --RGHGGYVGEDDIPRLNDLQRLIRVIPKPVIAMVRGYAIGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
MENB_STAEQ      --RGHGGYVGEDDIPRLNDLQRLIRVIPKPVIAMVRGYAIGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
CAID_SALG2      EGEAPDADFGSGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
CAID_SALEP      EGEAPDADFGSGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
MENB_PASMU      DYGGYQDESGVHHLNVLD-FQRDIRTCPKPVVAMVAGYAIGGGHVLHMICDLTIAADNAIFGQTGPKVGS
ECHD3_DANRE     SAESDLPRRVFHSCSELMMLIQDL---PVPVIAMVNGVATAAGCQLVASCDVAVASEKSTFATPGVNVGL
CAID_SALTI      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
CAID_SALPK      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
CAID_SALPC      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
CAID_SALPA      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
CAID_SALCH      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
CAID_SALA4      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
MENB_ECOLI      DYGGYKDDSGVHHLNVLD-FQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGS
MENB_ECOL6      DYGGYKDDSGVHHLNVLD-FQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGS
CAID_SALTY      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
CAID_SALSV      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
CAID_SALPB      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
CAID_SALNS      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
CAID_SALHS      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
CAID_SALDC      EGEAPDADFGPGGFAGLTEIFD----LDKPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGI
MENB_STAAN      --RGHGGYVGEDQIPRLNDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
MENB_STAAM      --RGHGGYVGEDQIPRLNDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
MENB_STAAW      --RGHGGYVGEDQIPRLNDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
MENB_STAAS      --RGHGGYVGEDQIPRLNDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
MENB_STAAR      --RGHGGYVGEDQIPRLNDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
MENB_STAAC      --RGHGGYVGEDQIPRLNDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGS
ECHD2_MOUSE     --REQMSDVEVGTVQRLRGLMSEIAAFPVPTIAAMDXXXXXXXXXXXXXCDLRIAASSAVMGLIETTRGL
CAID_PROSL      XXXXXXXXXXXXXXXXLTELFD----LNKPVIAAINXXXXXXXXXXXXXXDMIICSDNASFALPEAQLGI
CAID_PROMH      XXXXXXXXXXXXXXXXLTELFD----LNKPVIAAINXXXXXXXXXXXXXXDMIICSDNASFALPEAQLGI
MENB_HAEIN      DYGGYKDDSGVHHLNVLD-FQRDIRSCPKPVVAMVAGYAIGGGHVLHMLCDLTIAAENAIFGQTGPKVGS
CDYL2_HUMAN     GRLSSDRRKESTRIEAIRDFVKAFIQFKKPIVVAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRL
MENB_CYACA      SKTGYIDEKGRSSLNVL-ELQRIIRTFPKPVIAKVSGYAVGGGQILNMMCDLTIASENAVLGQSGPKVGS
AUHM_MOUSE      KMHS---SEVGPFVSKIRSVINDIANLPVPTIXXXXXXXXXXXXXXXXXCDIRVAASSAKMGLVETKLAI
ECHD2_BOVIN     --REQMSEAEVGLVQRLRGLMTEIAAFPAPTIAAMDXXXXXXXXXXXXXCDLRVAASSAVMGLIETTRGL
AUHM_HUMAN      KMSSSEVGPFVSKIRAV---INDIANLPVPTIXXXXXXXXXXXXXXXXXCDIRVAASSAKMGLVETKLAI
AUHM_DICDI      --RALMSQVEASQVHSLRSSFTELETLQMPXXXXXXXXXXXXXXXMVLACDFRVASKSSKMGLPETGLAI
ECH1_PONAB      SDILQPKGDDVARIDIITRYQETFNVIPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGL
CDYL_RAT        DDRKRESTKMAEAIR---NFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQ
CDYL_MOUSE      DDRKRESTKMADAIR---NFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQ
ECH1_HUMAN      SDILQPKGDDVARIDIITRYQETFNVIPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGL
CDYL1_HUMAN     DDRKRESTKMAEAIR---NFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQ
ECHD2_HUMAN     --REQMSEAEVGVVQRLRGLMNDIAAFPAPTIAAMDXXXXXXXXXXXXXCDLRVAASSAVMGLIETTRGL
CDY1_HUMAN      KHRNNRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQ
FADB_SHESH      GLFAQEDSVLLPWIAEANVVFNKLEDLPFPTISAINGFALGGGFETVLATDFRIADTTAKIGLPETKLGL
PECI_MOUSE      SATGGIEEAASNGAVLLRDFVNSFIDFPKPLVAVVNGPAVGISVTLLGLFDAVFASDRATFHTPFSQLGQ
CRTL_DICDI      ERTKDTPENNQRIMERFYRTFLYIRSLPVPXXXXXXXXXXXXXFCLALATDIRVVSNKAPVGLTFTKLGI
CDY2_HUMAN      RHRNDRNTASLEMVDTIKNFVNTFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQ
FADB_SHEWM      GLFAQEESVLLPWIAEANVVFNKIEDLPFPTISAINGFALGGGFETVLATDFRIADTTAKLGLPETKLGL
FADB_SHEHH      GLFAEEDAVLQSWLEQANVVFNKLEDLPFPTLSAINGFALGAGCETILATDFRIADTTARIGLPETKLGI
FADB_SHEPA      GLFAEEDTVLQSWLEQANVVFNKLEDLPFPTISAINGFALGAGCETILATDFRIADTTARIGLPETKLGI
PECI_RAT        SASGGMEEAANKGAIVLREFVNTFIDFPKPLVAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQ
FADB_SHEPW      GLFAEEDAVLLSWLEEANVVFNKLEDLPFPTISAINGFALGAGCETILATDFRVADTTARIGLPETKLGI
FADB_BACSU      SLKNEDSSLLAERGQQLMERIESF---PKPXXXXXXXXXXXXXXXXXXXCHIRIAAEDAKLGLPELNLGI
CRT_CLODI       ----------------------------KVVIAAVNGFALG-GCELAMACDIRIASAKAKFGQPEVTLGI
PECI_HUMAN      D--IPPGGVEENNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQ
ECHA_MOUSE      SSCTTPQEATRISQEG-QRMFEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLGVVLLGI
ECHA_RAT        SCTT--PQEAARISQEGQKMFEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLGVVLLGI
FADB_SERP5      SLFAAPAEKLQEWLNFANAIFNRLEDLPVPTISAINGYALGGGCECILATDFRVASPDARIGLPETKLGI
ECHP_CAVPO      ---SAPLSFGTGS--GLGPIVDEMQRYEKPVVAAIQGMALGGGLELSLGCHYRIAHAEARIGFPEVTLGI
ECH12_MYCBO     GENLTRPTYALRSMELLDDVILMLRRLHQPVIAAVNGPAIXXXXXXXXXXDIRVASSSAYFRAAGINNGL
ECH12_MYCTU     GENLTRPTYALRSMELLDDVILMLRRLHQPVIAAVNGPAIXXXXXXXXXXDIRVASSSAYFRAAGINNGL
ECHD1_MOUSE     A-LSTPESGVALSMFMQNT-LTRFMRLPLISVALVQGWAMGGGAELTTACDFRLMTEESVIRFVHKEMGI
MFP_ORYSJ       GNVSLMPDV---SVELVSNLME---AGKKPSVAAIQXXXXXXXXXXTMGCHARISTPEAQLGLPELTLGI
FADB_SHEB8      GLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGI
YHAR_BACSU      TSEHDPDQFKRDTIEAVTL---NLYQMKKVTIXXXXXXXXXXXXXXXXXXDIVLAEKNAVLAMNFIGIGL
MFPA_CUCSA      GGKGEQPNVRNISIEMIT---DIFEAARKPXXXXXXXXXXXXXXEVAMACHARISTPTAQLGLPELQLGI
ECHP_DANRE      XXXXXXXXXXXDAIE----------AGEKPVVAAIEGVALGGGFELALVCHYRIAHYKARLGLPEVTLGI
FADB_ENTS8      SLFQVPAEQLSQWLHFANSVFNRLEDLPVPTLCAINGYALGGGCECVLATDFRLATPDARIGLPETKLGI
YKB4_CAEEL      AELSTLTDIQEHGYKL---FVDILIAFPKPIIALVNGHAVGVSVTMLGVMDAVIAIDTATFATPFADIGV
FADB_PSYWF      SHFNKEAAEIEKWIVDINGVFNRFEDLPFPKVAAINGAALGGGCEMTLVCEYRVMGDKAQIGLPETQLGI
FADB_PSEMY      DNFKLPDELVAGNLEA-NKIFSDFEDLAVPTVVAINGIALGGGFEMCLAGDYRVMSETAKIGLPEVKLGI
PKSI_BACSU      RIQQGLTKFTDDNLYSLALDCEI------PVIAAMQGHGIGGGFVMGLFADIVILSRESVYTANFMKYGF
FADB_YERE8      SLFNEPPEKLHQWLVFANDIFNRLEDLPVPTIAAINGYALGGGCECILATDFRVASPEARIGLPETKLGI
FADB_YERPY      SLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGI
FADB_YERPS      SLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGI
FADB_YERPP      SLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGI
FADB_YERPN      SLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGI
FADB_YERPG      SLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGI
FADB_YERPE      SLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGI
FADB_YERPB      SLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGI
FADB_YERPA      SLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGI
FADB_YERP3      SLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGI
ECH1_RAT        SDILQPPGDDVARIDLISRYQKTFTVIPKPVXXXXXXXXXXXXVDLISACDIRYCTQDAFFQVKEVDVGL
FADB_SHELP      GLFAQDDNVLQGWLEDANKVFNKLEDLPFPTISAIKGFALGGGCETILATDLRIADTSARIGLPETKLGI
ECHA_HUMAN      ACKTLQEVTQLS--QEAQRIVEKLEKSTKPIVAAINGSCLGGGLEVAISCQYRIATKDRKTVLGEVLLGA
FADB_SHEAM      ALFAEEDAKLMEWIAQANVVFNKLEDLPFPTVSAIKGFALGGGCEAILATDFRVADTSAKIGLPETKLGL
FADB_ENTCL      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCECVLATDYRLATPDLRIGLPETRLGI
ECHP_PONAB      APRTFGFT--------LGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHSEAQVGLPEVTLGL
FADJ_CITK8      GNCKS--AQEAETLARQGQQIMAIQALSVPVVAAIHGACLGGGLEMALACHRRICTDDAKTVLGLVQLGL
FADB_SHEB9      GLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCETILATDFRVADTTAKIGLPETKLGI
FADB_PSE14      DNFKLPEAELVAGNLQANRIFSDFEDLGVPTVVAINGIALGGGLEMCLAADYRVISSSARIGLPEVKLGL
FADJ_IDILO      GCEN---AVDAESLARKGQMFDRIEQLNVPVVAAINGACLGGGLELAMACHVRVCTDNSKTALGLVKLGL
FADB_SHEB5      GLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGI
FADB_SHIDS      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_KLEP3      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ERWCT      SLFAAPAEKLHEWLVFANSIFNRLEDLPVPTLSAINSYALGGGCECVLATDFRLATPDARIGLPETKLGI
ECHD1_BOVIN     GTPEDGMAV----CMFMQNTLTRFMRLPLISVALVQGRALGGGAEVTTACDFRLMTTESEIRFVHKEMGI
FADB_SHIFL      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SHIF8      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_PHOPR      GLFAKPAEELSQWLTRANDIFNKLEDLPVPTLSAINGHALGGGCECVLATDFRLADITARIGLPETRLGI
FADB_KLEP7      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECOUT      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECOSM      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECOHS      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECO5E      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECO57      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECO45      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SHEB2      GLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCETILTTDFRIADTTAKIGLPETKLGI
FADB_ECOLU      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECOL6      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECOL5      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECO81      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECO7I      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECO27      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_CITK8      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLSAINGYALGGGCECVLATDYRLVTPDLRIGLPETKLGI
ECHP_HUMAN      APRTFGLT--------LGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEVTLGL
ECHD1_RAT       A-LSTPENGVALSMFMQNT-LTRFMRLPLISVALVQGWAMGGGAELTTACDFRLMTEESVIRFVHKEMGI
ECHA_PIG        ACTTSQEVTQIS--QEAQRTFEKLEKSTKPIVAAINGTCLGGGLELAISCQYRIATKDKKTVLGEVLLGI
FADJ_SALTI      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADB_SHESA      GLFAQDDAVLLSWIEQANAVFNKLEDLPFPTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGI
FADB_SALTY      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SALTI      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SALPK      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SALPB      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SALPA      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SALG2      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SALEP      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SALCH      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SALA4      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECO24      SLFLVPEEQLSQWLQFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SHESR      GLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGI
FADB_SHESM      GLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCEAILATDFRIADTTAKIGLPETKLGI
FADB_SALSV      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_PSYCK      ASFKQSEEEIKDWVININDAFNRFEDLPFPKVAAINGAALGGGCEMTLVCEYRVMSDKAIIGLPETQLGI
FADB_PHOLL      SLFDSPVEKLQEWLNFSNSIFNRIEDLPVPTISAINGYALGGGCECVLSTDFRVASPDIRIGLPETKLGI
FADJ_SALSV      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADB_SHISS      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SHIB3      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_SALNS      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_PSYA2      ASFKQSEEEIKDWVININDAFNRFEDLPFPKVAAINGAALGGGCEMTLVCEYRVMSDKAIIGLPETQLGI
FADB_ESCF3      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECOLI      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECOLC      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECODH      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECOBW      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECO8A      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ECO55      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADJ_SALTY      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADJ_SALPB      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADJ_SALNS      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADJ_SALHS      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADJ_SALG2      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADJ_SALEP      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADJ_SALDC      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADJ_SALCH      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADJ_SALA4      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADB_VIBSL      GLFAKPEAELDEWLRFANSIFSKLEDLPVPTLSMMRGHALGGGCECVLATDFRIGDKTTSIGLPETKLGI
FADB_SHEFN      TLFQQDDATLLAWVEQANAVFNKLEDLPFPTASAINGFALGGGCETILATDLRVADTNARIGLPETKLGL
FADB_PSEU5      DNFKLPDELVAGNLEA-NKIFSDFEDLGVPTVVAINGIALGGGFEMCMAADYRVMSTTAKVGLPEVKLGI
FADB_ENT38      SLFQVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
FADB_ALISL      GLFDTPEEELSDWLHQANVIFSRLEDLPVPTLSAITGFALGGGCECVLATDFRLADDTASIGLPETQLGI
FADJ_SALPK      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADJ_SALPA      GHCQNAQEAETLARQG-QQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKTVLGLVQLGL
FADB_SHESW      GLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGI
FADB_SHEPC      GLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGI
FADB_PSESM      DNFKLPEALVAGNLEA-NRIFSDFEDLGVPTVVAINGIALGGGLEMCLAADYRVISSSARVGLPEVKLGL
FADB_VIBF1      GLFDIPTEELSDWLHQANAIFNRLEDIPVPTLSAITGFALGGGCECVLATDFRLADETASIGLPETQLGI
FADB_ECOSE      SLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAANGYALGGGCECVLATDYRLATPDLRIGLPETKLGI
ECHP_RAT        GFSAFTPGLALGSL------VDEIQRYQKPVLAAIQGVXXXXXXXXXXXCHYRIANAKARVGLPEVTLGI
MFPA_BRANA      KGTMKEPKVGYISIDILTDLLE---AAKKPSVXXXXXXXXXXXXXXXXXCHARISAPGAQLGLPELQLGV
FADB_VIBFM      GLFDIPTEELSDWLHQANAIFNRLEDIPVPTLSAITGFALGGGCECVLATDFRLADETASIGLPETQLGI
ECHA6_MYCLE     ------DAFAADYPDRLIELHRVMDAVPMPVXXXXXXXXXXXXLQLAMQCDLRVVAPDAYFQFPTSKYGL
FADB_SHEON      GLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGI
FADB_AERHH      ELFDLPQADLLGWLKKANDIFSAIEDLPVPTLSAIKGHALGGGCETILSTDFRLADTSAKIGLPETKLGI
FADB_AERS4      ELFDLPQEDLLGWLKKANDIFSAIEDLPVPTLSAIKGHALGGGCETILSTDFRLADTSAKIGLPETKLGI
HIBCH_DANRE     GNLLSQVFFREEYI--LNNTIGTYQ---KPYVALINGITMGGGVGLSVHGQFRVATEKTLFAMPETGIGL
ECHD1_PONAB     -SLGTPEDGMAVCMFMQNT-LTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGI
ECHD1_HUMAN     -SLGTPEDGMAVCMFMQNT-LTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGI
ECH1_MOUSE      SELMQPSGDDAARIDLISKYQKTFTVIPKPVXXXXXXXXXXXXVDLVSACDIRYCTQDAFFQIKEVDMGL
HIBCH_XENTR     DAGKAGDRLAQDFFRILNNAIGTYK---KPYVALIDGITMGGGVGLSVHGHFRVASENTLFAMPETAIGL
FADB_PSEU2      DNFKLPEALVAGNLEA-NRIFSDFEDLNVPTVVAINGIALGGGLEMCLAADYRVMASSARIGLPEVKLGL
FADB_ACIBY      QNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGI
FADB_ACIBC      QNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGI
FADB_ACIB5      QNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGI
FADB_ACIB3      QNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGI
FADB_IDILO      SDQEKTRSWVAKASRVFDQ----LEDLPVPTVGAVTGFALGGGCEALLACDYRVADTTATIGLPEVKLGL
FADB_ACIBS      QNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGIALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGI
HIBCH_BOVIN     EARNTNQKMLQDLFRILNNAIDSCQ---KPYIALIHGITMGGGVGVSVHGQFRVATEKSVFAMPETAIGL
FADB_VIBCM      GLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCECVLATDFRIGDATTSIGLPETKLGI
FADB_VIBCH      GLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCECVLATDFRIGDATTSIGLPETKLGI
FADB_VIBC3      GLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCECVLATDFRIGDATTSIGLPETKLGI
FADB_VIBVY      GLFAKPEEELDQWLQFANSIFNKLEDLPVPTVAVVKGHTLGGGCECVLATDLRIGDKTTSIGLPETKLGI
FADB_VIBVU      GLFAKPEEELDQWLQFANSIFNKLEDLPVPTVAVVKGHTLGGGCECVLATDLRIGDKTTSIGLPETKLGI
FADB_COLP3      VSFSQPEDALASWAKKASDVFDSFEDIQLPTXXXXXXXXXXXXCEMTLACDYRVAATTASIGLPEVKLGL
ECHP_MOUSE      ---KSPTGLTLGSL------VDEIQRYQKPVVAAIQGVXXXXXXXXXXXCHYRIANAKARVGFPEVMLGI
FADJ_ECOSM      GNCKT-----AQEAEVLQQLMAEIHALPVPVIAAIXXXXXXXXXXXXXXXXXRVCTDDAKTVLGLVQLGL
FADJ_ECO7I      GNCKT-----AQEAEVLQQLMAEIHALPVPVIAAIXXXXXXXXXXXXXXXXXRVCTDDAKTVLGLVQLGL
FADJ_ENT38      RAKS---AQEAEELARQGQQIMAIHGLSIPVIAAIHXXXXXXXXXXXXXXHSRVCTDDAKTVLGLVQLGL
FADB_ACIAD      QNFAQGEKAIVEWALPVHDIFNSFEDLDIPKVAAINGMALGGGFEMCLVCDYRVMSDQAQVGLPEIKLGI
FADJ_ECOUT      GNCKT-----AQEAEVLQQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECOL5      GNCKT-----AQEAEVLQQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECOK1      GNCKT-----AQEAEVLQQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECO8A      GNCKTAQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECO81      GNCKT-----AQEAEVLQQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECO5E      GNCKTAQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECO57      GNCKTAQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECO55      GNCKTAQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECO45      GNCKT-----AQEAEVLQQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECO27      GNCKT-----AQEAEVLQQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_SHISS      GNCKTAQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_SHIFL      GNCKTAQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECOLU      GNCKTAQEAEALARQG-QQLMAEIHALPVPVIAAIXXXXXXXXXXXXXXXXXRMCTDDPKTVLGLVQLGL
FADJ_ECOHS      GNCKTAQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
DCH_THAAR       ------PDQCAQMLKSLHGLVREMLDSPVPILVALRGQCLGGGLEVAAAGNLLFAAPDAKFGQPEIRLGV
FADJ_SHIB3      GNCKTAQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECOSE      GNCKTAQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECO24      GNCKTAQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADB_VIBPA      GLFAKTDAELDQWLQFANSIFNKLEDLPVPTISVLKGHTLGGGCECVLATDMRIGDKTTSIGLPETKLGI
FADJ_ECOLI      GNCKTAQEAEALARQG-QQLMAEIHALPIQVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECODH      GNCKTAQEAEALARQG-QQLMAEIHALPIQVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECOBW      GNCKTAQEAEALARQG-QQLMAEIHALPIQVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADB_VIBHB      GLFAKTDAELDQWLQFANSIFNKLEDLPVPTISVLKGHTLGGGCECVLATDMRIGDKTTSIGLPETKLGI
FADB_PSEPF      DNFKLPDALVAGNLEA-NKIFSDFEDLNVPTVXXXXXXXXXXXXEMCLAADYRVMSTKAKIGLPEVKLGI
FADJ_KLEP7      RCRS---AQEAEALARQGQQIMAIHGLSIPVIAAIXXXXXXXXXXXXXXXXXRICSDDEKTRLGLVQLGL
FADJ_ECOLC      GNCKTAQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADJ_ECOL6      NCKT------AQEAEALQQLMAEIHALPVPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
ECH12_MYCLE     GLTQPVRALRA--MELLEEVILALRRLHQPVXXXXXXXXXXXXXXXXXXXDVRVASTRAYFRAAGINNGL
HIBCH_CHICK     DAGKAGDTMTRDYFREEYRLDNAIGTCKKPYVALIDGITMGGGVGLSVHGHFRVATEKTVFAMPETAIGL
FADJ_SHIDS      GNCKTAQEAEALARQD-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLSLVQLGL
FADJ_SHIBS      GNCKTVQEAEALARQG-QQLMAEIHALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
FADB_PSEFS      DNFKLPDALVAGNLEA-NKIFSDFEDLNVPTVXXXXXXXXXXXXEMCLAADFRVMSATAKIGLPEVKLGI
FADJ_SHIF8      GNCKTAQEAEALARQG-QQLMAEINALPIPVIAAIXXXXXXXXXXXXXXXXXRVCTDDPKTVLGLVQLGL
ECH17_MYCTU     TLSAQEADTAA---RIRQQAVDAVAAIPKPTVXXXXXXXXXXXXXXXXXXDWRVSGDNVKFGATEILAGL
ECH17_MYCTA     TLSAQEADTAA---RIRQQAVDAVAAIPKPTVXXXXXXXXXXXXXXXXXXDWRVSGDNVKFGATEILAGL
ECH17_MYCBP     TLSAQEADTAA---RIRQQAVDAVAAIPKPTVXXXXXXXXXXXXXXXXXXDWRVSGDNVKFGATEILAGL
ECH17_MYCBO     TLSAQEADTAA---RIRQQAVDAVAAIPKPTVXXXXXXXXXXXXXXXXXXDWRVSGDNVKFGATEILAGL
FADB_PSEPG      DNFKLPEALVAGNLEA-NRIFNAFEDLEVPTVXXXXXXXXXXXXEMCLAADYRVMSNSAKIGLPEVKLGI
HIBCH_YEAST     FNKEFAKSIKFFTDEYLNFQIATYL---KPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGF
FADJ_ESCF3      HCNT---AMEAETLARQGQQLMAIHALPVPVIAAIXXXXXXXXXXXXXXXXXRICTDDPKTILGLVQLGL
FADB_PSEOL      DNFKLPEALVAGNLEA-NRIFNAFEDLEVPTVXXXXXXXXXXXXEMCLAADYRVMSTSAKIGLPEVKLGI
FADB_PSEP1      DNFKLPEALVAGNLEA-NRIFNAFEDLEVPTVXXXXXXXXXXXXEMCLAADYRVMSTSARIGLPEVKLGI
FADB_PSEF5      DNFKLPDALVAGNLEA-NKIFSDFEDLNVPTVXXXXXXXXXXXXEMCLAADYRVMAASAKIGLPEVKLGI
ECH14_MYCTU     GDPAEPRLLR------LYDGFMAVSSCNLPTIXXXXXXXXXXXXXXXXXXDVRIAGPAALFDARFQKLGL
ECH14_MYCBO     GDPAEPRLLR------LYDGFMAVSSCNLPTIXXXXXXXXXXXXXXXXXXDVRIAGPAALFDARFQKLGL
FADB_PSEPU      DNFKLPEALVAGNLEA-NRIFSAFEDLEVPTVXXXXXXXXXXXXEMCLAADYRVMSTSAKIGLPEVKLGI
FADB_PSEE4      DNFKLPEALVAGNLEA-NRIFSDFEDLEVPTVXXXXXXXXXXXXEMCLAADYRIMSSSAKIGLPEVKLGI
HIBCH_DICDI     NEEQKSKTNDIGDLFFREEYILNNLIGTNPIVSIYNGFAMGGGIGLSVHGKFRVATENTVFAMPETGIGF
FADB_PSEPW      DNFKLPEALVAGNLEA-NRIFNAFEDLEVPTVXXXXXXXXXXXXEMCLAADYRVMSTSAKIGLPEVKLGI
FADB_PSEPK      DNFKLPEALVAGNLEA-NRIFNAFEDLEVPTVXXXXXXXXXXXXEMCLAADYRVMSTSARIGLPEVKLGI
FADJ_KLEP3      RCRS---AQEAEALARQGQQIMAIHGLSIPVIAAIXXXXXXXXXXXXXXXXXRICSDDEKTRLGLVQLGL
ECHH_RHOCA      AEGLNLETVLREEYEPL---LQAIYSCPLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMQAFTRIGL
FADB_PSEAE      DNFQLPDELMAGNLEA-NKIFSDFEDLDVPTVXXXXXXXXXXXXEMCLAADFRVMSATAKVGLPEVKLGI
FADB_PSEAB      DNFQLPDELMAGNLEA-NKIFSDFEDLDVPTVXXXXXXXXXXXXEMCLAADFRVMSATAKVGLPEVKLGI
FADB_PSEA8      DNFQLPDELMAGNLEA-NKIFSDFEDLDVPTVXXXXXXXXXXXXEMCLAADFRVMSATAKVGLPEVKLGI
HIBCH_SCHPO     --KAAALSIQDGKLEVRHAFAQEYRTYQKPVVALMNGITMGGGSGLAMHVPFRIACEDTMFAMPETGIGY
PKSH_BACSU      QEMKRGRK-QASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGL
FADB_PSEFR      ENFKLPDALIAGNLEA-NKIFSDFEDLNVPTVXXXXXXXXXXXXEMCLAADFRVMADSAKIGLPEVKLGI
HIBCH_RAT       EAKKAGQTLSQDLFRILNNAIASCQ---KPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGL
ECI1_YEAST      --KAQGDDTNKYPSET-SKWVSNFVAHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLPFANLGL
FADJ_PHOLL      GCKTKEDA--RDLAEKGQKLFSQIANYPLPVVAAIHXXXXXXXXXXXXXXHWRVCSQDDKTRLGLVQLGL
HIBCH_MOUSE     ---------------ILNNAIASCQ---KPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGL
DCI1_YEAST      ----------------------AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLPFSNLGF
FADJ_PECCP      QCRS---AEQAENLAKQGQTFEQIAALPFPVVAAIHXXXXXXXXXXXXXXDYRVCSLDEKTVLGLVQLGL
ECH17_MYCPA     --RTLRGAEAETXXXXXXXXXXXXXXXPKPTVXXXXXXXXXXXXXXXXXXDWRISGDNVKFGATEILAGL
ECH17_MYCA1     --RTLRGAEAETXXXXXXXXXXXXXXXPKPTVXXXXXXXXXXXXXXXXXXDWRISGDNVKFGATEILAGL
FADJ_ERWCT      -NKCSSAEQAENLAKQGQETFDQIAALPFPVVAAIHXXXXXXXXXXXXXXDYRVCSLDEKTVLGLVQLGL
FADN_BACSU      MEVQDDNFLEVDFIRRFQETMMKIKYSAKPVVAAPFGMTLGGGTEACLPAARIQAASEAYMGLVESGVGL
HIBCH_XENLA     ----------------------------KPYVAVIDGITMGGGVGLSVHGHFRVASEKTLFAMPETAIGL
FADB_PSEA7      DNFQLPDELMAGNLEA-NKIFSDFEDLDVPTVXXXXXXXXXXXXEMCLAADFRVMSATAKVGLPEVKLGI
HIBCH_HUMAN     ----------------------------KPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGL
FADJ_VIBF1      NNASEAQAL-AEKGQHLFQRIEDL---PFATVAAIHXXXXXXXXXXXXXXDYRVCSDDTKLGLPEVQLGL
BOXC_AZOEV      STHAWKVNFCKFTNETRNGIEDSSQYSGLKFLAACNGTTAGGGYELALACDEIVLVDD------------
FADJ_SERP5      ACTT---AKEAETLAKKGQTLAQIAAFQVPVVAAIXXXXXXXXXXXXXXXXXRVCSLDDKTALGLVQLGL
SPPA_HAEIN      --RVNSPGGSAFASEIIRQETENLQKIGKPVIVSMGAMAASGGYWISSTADYIIADSNTTFENSIKKIGV


                         +         .         .         .         .         *         .:210
query           TPDGGGSYEIARMLPRQLASEIMMEGKPVDPARLAHFGIVNRVAAPGQALTEALRIAENLAKESPNAVSG
ECHH_RHIME      IPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRVVAPDRLLEEALGAAEKIASFSLPAAMM
ECHM_CAEEL      IPGAGGTQRWARAAGKSFAMEVCLTGNHVTAQEAKEHGIVSKIFPADQVVGEAVKLGEKIADQSPLIVQM
ECHA8_MYCTU     LPGMGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARM
ECHA8_MYCBO     LPGMGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARM
ECHA8_MYCLE     LPGMGGSQRLTRAIGKAKAMDLILTGRTIDAAEAERSGLVSRVVLADDLLPEAKAVATTISQMSRSATRM
ECHM_HUMAN      IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAM
CRT_CLOAB       TPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSELMNTAKEIANKIVSNAPVAVKL
ECHM_MOUSE      IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAM
ECHM_DICDI      IPGCGGTQRLIRAIGKSKAMELVLTGNNLTAVEAEKAGLVSKVVPVEELLTEATKMAEKIASYSQLTVAM
ECHM_RAT        IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
ECHM_PONAB      IPGAGGTQRLTRTVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIIAAM
ECHM_BOVIN      IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETVVEEAIQCAEKIASNSKIVTAM
ECH1_DICDI      IADLGTLQRISKIVGSGFARELALTGKDIDAKTAERFNLVNHVYPDHDTLSEGRKLALSIAQNSPLVVQA
PAAG_ECOLI      IPDCGGTWLLPXXXXXXXXXXXXXXXNQLSAEQAHEWGMIWQVVDDETLADTAQQLARHLATQPTFGLGL
ECHD3_XENLA     FCSTPG-VALGRAVPRKVALEMLFTGEPISAHDALLHGLVSKVVPEENLKSETNRIALKICQTSHSVVAL
ECHD3_RAT       TP----AVALGRAVPRKVALEMLFTGEPISAQEALRHGLISKVVPEEQLEEEATRIAKKIASLSRSVVAL
ECHD3_HUMAN     FCSTPG-VALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSL
YNGF_BACSU      IPGAGGTQRLPRLIGRGKAKEFIYTGRRVTAHEAKEIGLVEHVTAPCDLMPKAEELAAAISANGPIAVRQ
ECHD3_MOUSE     TP----AVALGRAVPRKVALEMLFTGEPISAQEALRHGLISKVVPEEQLEAETMRIAKKISSLSRSVVAL
CAID_ECO57      VPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAA
MENB_BACSU      FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEQLEEETIKWCEEMLEKSPTALRF
CAID_SHIFL      VPDSGGVLRLPKILPPTIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAA
CAID_SALAR      VPDSGGVLRLPKILPPAIVNDMVMTGRRMTAEEALRWGVVNRVVSPHELLDSARELARQLVQSAPLAVAA
CAID_ECOSM      VPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGVVNRVVSQAELMDNARELAQQLVNSAPLAIAA
CAID_ECOLI      VPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAA
CAID_ECOLC      VPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAA
MENB_STAS1      FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLDQVEDETVQWCQEMKQHSPTALRF
CAID_ECOL6      VPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGVVNRVVSQAELMDNARELAQQLVNSAPLAIAA
CAID_ECOL5      VPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGVVNRVVSQAELMDNARELAQQLVNSAPLAIAA
PAAF_ECOLI      MPGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPSDLTLEYALQLASKMARHSPXXXXX
MENB_STAHJ      FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLDQIEDETVQWCKEIMKHSPTALRF
ECHA6_MYCTU     ALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIG----TLADAQAWAAEIARLAPLAIQH
ECHA6_MYCBO     ALDNWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRIG----TLADAQAWAAEIARLAPLAIQH
MMCD_ECOLI      PYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
CAID_CITK8      VPDSGGVLRLPKLLPPAIVNEMLMTGRRMDAEEALRWGIVNRVVSQQALMDSARELAQQLVNSAPLAIAA
MENB_STAES      FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEQVEDETVKWCKDIMQHSPTALRF
MENB_STAEQ      FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEQVEDETVKWCKDIMQHSPTALRF
CAID_SALG2      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAA
CAID_SALEP      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAA
MENB_PASMU      FDGGWGASYMARIVGQKKAREIWFLCRQYDAKEALEMGLVNTVVPYAELEKETVRWCREMLRNSPIALRC
ECHD3_DANRE     TP----AVAIGRTVPRKIAMQMLLTGRPLSAQQALQHGLLSAVFSEERLEDETLAIARRVCESSRPVVSL
CAID_SALTI      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMESARELAQQLVNSAPLAIAA
CAID_SALPK      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAA
CAID_SALPC      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAA
CAID_SALPA      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAA
CAID_SALCH      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAA
CAID_SALA4      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAA
MENB_ECOLI      FDGGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRC
MENB_ECOL6      FDGGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRC
CAID_SALTY      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAA
CAID_SALSV      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAA
CAID_SALPB      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAA
CAID_SALNS      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAA
CAID_SALHS      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAA
CAID_SALDC      VPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAA
MENB_STAAN      FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLDKVEDETVQWCKEIMKHSPTALRF
MENB_STAAM      FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLDKVEDETVQWCKEIMKHSPTALRF
MENB_STAAW      FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRF
MENB_STAAS      FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRF
MENB_STAAR      FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRF
MENB_STAAC      FDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRF
ECHD2_MOUSE     LPGAGGTQRLPRCLGVALAKELIFTGRRLNGAQARELGLVNHAVAQNEAYHRALALAQEILPQAPIAVRL
CAID_PROSL      VPDSGGVLRLPKRLPPAIVNEMLMTGRRMNAQEALRWGIANRVVSATELMDSARELADQIANSAPLAVAA
CAID_PROMH      VPDSGGVLRLPKRLPPAIVNEMLMTGRRMNAQEALRWGIANRVVSATELMDSARELADQIANSAPLAVAA
MENB_HAEIN      FDGGWGASYMARLVGQKKAREIWFLCRQYNAQEALDMGLVNTVVPYADLEKETVRWCREMLRNSPIAIRC
CDYL2_HUMAN     TPAGCSSYTFPQILGVALANEMLFCGRKLTAQEACSRGLVSQVFWPTTFSQEVMLRVKEMASCSAVVLEE
MENB_CYACA      FDAGYGSAYMARIIGQKKARELWFTCYQYDAFEAYKMGLVNWVVKIEDLDSYAIKLATDILNKSPLAIRF
AUHM_MOUSE      IPGGGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVLEQNQAYRKALDLAREFLPQGPVAMRV
ECHD2_BOVIN     LPGAGGTQRLPRCLGVALAKELIFTGRRLSGAQAQALGLVNHAVAQNEAYHRARALAQEILPQAPIAVRL
AUHM_HUMAN      IPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQAYRKALDLAREFLPQGPVAMRV
AUHM_DICDI      IPGAGGTQRLPRLIGIPRAKELIFTGAILDSKRALEIGLVQYETEKGEAFDKAIEIAKQIIPKGPIAIRM
ECH1_PONAB      AADVGTLQRLPKVIGNQLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDALALAAEISSKSPVAVQS
CDYL_RAT        SPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPIVLEE
CDYL_MOUSE      SPDGCSTVMFPKIMGGASANEMLFSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEE
ECH1_HUMAN      AADVGTLQRLPKVIGNQLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDALALAAEISSKSPVAVQS
CDYL1_HUMAN     SPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEE
ECHD2_HUMAN     LPGAGGTQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEAYQRARALAQEILPQAPIAVRL
CDY1_HUMAN      SPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNPIVLEE
FADB_SHESH      IPGFGGTVRLPRLIGTDNALEWITSGKDQRPEAALKVGAIDAVVAPENLQASAIKMLKDALAE-------
PECI_MOUSE      SPEACSSYTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVWTRLKTYAKLPPNAMRI
CRTL_DICDI      HPGMGVTHSITNIVGQDVASYMLLSSDIIKGDEAQRLGLVLKSVESDQVLPTALNLAETISKNSTIAVNS
CDY2_HUMAN      SPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEE
FADB_SHEWM      IPGFGGTVRLPRLIGADNALEWITTGKDHKPEAALKVGAIDAVVAPENLEASAIAMLKEALSE-------
FADB_SHEHH      IPGFGGTVRLPRVIGADNALEWITSGKDQRPDAALKVGAIDAVVAPEQLRPAALRMLKDAMAE-------
FADB_SHEPA      IPGFGGTVRLPRVIGADNALEWITSGKDQRPEAALKVGAIDAVVAPEQLKPAALKMLKD-----------
PECI_RAT        SPEACSSYTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVWTRLKTYAKLPPNSMRI
FADB_SHEPW      IPGFGGTVRLPRVVGTDNALEWITSGKDQRPEAALNVGAIDALVAPEQLQSAALKMLKDAIAE-------
FADB_BACSU      IPGFAGTQRLPRYVGTAKALELIGSGEPISGKEALDLGLVSIGAKDAEVIXXXXXXXXXXXXXSPQTLAS
CRT_CLODI       TPGYGGTQRLTRLVGMAKAKELIFTGQVIKADEAEKIGLVNRVVEPDILIEEVEKLAKIIAKNAQLAVRY
PECI_HUMAN      SPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRI
ECHA_MOUSE      LPGAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVEP------------------------
ECHA_RAT        LPGAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVDP------------------------
FADB_SERP5      MPGFGGSVRLPRLLGNDSALEIIAAGKDVSAKDALKVGLVDAVVAPEKLVEAALKMLQ------------
ECHP_CAVPO      LPGARGTQLLPRLIGVPAALDLITSGRHITAGEALKLGILDKVSAP---VEEAIKFAQKILNQ-------
ECH12_MYCBO     TSELGLSYLLPRAIGSSRAFEIMLTGRDVSAEEAERIGLVSRQVPDEQLLDACYAIAARMAGFSPGIELT
ECH12_MYCTU     TSELGLSYLLPRAIGSSRAFEIMLTGRDVSAEEAERIGLVSRQVPDEQLLDACYAIAARMAGFSPGIELT
ECHD1_MOUSE     VPSWGGTSRLVEIIGSRQALKVLSGTLKLDSKEALNIGLTDEVLQPSDALEQAQEWLEKFVSGPPQVIRG
MFP_ORYSJ       IPGFGGTQRLPRLVGLPKAIEMMLQSKFITAKEGKEGGLVDALCSPDELI--------------------
FADB_SHEB8      IPGFGGTVRLPRVIGADNALEWITTGKDQRAEDALKVGAVDSVVAPQALEAAAIQMLKDAVAE-------
YHAR_BACSU      VPDGGGHYLLKKRIGEAKAKKLIWSGKKLSASEAADMGLLDGTFA-GDPAEGARPIIETLLASPLLAMIE
MFPA_CUCSA      IPGFGGTQRLPRLVGLSKALEMMLTSKPIKGQEAHSLGLVDAIVPPEELINTARRWAEILERRRP-----
ECHP_DANRE      LPAAGGTQRLPRLIGIPAALELITTGRHVSAQEALKLGMVDQV---------------------------
FADB_ENTS8      MPGFGGSVRLPRLLGADSALEIIAAGKDITADAALKVGLVDAVVKPEKLIEGALRM--------------
YKB4_CAEEL      CPEACSSYTLPRIMGHQKAAALMMFSEKFTAHEAHIAGLVTQILPAATFEKDAKKIIDRYSKLSPITMKV
FADB_PSYWF      FPGFGGSVRTPRVIGIDNAVELIATGKAQKPAEALKLGLVDAVVA-------------------------
FADB_PSEMY      YPGFGGTVRLPRVIGTDNAVEWIASGKENKAADALKVGAVDAVVAPAKLKEAALDLVK------------
PKSI_BACSU      TPGMGATFIVPKKLGFSLAQEILLNAGSYRGADLEKRGVPFKVLPRAEVLDYAVELAQELAEKPRNSLVT
FADB_YERE8      MPGFGGSVRLPRLLGADSALEXXXXXXXXXXXXXLKVGLVDAVVAPEKLVDAALSI--------------
FADB_YERPY      MPGFGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSAL----------------
FADB_YERPS      MPGFGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSAL----------------
FADB_YERPP      MPGFGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSAL----------------
FADB_YERPN      MPGFGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSAL----------------
FADB_YERPG      MPGFGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSAL----------------
FADB_YERPE      MPGFGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSAL----------------
FADB_YERPB      MPGFGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSAL----------------
FADB_YERPA      MPGFGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSAL----------------
FADB_YERP3      MPGFGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSAL----------------
ECH1_RAT        AADVGTLQRLPKVINRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVLNAAFALAADISSKSPVAVQG
FADB_SHELP      IPGFGGTVRLPRVIGADNALEWITTGKDQRPEAALKVGAIDAVVAPELLETAACQMLQDAISE-------
ECHA_HUMAN      LPGAGGTQRLPKMVGVPAALDMMLTGRSIRADRAKKMGLVDQL---------------------------
FADB_SHEAM      IPGFGGTVRLPRLIGADNALEWITTGKDQRPEDALKVGAIDAVVAPENLEAAAIQM--------------
FADB_ENTCL      MPGFGGSVRMPRMLGADSAMEIIAAGKDVGAEQAQKIGLVDGVVKPEKLVEGALAI--------------
ECHP_PONAB      LPGARGTQLLPRLIGVPAALDLITSGRHILADEALKLGILDKV-VNSDPVEEAIRFAQRVSDQ-------
FADJ_CITK8      LPGSGGTQRLPRLVGVSTALDMILTGKQLRPKQALRVGLVDEV---------------------------
FADB_SHEB9      IPGFGGTVRLPRVIGADNALEWITTGK-------------------------------------------
FADB_PSE14      YPGFGGTVRLPRIIGADNAIEWIASGKESSAEDALKVGAVDAVVAPEKLQAAALDLIQ------------
FADJ_IDILO      LPGSGGTQRLPELVGVQQGLTMILTGKELRAKQALKAGLVTEVVPQSILLDVAV---EHALKRKPKS---
FADB_SHEB5      IPGFGGTVRLPRVIGADNALEWITTGK-------------------------------------------
FADB_SHIDS      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI--------------
FADB_KLEP3      MPGFGGSVRLPRLLGADSALEIIAAGKDVGADQALKIGLVDGVVAAEKLRDGALAI--------------
FADB_ERWCT      MPGFGGTVRLPRLLGADSALEIIAAGKDVSAADALKVGLVQAVVANEKLIPAAIKM--------------
ECHD1_BOVIN     IPSWGGATRLVEIIGGRQALKVLSGALKLDSEKALNIGMVDDILPSSECLKEAQEWLQQFIKGPPEVIRA
FADB_SHIFL      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI--------------
FADB_SHIF8      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI--------------
FADB_PHOPR      MPGFGGTVRLPRLLGADSAMEIITAGKDKKAQDALKLGLVDAVVAPTALKDAALSMIKD-----------
FADB_KLEP7      MPGFGGSVRLPRLLGADSALEIIAAGKDVGADQALKIGLVDGVVAAEKLRDGALAI--------------
FADB_ECOUT      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAIAI--------------
FADB_ECOSM      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI--------------
FADB_ECOHS      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI--------------
FADB_ECO5E      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI--------------
FADB_ECO57      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI--------------
FADB_ECO45      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAIAI--------------
FADB_SHEB2      IPGFGGTVRLPRVIGADNALEWITTGK-------------------------------------------
FADB_ECOLU      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAMAI--------------
FADB_ECOL6      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAMAI--------------
FADB_ECOL5      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAMAI--------------
FADB_ECO81      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAIAI--------------
FADB_ECO7I      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAMAI--------------
FADB_ECO27      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAMAI--------------
FADB_CITK8      MPGFGGSVRMPRMLGADSALEIIAAGKDIGAEQALKIGLVDGVVKPEKLLDGAIAV--------------
ECHP_HUMAN      LPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKV-VNSDPVEEAIRFAQRVSDQ-------
ECHD1_RAT       VPSWGGASRLVEIIGSRQALKVLSGTFKLDSKEALRIGLADEVLQPSDALEQAQEWLEQFVSGPAQVIRG
ECHA_PIG        LPGAGGTQRLPKMVGVPAAFDMMLTGRGIRADKAKKMGLVDQL---------------------------
FADJ_SALTI      LPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADB_SHESA      IPGFGGTVRLPRVIGADNALEWITTGKDQRP---------------------------------------
FADB_SALTY      MPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAV--------------
FADB_SALTI      MPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAV--------------
FADB_SALPK      MPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAV--------------
FADB_SALPB      MPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAV--------------
FADB_SALPA      MPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAV--------------
FADB_SALG2      MPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAV--------------
FADB_SALEP      MPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAV--------------
FADB_SALCH      MPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAV--------------
FADB_SALA4      MPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAV--------------
FADB_ECO24      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGV---------------------------
FADB_SHESR      IPGFGGTVRLPRVIGADNALEWITTGKDQRP---------------------------------------
FADB_SHESM      IPGFGGTVRLPRVIGADNALEWITTGKDQRP---------------------------------------
FADB_SALSV      MPGFGGSVRMPRMLGADSALEIIAAGKDIGAEQALKIGLVDGVVKQEKLIDGAIAV--------------
FADB_PSYCK      FPGFGGTVRSTRVIGIDNALELIATGTPKKALDALKLGLVD-----------------------------
FADB_PHOLL      MPGFGGSVRLPRLIGTDNALDIIAAGKDIGAEEALKNGLIDAVVPKEKLVDSAVSMLE------------
FADJ_SALSV      LPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALRAGLVDDVVPQTILLEAAVELAERLAQRT------
FADB_SHISS      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGV---------------------------
FADB_SHIB3      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGV---------------------------
FADB_SALNS      MPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQETLIEGAIAV--------------
FADB_PSYA2      FPGFGGTVRSTRVIGIDNALELIATGAPKKALDALKLGLVD-----------------------------
FADB_ESCF3      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGV---------------------------
FADB_ECOLI      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGV---------------------------
FADB_ECOLC      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGV---------------------------
FADB_ECODH      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGV---------------------------
FADB_ECOBW      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGV---------------------------
FADB_ECO8A      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGV---------------------------
FADB_ECO55      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGV---------------------------
FADJ_SALTY      LPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADJ_SALPB      LPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADJ_SALNS      LPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADJ_SALHS      LPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADJ_SALG2      LPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADJ_SALEP      LPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADJ_SALDC      LPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADJ_SALCH      LPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADJ_SALA4      LPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADB_VIBSL      MPGFGGCVRLPRVIGADSAMEIITQGKACRADEALKVGLLDAIVETDQLLESAINTVSLAANE-------
FADB_SHEFN      IPGFGGTVRLPRVIGADNALEWITTAKDQRPEDALKVGAIDAVVAPENLEAAAIQMARRTKKQSPLQLPK
FADB_PSEU5      YPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVHAVDAVVAPEKLQEAALDLVK------------
FADB_ENT38      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLIDGI---------------------------
FADB_ALISL      MPGWGGSVRLPRLIGADPAMEVITTGKPKRAKDALKIGMVDGIVS-------------------------
FADJ_SALPK      LPGSGGTQRLPRLVGVSTALDMILIGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADJ_SALPA      LPGSGGTQRLPRLVGVSTALDMILIGKQLRARQALKAGLVDDVVPQTILLEAAVELAERLAQRT------
FADB_SHESW      IPGFGGTVRLPRVIGADNALEWISTG--------------------------------------------
FADB_SHEPC      IPGFGGTVRLPRVIGADNALEWISTG--------------------------------------------
FADB_PSESM      YPGFGGTVRLPRIIGADNAIEWIASGKENSAEDALKVGVVDAIVAPEKLQAAALDLIQ------------
FADB_VIBF1      MPGWGGSVRLPRLIGADPAMEVITTGKPKRAKDALALGMVDGVVSRETLITDSV----------------
FADB_ECOSE      MPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGV---------------------------
ECHP_RAT        LPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAV-VKSDPVEEAIKFAQKI----------
MFPA_BRANA      IPGFGGTQRLPRLVGLTKALEMILTSKPVKAEEGHSLGLIDAVVPPAELLNAARRWALDIAERRKPWVSS
FADB_VIBFM      MPGWGGSVRLPRLIGADPAMEVITTGKPKRAKDALALGMIDGVVSRETLITDSV----------------
ECHA6_MYCLE     ALDNWSIRRLSSLVGHGRARAMLLTAEKLTADIALQTGMANRIG----ALADAQAWAAEVTGLAPLAIQH
FADB_SHEON      IPGFGGTVRLPRVIGADNALEWITTG--------------------------------------------
FADB_AERHH      MPGFGGTVRLPRVIGADNALEWITTGKDYRADDALKVGAIDAVVAPDALQSAAVQMIKDAVK--------
FADB_AERS4      MPGFGGTVRLPRVIGADNALEWITTGKDYRADDALKVGAIDAVVAPDALHSAAVQMSRRAAKKAPLRLSK
HIBCH_DANRE     FPDVGGGYFLPRL---------------------------------------------------------
ECHD1_PONAB     IPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSKSLEEAQEWLKQFIQGPPEVIRA
ECHD1_HUMAN     IPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSKSLEEAQEWLKQFIQGPPEVIRA
ECH1_MOUSE      AADVGTLQRLPKVIGNQLVNELTFSARKMMADEALDSGLVSRVQDKDXXXXXXXXXXXDISSKSPVAVQG
HIBCH_XENTR     FPDVGGGYFLPR-LPGKLGLYLALTG--------------------------------------------
FADB_PSEU2      YPGFGGTVRLPRIIGADNAIEWIASGKENAAEDALKVGAVDAVVAPEKLQAAALDLIQ------------
FADB_ACIBY      YPGFGGSVRLSRLI--------------------------------------------------------
FADB_ACIBC      YPGFGGSVRLSRLI--------------------------------------------------------
FADB_ACIB5      YPGFGGSVRLSRLI--------------------------------------------------------
FADB_ACIB3      YPGFGGSVRLSRLI--------------------------------------------------------
FADB_IDILO      IPGFGGTMRLPRVIGPDNALEWITTGKNNKALDALKVGAVDAVVEP------------------------
FADB_ACIBS      YPGFGGSVRLSRLI--------------------------------------------------------
HIBCH_BOVIN     FPDVGGGYFLPRL---------------------------------------------------------
FADB_VIBCM      MPGFGGTVRLPRLIGADSAMEIITQGKACRAEEALKVGLLDAIVDSDKLIDSAI----------------
FADB_VIBCH      MPGFGGTVRLPRLIGADSAMEIITQGKACRAEEALKVGLLDAIVDSDKLIDSAI----------------
FADB_VIBC3      MPGFGGTVRLPRLIGADSAMEIITQGKACRAEEALKVGLLDAIVDSDKLIDSAI----------------
FADB_VIBVY      MPGFGGCVRLPRVIGADSAMEIITQGKACRAEEALKIGLLDAVVDSDRLYASALQTLTDAINE-------
FADB_VIBVU      MPGFGGCVRLPRVIGADSAMEIITQGKACRAEEALKIGLLDAVVDSDRLYASALQTLTDAINE-------
FADB_COLP3      MPGFGGTVRLPRLIGFDNAATWMSTGKAFKPAAALAQGAIDAVVEP------------------------
ECHP_MOUSE      LPGARGTQLLPRVVGVPVALDLITSGRHISTDEALKLGILD-VVVKSDPVEEAIKFAQTV----------
FADJ_ECOSM      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPQSILLEAAVELAK------------
FADJ_ECO7I      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPQSILLEAAVELAK------------
FADJ_ENT38      LPGSGGTQRLPRLVGVSTALEMILTGKQLRPRQALKVGLVDEVVPHSILLTAAVELAQKERQASRHLPVR
FADB_ACIAD      FPGFGGTVRLSRLI--------------------------------------------------------
FADJ_ECOUT      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAK------------
FADJ_ECOL5      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAK------------
FADJ_ECOK1      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAK------------
FADJ_ECO8A      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAK---KDRPSS---
FADJ_ECO81      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAK------------
FADJ_ECO5E      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAK---KDRPSS---
FADJ_ECO57      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAK---KDRPSS---
FADJ_ECO55      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAK---KDRPSS---
FADJ_ECO45      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAK------------
FADJ_ECO27      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAK------------
FADJ_SHISS      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAK---KDRPSS---
FADJ_SHIFL      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAK---KDRPSS---
FADJ_ECOLU      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPQSILLEAAVELAK------------
FADJ_ECOHS      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAK---KDRPSS---
DCH_THAAR       FAP-AASCLLPPRVGQACAEDLLWSGRSIDGAEGHRIGLIDVLAEDPEA--AALRFDEHIARLSASSLRF
FADJ_SHIB3      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAK---KDRPSS---
FADJ_ECOSE      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAK---KDRPSS---
FADJ_ECO24      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAK---KDRPSS---
FADB_VIBPA      MPGFGGCVRLPRVIGADSAMEIITQGKACRADEALKIGLLDAVVETDQTLTSAINQARRKQKTSPLTLSK
FADJ_ECOLI      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAK---KERPSS---
FADJ_ECODH      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAK---KERPSS---
FADJ_ECOBW      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAK---KERPSS---
FADB_VIBHB      MPGFGGCVRLPRVIGADSAMEVITQGKACRADEALKIGLLDAVVDSDALYESALKTARRKQKTSPLTLSK
FADB_PSEPF      YPGFGGTVRLPRLIGADNAIEWIAAGKENRPEDALKVGAVDAVVAPEKLQDAALEL--------------
FADJ_KLEP7      LPGSGGTQRLPRLIGVSTALDMMLTGKQLRPRQALKAGLVDEVVPQAILLQAAVELA-------------
FADJ_ECOLC      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDV-VPHSILLEA-----------------
FADJ_ECOL6      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAK------------
ECH12_MYCLE     SSELGLSYLLPRAVGSSRAFEIMLSGRDVGAEEAEQIGLVSYRVSDDRLLDTCYSIAARMATFSRSGTEL
HIBCH_CHICK     FPDVGGGYFLPRL---------------------------------------------------------
FADJ_SHIDS      LPGSDGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAK------------
FADJ_SHIBS      LPGSGGTQRLPRLIGVSTTLEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAK---KDRPSS---
FADB_PSEFS      YPGFGGTVRLPRLIGADNAIEWIAAGKENRAEDALKVGAVDAVVAPDKLAEAALNL--------------
FADJ_SHIF8      LPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAK---KDRPSS---
ECH17_MYCTU     IPSGDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLI------------------------------
ECH17_MYCTA     IPSGDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLI------------------------------
ECH17_MYCBP     IPSGDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLI------------------------------
ECH17_MYCBO     IPSGDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLI------------------------------
FADB_PSEPG      YPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAPELLLAGAL----------------
HIBCH_YEAST     FPDVGSTFALPRIVTSQMALYLCLTGEVVTGADAYMLGLAS-----------------------------
FADJ_ESCF3      LPGSGGTQRLPRLVGLSTALDMILTGKQLRPGQALKSGLVDEIVPQSILLQAAVERAKQ-ERQTPRSL--
FADB_PSEOL      YPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAPELLMAGALDLVK------------
FADB_PSEP1      YPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAPELLLAGAL----------------
FADB_PSEF5      YPGFGGTVRLPRLIGADNAIEWIAAGKENRAEDALKVGAVDAVVAP------------------------
ECH14_MYCTU     HPGGGATWMLQRAVGPQVARAALLFGMCFDAESAVRHGLALMVA--------------------------
ECH14_MYCBO     HPGGGATWMLQRAVGPQVARAALLFGMCFDAESAVRHGLALMVA--------------------------
FADB_PSEPU      YPGFGGTVRLPRLIGSDNAVEWIASGKENRAEDALKVGAVDAVVAP------------------------
FADB_PSEE4      YPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAP------------------------
HIBCH_DICDI     FCDVGGSYFLPR-LPNNYGMYLALTGSKLKGNNVYLAGVATHFVSNEQALEKEIEECENPTSQTINSI--
FADB_PSEPW      YPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAP------------------------
FADB_PSEPK      YPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAPELLLAGAL----------------
FADJ_KLEP3      LPGSGGTQRLPRLIGVSTALDMMLTGRQLRARQALKAGLVDEVVPQAILLQAAVELA-------------
ECHH_RHOCA      MPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMGLIWE-AVPDVDFEXXXXXXXXXXXXGPSXXXX
FADB_PSEAE      YPGFGGTVRLPRLIGCDNAVEWIASGK-------------------------------------------
FADB_PSEAB      YPGFGGTVRLPRLIGCDNAVEWIASGK-------------------------------------------
FADB_PSEA8      YPGFGGTVRLPRLIGCDNAVEWIASGK-------------------------------------------
HIBCH_SCHPO     FTDVAASFFFSRL---------------------------------------------------------
PKSH_BACSU      YPACVLPF-LIRRIGRQKAHYMTLMTKPISVQEASEWGLID-----------------------------
FADB_PSEFR      YPGFGGTVRLPRLIGVDNAVEWIASGK-------------------------------------------
HIBCH_RAT       FPDVGGGYFLPR-LQGKLGYFLALTGFRLKGRDVHRAGIATHFVD-----SEKLHVLEELALKSPSAVAG
ECI1_YEAST      ITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISK----------------------------
FADJ_PHOLL      LPGSGGTQRLPRLIGVSSALDIMLTGKQLRAKQALRLGLVD-----------------------------
HIBCH_MOUSE     FPDVGGGYFLPR-LQGKLGYFLALTGYRLKGRDVHRAGIATHFVD-----SEKLRVLEELALKSPSAVAG
DCI1_YEAST      VAEVGTSVTLTQKLGINSANEHMIFSTPVLFKELKNYQLTNTETFNEKVLQD---IKQNLEGLYPKSVLG
FADJ_PECCP      LPGSGGTQRLPRLIGLDSALDLILTGRHLRANQALRQGLVDE-AVPHDILLD------------------
ECH17_MYCPA     VPGGDALARLTRVAGASKAKELVFSGRFFDAEEALALGLIDEM---------------------------
ECH17_MYCA1     VPGGDALARLTRVAGASKAKELVFSGRFFDAEEALALGLIDEM---------------------------
FADJ_ERWCT      LPGSGGTQRLPRLIGLDSALDLILTGRHLRAGQALRQGLVDEAVPHDILLDTAVEI--------------
FADN_BACSU      IPGGGGNKEL------------------------------------------------------------
HIBCH_XENLA     FPDVGGGYFLPRL---------------------------------------------------------
FADB_PSEA7      YPGFGGTVRLPRLIGCDNAVEWIASGK-------------------------------------------
HIBCH_HUMAN     FPDVGGGYFLPRL---------------------------------------------------------
FADJ_VIBF1      LPGSGGTQRLPRLIGLLPSLDIILTGKQLRPKTALKLGVVD-----------------------------
BOXC_AZOEV      ----------------------------------------------------------------------
FADJ_SERP5      LPGSGGTQRLPRLIGASKALDMILTGKHIRARQALRLGLVD-----------------------------
SPPA_HAEIN      HADGVSTTELA-----------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IKSLINHAGTATLTEHLAAERDSFVAALHHKDGGEGISAFLEKRKPNYR
ECHH_RHIME      AKEAVNRSLELTLAEGLRFERRLFQSLFATEDQKEGMAAFVAKRKAEFK
ECHM_CAEEL      AKEAVNKAYELTLQEGLHFERRLFHATFATKDRKEGMTAFAEKRKPQW-
ECHA8_MYCTU     AKEAVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQF-
ECHA8_MYCBO     AKEAVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQF-
ECHA8_MYCLE     AKEAVNRSFESTLAEGLLHERRLFHSTFVTDDQSEGMAAFIEKRAPQF-
ECHM_HUMAN      AKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFK
CRT_CLOAB       SKQAINRGMQCDIDTALAFESEAFGECFSTEDQKDAMTAFIEKRK----
ECHM_MOUSE      AKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFK
ECHM_DICDI      AKEAVNASYELTLQEGIRFERRMFHSTFGTHDQKEGMNAFVEKRTPTW-
ECHM_RAT        AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
ECHM_PONAB      AKESVNAAFEMTLAEGSKLEKKLFYSTFATNDRKEGMTAFVEKRKANFK
ECHM_BOVIN      AKESVNAAFEMTLAEGVKLEKKLFYSTFATEDRKEGMAAFVEKRKANFK
ECH1_DICDI      TKLTLNHADDHTIDEGLYRVALQNAAFLKSDDLNESATSFFEKRQPIFK
PAAG_ECOLI      IKQAINSAETNTLDTQLDLERDYQRLAGRSADYREGVSAFLAKRSPQF-
ECHD3_XENLA     GKSTFYRQMAKSLTDAYKLTSEVMVENLAMKDGQEGLKSFIQKRKP---
ECHD3_RAT       GKATFYKQLPQDLSTAYFLASQAMVDNLTLKDGQEGIEAFIQKRRP---
ECHD3_HUMAN     GKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP---
YNGF_BACSU      AKFAINKGLETDLATGLAIEQKAYEQTIPTKDRREGLQAFQEKRRAVYK
ECHD3_MOUSE     GKATFYKQLPQDLRTAYFLASQAMVDNLALQDGQEGIEAFIQKRKP---
CAID_ECO57      LKEIYRTTSEMPVEESYSYIRSGYPSVLHSEDAIEGPLAFAEKRDPVWK
MENB_BACSU      LKAAFN-ADTDGLAGIQQFAGDATLLYYTTDEAKEGRDSFKEKRKPDF-
CAID_SHIFL      LKEIYRTTSEMPVEEAYRYIRSGYPSVLHSEDAIEGPLAFAEKRDPVWK
CAID_SALAR      LKEITRTTRDMSVEEGYRYIRSGYPAVLHSEDALEGPLAFAEKRDPEWK
CAID_ECOSM      LKEIYRTTSEMPVEEAYRYIRSNYPSVLHSEDAIEGPLAFAEKRDPVWK
CAID_ECOLI      LKEIYRTTSEMPVEEAYRYIRSGYPSVLHSEDAIEGPLAFAEKRDPVWK
CAID_ECOLC      LKEIYRTTSEMPVEEAYRYIRSGYPSVLHSEDAIEGPLAFAEKRDPVWK
MENB_STAS1      LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDF-
CAID_ECOL6      LKEIYRTTSEMPVEEAYRYIRSGYPSVLHSEDAIEGPLAFAEKRDPVWK
CAID_ECOL5      LKEIYRTTSEMPVEEAYRYIRSGYPSVLHSEDAIEGPLAFAEKRDPVWK
PAAF_ECOLI      XXXXXXXXXEVALQAGLAQERQLFTLLAATEDRHEGISAFLQKRTPDFK
MENB_STAHJ      LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDF-
ECHA6_MYCTU     AKRVLNDDG--AIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKFQ
ECHA6_MYCBO     AKRVLNDDG--AIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKFQ
MMCD_ECOLI      IKEELRVLGEAHTMNSDEFERIQGMAVYDSEDYQEGMNAFLEKRKPNF-
CAID_CITK8      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDAIEGPQAFAEKRDPVWK
MENB_STAES      LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRNPDF-
MENB_STAEQ      LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRNPDF-
CAID_SALG2      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
CAID_SALEP      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
MENB_PASMU      LKAALNADGQAGLQELAGNATMLFYMT---EEGQEGRNAFNEKRAPDF-
ECHD3_DANRE     GKQIFNTQMSQSRDAAYSTAGAAMLDNLRLRDGQEGIRAFLEKRKP---
CAID_SALTI      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRAPVWK
CAID_SALPK      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
CAID_SALPC      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
CAID_SALPA      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
CAID_SALCH      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
CAID_SALA4      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
MENB_ECOLI      LKAALNADGQAGLQELAGNATMLFYMT---EEGQEGRNAFNQKRQPDF-
MENB_ECOL6      LKAALNADGQAGLQELAGNATMLFYMT---EEGQEGRNAFNQKRQPDF-
CAID_SALTY      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
CAID_SALSV      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
CAID_SALPB      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
CAID_SALNS      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRAPVWK
CAID_SALHS      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
CAID_SALDC      LKEIYRATSEMPVEEGYRYIRSGYPSVLHSEDALEGPQAFAEKRDPVWK
MENB_STAAN      LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDF-
MENB_STAAM      LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDF-
MENB_STAAW      LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDF-
MENB_STAAS      LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDF-
MENB_STAAR      LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDF-
MENB_STAAC      LKAAMN-ADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDF-
ECHD2_MOUSE     GKVAIDRGMEVDIASGMAIEQMCYAQNIPTQDRLEGMAAFREKRAPKF-
CAID_PROSL      LKEIYRATSELSIEEGYKLMRSGYPRVLHSEDALEGPLAFAEKRSPEWK
CAID_PROMH      LKEIYRATSELSIEEGYKLMRSGYPRVLHSEDALEGPLAFAEKRSPEWK
MENB_HAEIN      LKAALNADGQAGLQELAGNATMLFYMT---EEGQEGRNAFNEKRAPDF-
CDYL2_HUMAN     SKCLV--------------------------------------------
MENB_CYACA      LKSSLNAAGYSTMLFYMSAE------------GQEGHRAFLENREPDF-
AUHM_MOUSE      AKLAINQGMEVDLVTGLAIEEACYAQTISTKDRLEGLLAFKEKRPPRYK
ECHD2_BOVIN     SKVAIDRGIEVDIASGMAIEGICYAQNIPTRDRLEGMAAFREKRLPRF-
AUHM_HUMAN      AKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYK
AUHM_DICDI      AKQAIDRGMNVDQASGMIIEQASYAQVIPTKDRIEGLTAFKEKRKPIYK
ECH1_PONAB      TKVNLLYS-----RDHSVAESLNYVAS----------------------
CDYL_RAT        SKALVRCNMKMELEQANERECDALKKIWGSAQGMDSMLKYLQRK-----
CDYL_MOUSE      SKALV--------------------------------------------
ECH1_HUMAN      TKVNLLYS-----RDHSVAESLNYVAS----------------------
CDYL1_HUMAN     SKALV--------------------------------------------
ECHD2_HUMAN     GKVAIDRGTEVDIASGMAIEGMCYAQNIPTRDRLEGMAAFREKRTPKF-
CDY1_HUMAN      CKALV--------------------------------------------
FADB_SHESH      -------------------------------------------------
PECI_MOUSE      SKELI--------------------------------------------
CRTL_DICDI      TTKTLRNKYNSDLDKSLTREADAQSQCWASKDIVEGILAIRESRDPKH-
CDY2_HUMAN      CKALV--------------------------------------------
FADB_SHEWM      -------------------------------------------------
FADB_SHEHH      -------------------------------------------------
FADB_SHEPA      -------------------------------------------------
PECI_RAT        SKELI--------------------------------------------
FADB_SHEPW      -------------------------------------------------
FADB_BACSU      LLELLYSNKVYSYEGSLKLEAKRFGEAFESEDAKEGIQAFLEKRKPQFK
CRT_CLODI       SKEAIQLGAQTDINTGIDIESNLFGLCFSTKDQKEGIVSF---------
PECI_HUMAN      SKEVI--------------------------------------------
ECHA_MOUSE      -------------------------------------------------
ECHA_RAT        -------------------------------------------------
FADB_SERP5      -------------------------------------------------
ECHP_CAVPO      -------------------------------------------------
ECH12_MYCBO     KRTLWSGLDAASLEAHMQAE-----------------------------
ECH12_MYCTU     KRTLWSGLDAASLEAHMQAE-----------------------------
ECHD1_MOUSE     LKKSVCSARELYIEEALQNERD---------------------------
MFP_ORYSJ       -------------------------------------------------
FADB_SHEB8      -------------------------------------------------
YHAR_BACSU      TKGIFQSLQIEELKKVLSLERSAQERMRRTKDHQEGIRAFLEKREPKFQ
MFPA_CUCSA      -------------------------------------------------
ECHP_DANRE      -------------------------------------------------
FADB_ENTS8      -------------------------------------------------
YKB4_CAEEL      AKELM--------------------------------------------
FADB_PSYWF      -------------------------------------------------
FADB_PSEMY      -------------------------------------------------
PKSI_BACSU      LK-----------------------------------------------
FADB_YERE8      -------------------------------------------------
FADB_YERPY      -------------------------------------------------
FADB_YERPS      -------------------------------------------------
FADB_YERPP      -------------------------------------------------
FADB_YERPN      -------------------------------------------------
FADB_YERPG      -------------------------------------------------
FADB_YERPE      -------------------------------------------------
FADB_YERPB      -------------------------------------------------
FADB_YERPA      -------------------------------------------------
FADB_YERP3      -------------------------------------------------
ECH1_RAT        SKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKK-----
FADB_SHELP      -------------------------------------------------
ECHA_HUMAN      -------------------------------------------------
FADB_SHEAM      -------------------------------------------------
FADB_ENTCL      -------------------------------------------------
ECHP_PONAB      -------------------------------------------------
FADJ_CITK8      -------------------------------------------------
FADB_SHEB9      -------------------------------------------------
FADB_PSE14      -------------------------------------------------
FADJ_IDILO      -------------------------------------------------
FADB_SHEB5      -------------------------------------------------
FADB_SHIDS      -------------------------------------------------
FADB_KLEP3      -------------------------------------------------
FADB_ERWCT      -------------------------------------------------
ECHD1_BOVIN     LKKSVSSCKELCLEEALQRERD---------------------------
FADB_SHIFL      -------------------------------------------------
FADB_SHIF8      -------------------------------------------------
FADB_PHOPR      -------------------------------------------------
FADB_KLEP7      -------------------------------------------------
FADB_ECOUT      -------------------------------------------------
FADB_ECOSM      -------------------------------------------------
FADB_ECOHS      -------------------------------------------------
FADB_ECO5E      -------------------------------------------------
FADB_ECO57      -------------------------------------------------
FADB_ECO45      -------------------------------------------------
FADB_SHEB2      -------------------------------------------------
FADB_ECOLU      -------------------------------------------------
FADB_ECOL6      -------------------------------------------------
FADB_ECOL5      -------------------------------------------------
FADB_ECO81      -------------------------------------------------
FADB_ECO7I      -------------------------------------------------
FADB_ECO27      -------------------------------------------------
FADB_CITK8      -------------------------------------------------
ECHP_HUMAN      -------------------------------------------------
ECHD1_RAT       LKKSVCSGRELYLEEALQNERD---------------------------
ECHA_PIG        -------------------------------------------------
FADJ_SALTI      -------------------------------------------------
FADB_SHESA      -------------------------------------------------
FADB_SALTY      -------------------------------------------------
FADB_SALTI      -------------------------------------------------
FADB_SALPK      -------------------------------------------------
FADB_SALPB      -------------------------------------------------
FADB_SALPA      -------------------------------------------------
FADB_SALG2      -------------------------------------------------
FADB_SALEP      -------------------------------------------------
FADB_SALCH      -------------------------------------------------
FADB_SALA4      -------------------------------------------------
FADB_ECO24      -------------------------------------------------
FADB_SHESR      -------------------------------------------------
FADB_SHESM      -------------------------------------------------
FADB_SALSV      -------------------------------------------------
FADB_PSYCK      -------------------------------------------------
FADB_PHOLL      -------------------------------------------------
FADJ_SALSV      -------------------------------------------------
FADB_SHISS      -------------------------------------------------
FADB_SHIB3      -------------------------------------------------
FADB_SALNS      -------------------------------------------------
FADB_PSYA2      -------------------------------------------------
FADB_ESCF3      -------------------------------------------------
FADB_ECOLI      -------------------------------------------------
FADB_ECOLC      -------------------------------------------------
FADB_ECODH      -------------------------------------------------
FADB_ECOBW      -------------------------------------------------
FADB_ECO8A      -------------------------------------------------
FADB_ECO55      -------------------------------------------------
FADJ_SALTY      -------------------------------------------------
FADJ_SALPB      -------------------------------------------------
FADJ_SALNS      -------------------------------------------------
FADJ_SALHS      -------------------------------------------------
FADJ_SALG2      -------------------------------------------------
FADJ_SALEP      -------------------------------------------------
FADJ_SALDC      -------------------------------------------------
FADJ_SALCH      -------------------------------------------------
FADJ_SALA4      -------------------------------------------------
FADB_VIBSL      -------------------------------------------------
FADB_SHEFN      LEAMMSFA-----------------------------------------
FADB_PSEU5      -------------------------------------------------
FADB_ENT38      -------------------------------------------------
FADB_ALISL      -------------------------------------------------
FADJ_SALPK      -------------------------------------------------
FADJ_SALPA      -------------------------------------------------
FADB_SHESW      -------------------------------------------------
FADB_SHEPC      -------------------------------------------------
FADB_PSESM      -------------------------------------------------
FADB_VIBF1      -------------------------------------------------
FADB_ECOSE      -------------------------------------------------
ECHP_RAT        -------------------------------------------------
MFPA_BRANA      V------------------------------------------------
FADB_VIBFM      -------------------------------------------------
ECHA6_MYCLE     AKRVLNDDG--SIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQ
FADB_SHEON      -------------------------------------------------
FADB_AERHH      -------------------------------------------------
FADB_AERS4      LEAMMSFSTAAGMVAAVAGK-----------------------------
HIBCH_DANRE     -------------------------------------------------
ECHD1_PONAB     LKKSVCSGRELYLEEALQNERD---------------------------
ECHD1_HUMAN     LKKSVCSGRELYLEEALQNERD---------------------------
ECH1_MOUSE      SKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKR-----
HIBCH_XENTR     -------------------------------------------------
FADB_PSEU2      -------------------------------------------------
FADB_ACIBY      -------------------------------------------------
FADB_ACIBC      -------------------------------------------------
FADB_ACIB5      -------------------------------------------------
FADB_ACIB3      -------------------------------------------------
FADB_IDILO      -------------------------------------------------
FADB_ACIBS      -------------------------------------------------
HIBCH_BOVIN     -------------------------------------------------
FADB_VIBCM      -------------------------------------------------
FADB_VIBCH      -------------------------------------------------
FADB_VIBC3      -------------------------------------------------
FADB_VIBVY      -------------------------------------------------
FADB_VIBVU      -------------------------------------------------
FADB_COLP3      -------------------------------------------------
ECHP_MOUSE      -------------------------------------------------
FADJ_ECOSM      -------------------------------------------------
FADJ_ECO7I      -------------------------------------------------
FADJ_ENT38      ERILAGPLGRALL------------------------------------
FADB_ACIAD      -------------------------------------------------
FADJ_ECOUT      -------------------------------------------------
FADJ_ECOL5      -------------------------------------------------
FADJ_ECOK1      -------------------------------------------------
FADJ_ECO8A      -------------------------------------------------
FADJ_ECO81      -------------------------------------------------
FADJ_ECO5E      -------------------------------------------------
FADJ_ECO57      -------------------------------------------------
FADJ_ECO55      -------------------------------------------------
FADJ_ECO45      -------------------------------------------------
FADJ_ECO27      -------------------------------------------------
FADJ_SHISS      -------------------------------------------------
FADJ_SHIFL      -------------------------------------------------
FADJ_ECOLU      -------------------------------------------------
FADJ_ECOHS      -------------------------------------------------
DCH_THAAR       AVRAARCDSVPRIKQKLDTVEALYLEELASHDAVEGLKAFLEKRSANW-
FADJ_SHIB3      -------------------------------------------------
FADJ_ECOSE      -------------------------------------------------
FADJ_ECO24      -------------------------------------------------
FADB_VIBPA      LESMMSFTMAKGLVAQVA-------------------------------
FADJ_ECOLI      -------------------------------------------------
FADJ_ECODH      -------------------------------------------------
FADJ_ECOBW      -------------------------------------------------
FADB_VIBHB      LESMMSF----TMAKGLVAQK----------------------------
FADB_PSEPF      -------------------------------------------------
FADJ_KLEP7      -------------------------------------------------
FADJ_ECOLC      -------------------------------------------------
FADJ_ECOL6      -------------------------------------------------
ECH12_MYCLE     TKALWGGLDAASLDKHMQSESAQLFIALHTSNFEEAAAPCTEKR-----
HIBCH_CHICK     -------------------------------------------------
FADJ_SHIDS      -------------------------------------------------
FADJ_SHIBS      -------------------------------------------------
FADB_PSEFS      -------------------------------------------------
FADJ_SHIF8      -------------------------------------------------
ECH17_MYCTU     -------------------------------------------------
ECH17_MYCTA     -------------------------------------------------
ECH17_MYCBP     -------------------------------------------------
ECH17_MYCBO     -------------------------------------------------
FADB_PSEPG      -------------------------------------------------
HIBCH_YEAST     -------------------------------------------------
FADJ_ESCF3      -------------------------------------------------
FADB_PSEOL      -------------------------------------------------
FADB_PSEP1      -------------------------------------------------
FADB_PSEF5      -------------------------------------------------
ECH14_MYCTU     -------------------------------------------------
ECH14_MYCBO     -------------------------------------------------
FADB_PSEPU      -------------------------------------------------
FADB_PSEE4      -------------------------------------------------
HIBCH_DICDI     -------------------------------------------------
FADB_PSEPW      -------------------------------------------------
FADB_PSEPK      -------------------------------------------------
FADJ_KLEP3      -------------------------------------------------
ECHH_RHOCA      XXXXXXXXGLSNLPAQLALEARLQGELGQSADFREGVQAFLEKRPPHF-
FADB_PSEAE      -------------------------------------------------
FADB_PSEAB      -------------------------------------------------
FADB_PSEA8      -------------------------------------------------
HIBCH_SCHPO     -------------------------------------------------
PKSH_BACSU      -------------------------------------------------
FADB_PSEFR      -------------------------------------------------
HIBCH_RAT       VKSKMGQDKSIIFEEHMDKINSCFSA-----------------------
ECI1_YEAST      -------------------------------------------------
FADJ_PHOLL      -------------------------------------------------
HIBCH_MOUSE     VKSKMDQDKSIIFEEHMDKINSCFSA-----------------------
DCI1_YEAST      MKELLHSEMKQKLIKAQAMETN---GTLPFWASGEPFKRFKQLQEGNRR
FADJ_PECCP      -------------------------------------------------
ECH17_MYCPA     -------------------------------------------------
ECH17_MYCA1     -------------------------------------------------
FADJ_ERWCT      -------------------------------------------------
FADN_BACSU      -------------------------------------------------
HIBCH_XENLA     -------------------------------------------------
FADB_PSEA7      -------------------------------------------------
HIBCH_HUMAN     -------------------------------------------------
FADJ_VIBF1      -------------------------------------------------
BOXC_AZOEV      -------------------------------------------------
FADJ_SERP5      -------------------------------------------------
SPPA_HAEIN      -------------------------------------------------