[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07913.1

[Show Plain Result]


## Summary of Sequence Search
    1::113
    3::107     6e-32  70%  107 aa  ISCA_XENNE RecName: Full=Iron-binding protein iscA;AltName:
    3::107     8e-32  56%  107 aa  ISCA_HAEIN RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-31  67%  107 aa  ISCA_YERPY RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-31  67%  107 aa  ISCA_YERPS RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-31  67%  107 aa  ISCA_YERPP RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-31  67%  107 aa  ISCA_YERPN RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-31  67%  107 aa  ISCA_YERPG RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-31  67%  107 aa  ISCA_YERPE RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-31  67%  107 aa  ISCA_YERPB RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-31  67%  107 aa  ISCA_YERPA RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-31  67%  107 aa  ISCA_YERP3 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     7e-31  68%  107 aa  ISCA_PHOLL RecName: Full=Iron-binding protein iscA;AltName:
    3::107     7e-31  54%  107 aa  ISCA_ENT38 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     9e-31  70%  107 aa  ISCA_EDWI9 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-30  56%  107 aa  ISCA_PROMH RecName: Full=Iron-binding protein iscA;AltName:
    3::107     3e-30  66%  107 aa  ISCA_SERP5 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     3e-30  67%  107 aa  ISCA_ERWCT RecName: Full=Iron-binding protein iscA;AltName:
    3::107     3e-30  54%  107 aa  ISCA_KLEP7 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     3e-30  54%  107 aa  ISCA_KLEP3 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     8e-30  65%  107 aa  ISCA_YERE8 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     8e-30  68%  107 aa  ISCA_PECCP RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_SHISS RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_SHIFL RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_SHIDS RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_SHIBS RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ESCF3 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECOSM RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECOSE RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECOLU RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECOLI RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECOLC RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECOL6 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECOL5 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECOK1 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECODH RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECOBW RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECO8A RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECO81 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECO7I RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECO57 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECO55 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECO45 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     5e-26  50%  107 aa  ISCA_ECO27 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     1e-25  50%  107 aa  ISCA_SALNS RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALTY RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALTI RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALSV RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALPK RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALPC RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALPB RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALPA RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALHS RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALG2 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALEP RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALDC RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALCH RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALAR RecName: Full=Iron-binding protein iscA;AltName:
    3::107     2e-25  50%  107 aa  ISCA_SALA4 RecName: Full=Iron-binding protein iscA;AltName:
    3::107     1e-24  49%  107 aa  ISCA_ENTS8 RecName: Full=Iron-binding protein iscA;AltName:
   18::122     1e-20  41%  122 aa  SUFA_ECOLI RecName: Full=Protein sufA;
    4::110     1e-17  38%  110 aa  Y484_RICPR RecName: Full=Uncharacterized protein RP484;
   19::124     4e-17  35%  137 aa  ISAM1_ARATH RecName: Full=Iron-sulfur assembly protein IscA-like 1,
  146::250     6e-17  40%  250 aa  ISA1_YEAST RecName: Full=Iron sulfur assembly protein 1;
    7::118     6e-16  34%  118 aa  Y1417_SYNY3 RecName: Full=Uncharacterized protein slr1417;
   72::176     1e-15  32%  180 aa  ISCAP_ARATH RecName: Full=Iron-sulfur assembly protein IscA,
   37::106     1e-15  49%  109 aa  ISAM3_ARATH RecName: Full=Iron-sulfur assembly protein IscA-like 3,
    8::112     2e-15  36%  114 aa  YCF83_PORYE RecName: Full=Uncharacterized protein ycf83;
   25::129     2e-15  31%  129 aa  ISCA1_CHICK RecName: Full=Iron-sulfur cluster assembly 1 homolog,
   25::129     3e-15  32%  129 aa  ISCA1_MOUSE RecName: Full=Iron-sulfur cluster assembly 1 homolog,
   38::109     3e-15  40%  121 aa  HESB_PLEBO RecName: Full=Protein hesB;
   25::129     4e-15  32%  129 aa  ISCA1_RAT RecName: Full=Iron-sulfur cluster assembly 1 homolog,
    1::105     5e-15  35%  107 aa  YNIU_AZOVI RecName: Full=Uncharacterized protein in nifU
   35::105     5e-15  44%  106 aa  Y1755_BRAJA RecName: Full=Uncharacterized protein blr1755;
   25::129     5e-15  31%  129 aa  ISCA1_MACFA RecName: Full=Iron-sulfur cluster assembly 1 homolog,
   25::129     5e-15  31%  129 aa  ISCA1_HUMAN RecName: Full=Iron-sulfur cluster assembly 1 homolog,
   25::129     5e-15  32%  129 aa  ISCA1_DANRE RecName: Full=Iron-sulfur cluster assembly 1 homolog,
   25::129     5e-15  31%  129 aa  ISCA1_BOVIN RecName: Full=Iron-sulfur cluster assembly 1 homolog,
   35::105     2e-14  42%  106 aa  YNIU_RHOSH RecName: Full=Uncharacterized protein in nifU
   40::112     2e-14  41%  123 aa  HESB_ANASP RecName: Full=Protein hesB;
   47::117     3e-14  42%  118 aa  Y2227_MYCBO RecName: Full=Protein Mb2227c;
   47::117     3e-14  42%  118 aa  Y2204_MYCTU RecName: Full=Protein Rv2204c/MT2260;
  116::186     3e-14  44%  190 aa  ISA1_SCHPO RecName: Full=Iron sulfur assembly protein 1;
   40::111     4e-14  39%  123 aa  HESB2_ANAVT RecName: Full=Protein hesB, vegetative;
   40::111     6e-14  40%  123 aa  HESB1_ANAVT RecName: Full=Protein hesB, heterocyst;
   56::128     8e-14  41%  128 aa  ERPA_XYLFM RecName: Full=Iron--sulfur cluster insertion protein
   15::128     1e-13  33%  129 aa  Y114_BUCAP RecName: Full=Uncharacterized protein BUsg_114;
   79::152     1e-13  41%  154 aa  ISCA2_MOUSE RecName: Full=Iron-sulfur cluster assembly 2 homolog,
   79::152     1e-13  40%  154 aa  ISCA2_PONAB RecName: Full=Iron-sulfur cluster assembly 2 homolog,
   79::152     1e-13  40%  154 aa  ISCA2_HUMAN RecName: Full=Iron-sulfur cluster assembly 2 homolog,
   77::150     2e-13  41%  152 aa  ISCA2_BOVIN RecName: Full=Iron-sulfur cluster assembly 2 homolog,
   56::128     2e-13  41%  128 aa  ERPA_XYLFT RecName: Full=Iron-sulfur cluster insertion protein
   56::128     2e-13  41%  128 aa  ERPA_XYLFA RecName: Full=Iron-sulfur cluster insertion protein
   56::128     2e-13  41%  128 aa  ERPA_XYLF2 RecName: Full=Iron--sulfur cluster insertion protein
   44::116     2e-13  45%  116 aa  ERPA_PSEU5 RecName: Full=Iron-sulfur cluster insertion protein
   44::116     2e-13  45%  116 aa  ERPA_PSEF5 RecName: Full=Iron-sulfur cluster insertion protein
    1::114     2e-13  38%  114 aa  ERPA_CITK8 RecName: Full=Iron--sulfur cluster insertion protein
   44::116     2e-13  45%  116 aa  ERPA_AZOVD RecName: Full=Iron--sulfur cluster insertion protein
   35::105     3e-13  38%  113 aa  Y1565_SYNY3 RecName: Full=Uncharacterized protein slr1565;
   18::128     3e-13  32%  130 aa  ERPA_STRMK RecName: Full=Iron--sulfur cluster insertion protein
   18::128     3e-13  32%  130 aa  ERPA_STRM5 RecName: Full=Iron--sulfur cluster insertion protein
    1::114     4e-13  36%  114 aa  ERPA_YERE8 RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-13  44%  116 aa  ERPA_PSEU2 RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-13  44%  116 aa  ERPA_PSESM RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-13  44%  116 aa  ERPA_PSEAE RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-13  44%  116 aa  ERPA_PSEAB RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-13  44%  116 aa  ERPA_PSEA8 RecName: Full=Iron--sulfur cluster insertion protein
   44::116     4e-13  44%  116 aa  ERPA_PSEA7 RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-13  44%  116 aa  ERPA_PSE14 RecName: Full=Iron-sulfur cluster insertion protein
    1::114     4e-13  38%  114 aa  ERPA_KLEP7 RecName: Full=Iron--sulfur cluster insertion protein
    1::114     4e-13  37%  114 aa  ERPA_ENT38 RecName: Full=Iron--sulfur cluster insertion protein
   44::114     4e-13  48%  116 aa  ERPA_AZOSE RecName: Full=Putative iron-sulfur cluster insertion
   44::116     5e-13  44%  116 aa  ERPA_PSEPK RecName: Full=Iron-sulfur cluster insertion protein
   44::116     5e-13  44%  116 aa  ERPA_PSEPF RecName: Full=Iron-sulfur cluster insertion protein
   44::116     5e-13  44%  116 aa  ERPA_PSEFS RecName: Full=Iron--sulfur cluster insertion protein
    1::114     5e-13  38%  114 aa  ERPA_KLEP3 RecName: Full=Iron--sulfur cluster insertion protein
   42::114     6e-13  46%  114 aa  ERPA_YERPY RecName: Full=Iron--sulfur cluster insertion protein
   42::114     6e-13  46%  114 aa  ERPA_YERPS RecName: Full=Iron-sulfur cluster insertion protein
   42::114     6e-13  46%  114 aa  ERPA_YERPP RecName: Full=Iron-sulfur cluster insertion protein
   42::114     6e-13  46%  114 aa  ERPA_YERPN RecName: Full=Iron-sulfur cluster insertion protein
   42::114     6e-13  46%  114 aa  ERPA_YERPG RecName: Full=Iron--sulfur cluster insertion protein
   42::114     6e-13  46%  114 aa  ERPA_YERPE RecName: Full=Iron-sulfur cluster insertion protein
   42::114     6e-13  46%  114 aa  ERPA_YERPB RecName: Full=Iron--sulfur cluster insertion protein
   42::114     6e-13  46%  114 aa  ERPA_YERPA RecName: Full=Iron-sulfur cluster insertion protein
   42::114     6e-13  46%  114 aa  ERPA_YERP3 RecName: Full=Iron--sulfur cluster insertion protein
   56::128     6e-13  40%  128 aa  ERPA_XANCP RecName: Full=Iron-sulfur cluster insertion protein
   56::128     6e-13  40%  128 aa  ERPA_XANCB RecName: Full=Iron--sulfur cluster insertion protein
   56::128     6e-13  40%  128 aa  ERPA_XANC8 RecName: Full=Iron-sulfur cluster insertion protein
   56::128     6e-13  40%  128 aa  ERPA_XANC5 RecName: Full=Iron-sulfur cluster insertion protein
   56::128     6e-13  40%  128 aa  ERPA_XANAC RecName: Full=Iron-sulfur cluster insertion protein
   44::116     6e-13  44%  116 aa  ERPA_PSEE4 RecName: Full=Iron-sulfur cluster insertion protein
   44::114     6e-13  46%  116 aa  ERPA_AZOSB RecName: Full=Putative iron-sulfur cluster insertion
   35::105     8e-13  39%  106 aa  YNIU_RHOCA RecName: Full=Uncharacterized protein in nifU
   43::102     8e-13  45%  116 aa  Y1857_AQUAE RecName: Full=Protein aq_1857;
   56::128     8e-13  40%  128 aa  ERPA_XANOR RecName: Full=Iron-sulfur cluster insertion protein
   56::128     8e-13  40%  128 aa  ERPA_XANOM RecName: Full=Iron-sulfur cluster insertion protein
   42::114     8e-13  46%  114 aa  ERPA_SODGM RecName: Full=Iron-sulfur cluster insertion protein
    1::114     8e-13  38%  114 aa  ERPA_SERP5 RecName: Full=Iron--sulfur cluster insertion protein
   51::123     8e-13  40%  123 aa  ERPA_HALHL RecName: Full=Iron-sulfur cluster insertion protein
   35::105     1e-12  42%  106 aa  Y4VC_RHISN RecName: Full=Uncharacterized protein y4vC;
   42::114     1e-12  46%  114 aa  ERPA_SHISS RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SHIFL RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SHIF8 RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SHIDS RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SHIBS RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SHIB3 RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALTY RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALTI RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALSV RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALPB RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALPA RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALNS RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALHS RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALG2 RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALEP RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALDC RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALCH RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALAR RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_SALA4 RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ESCF3 RecName: Full=Iron--sulfur cluster insertion protein
   43::115     1e-12  46%  115 aa  ERPA_ERWCT RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  45%  114 aa  ERPA_ENTS8 RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECOUT RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECOSM RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECOSE RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECOLU RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECOLI RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECOLC RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECOL6 RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECOL5 RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECOK1 RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECOHS RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECODH RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECOBW RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECO8A RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECO81 RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECO7I RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECO5E RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECO57 RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECO55 RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECO45 RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECO27 RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-12  46%  114 aa  ERPA_ECO24 RecName: Full=Iron--sulfur cluster insertion protein
   19::130     1e-12  32%  130 aa  ERPA2_METCA RecName: Full=Iron-sulfur cluster insertion protein
    1::114     1e-12  35%  114 aa  ERPA_HAEIN RecName: Full=Iron-sulfur cluster insertion protein
    1::114     1e-12  35%  114 aa  ERPA_HAEIG RecName: Full=Iron-sulfur cluster insertion protein
    1::114     1e-12  35%  114 aa  ERPA_HAEI8 RecName: Full=Iron-sulfur cluster insertion protein
   50::122     1e-12  37%  122 aa  ERPA_BORPD RecName: Full=Putative iron--sulfur cluster insertion
   39::111     2e-12  41%  112 aa  YCF83_GALSU RecName: Full=Uncharacterized protein ycf83;AltName:
   42::114     2e-12  46%  114 aa  ERPA_ERWT9 RecName: Full=Iron--sulfur cluster insertion protein
   44::116     2e-12  40%  116 aa  ERPA_SHEDO RecName: Full=Iron-sulfur cluster insertion protein
   43::115     2e-12  45%  115 aa  ERPA_PHOLL RecName: Full=Iron-sulfur cluster insertion protein
   41::113     2e-12  45%  113 aa  ERPA_HAES2 RecName: Full=Iron--sulfur cluster insertion protein
   41::113     2e-12  45%  113 aa  ERPA_HAES1 RecName: Full=Iron-sulfur cluster insertion protein
    1::114     2e-12  35%  114 aa  ERPA_HAEIE RecName: Full=Iron-sulfur cluster insertion protein
   55::109     3e-12  49%  120 aa  YUTM_BACSU RecName: Full=Uncharacterized protein yutM;
   52::122     3e-12  38%  124 aa  ERPA_POLSQ RecName: Full=Putative iron--sulfur cluster insertion
   45::117     3e-12  45%  117 aa  ERPA_HAHCH RecName: Full=Iron-sulfur cluster insertion protein
   44::116     3e-12  37%  116 aa  ERPA_FRATW RecName: Full=Iron-sulfur cluster insertion protein
   44::116     3e-12  37%  116 aa  ERPA_FRATT RecName: Full=Iron-sulfur cluster insertion protein
   44::116     3e-12  37%  116 aa  ERPA_FRATO RecName: Full=Iron-sulfur cluster insertion protein
   44::116     3e-12  37%  116 aa  ERPA_FRATN RecName: Full=Iron-sulfur cluster insertion protein
   44::116     3e-12  37%  116 aa  ERPA_FRATM RecName: Full=Iron--sulfur cluster insertion protein
   44::116     3e-12  37%  116 aa  ERPA_FRATH RecName: Full=Iron-sulfur cluster insertion protein
   44::116     3e-12  37%  116 aa  ERPA_FRATF RecName: Full=Iron-sulfur cluster insertion protein
   44::116     3e-12  37%  116 aa  ERPA_FRAT1 RecName: Full=Iron-sulfur cluster insertion protein
   44::114     3e-12  45%  116 aa  ERPA_DECAR RecName: Full=Putative iron-sulfur cluster insertion
   51::123     3e-12  37%  123 aa  ERPA_BORA1 RecName: Full=Putative iron-sulfur cluster insertion
   53::125     3e-12  44%  125 aa  ERPA2_POLNA RecName: Full=Putative iron-sulfur cluster insertion
   44::116     4e-12  42%  116 aa  ERPA_PSEMY RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-12  36%  116 aa  ERPA_FRAP2 RecName: Full=Iron--sulfur cluster insertion protein
   51::123     4e-12  37%  123 aa  ERPA_BORPE RecName: Full=Putative iron-sulfur cluster insertion
   51::123     4e-12  37%  123 aa  ERPA_BORPA RecName: Full=Putative iron-sulfur cluster insertion
   51::123     4e-12  37%  123 aa  ERPA_BORBR RecName: Full=Putative iron-sulfur cluster insertion
   54::126     5e-12  38%  128 aa  Y116_BUCBP RecName: Full=Uncharacterized protein bbp_116;
   41::113     5e-12  36%  113 aa  ERPA_THICR RecName: Full=Iron-sulfur cluster insertion protein
    8::113     5e-12  36%  113 aa  ERPA_MANSM RecName: Full=Iron-sulfur cluster insertion protein
   42::114     5e-12  46%  114 aa  ERPA_EDWI9 RecName: Full=Iron--sulfur cluster insertion protein
   50::122     5e-12  38%  122 aa  ERPA_ALHEH RecName: Full=Iron-sulfur cluster insertion protein
   41::113     9e-12  45%  113 aa  ERPA_VIBFM RecName: Full=Iron--sulfur cluster insertion protein
   41::113     9e-12  45%  113 aa  ERPA_VIBF1 RecName: Full=Iron-sulfur cluster insertion protein
   41::113     9e-12  46%  113 aa  ERPA_PHOPR RecName: Full=Iron-sulfur cluster insertion protein
   55::127     9e-12  36%  127 aa  ERPA_NITMU RecName: Full=Putative iron-sulfur cluster insertion
   45::117     9e-12  44%  117 aa  ERPA_BLOPB RecName: Full=Iron-sulfur cluster insertion protein
   47::119     9e-12  49%  119 aa  ERPA_BLOFL RecName: Full=Iron-sulfur cluster insertion protein
   11::116     9e-12  36%  116 aa  ERPA_AERS4 RecName: Full=Iron-sulfur cluster insertion protein
   18::124     9e-12  36%  124 aa  ERPA2_BURXL RecName: Full=Putative iron-sulfur cluster insertion
   51::123     9e-12  36%  123 aa  ERPA1_BURVG RecName: Full=Putative iron-sulfur cluster insertion
   41::113     1e-11  46%  113 aa  ERPA_VIBVY RecName: Full=Iron-sulfur cluster insertion protein
   41::113     1e-11  46%  113 aa  ERPA_VIBVU RecName: Full=Iron-sulfur cluster insertion protein
   45::117     1e-11  36%  117 aa  ERPA_RUTMC RecName: Full=Iron-sulfur cluster insertion protein
   42::114     1e-11  44%  114 aa  ERPA_PASMU RecName: Full=Iron-sulfur cluster insertion protein
   49::121     1e-11  37%  121 aa  ERPA_NITEU RecName: Full=Putative iron-sulfur cluster insertion
   51::123     1e-11  36%  123 aa  ERPA_BURS3 RecName: Full=Putative iron-sulfur cluster insertion
   41::113     2e-11  46%  113 aa  ERPA_VIBPA RecName: Full=Iron-sulfur cluster insertion protein
   42::114     2e-11  44%  114 aa  ERPA_PROMH RecName: Full=Iron--sulfur cluster insertion protein
   41::113     2e-11  36%  113 aa  ERPA_COLP3 RecName: Full=Iron-sulfur cluster insertion protein
   51::123     2e-11  36%  123 aa  ERPA_BURM1 RecName: Full=Putative iron--sulfur cluster insertion
   51::123     2e-11  36%  123 aa  ERPA_BURCM RecName: Full=Putative iron-sulfur cluster insertion
   51::123     2e-11  36%  123 aa  ERPA_BURCJ RecName: Full=Putative iron--sulfur cluster insertion
   51::123     2e-11  36%  123 aa  ERPA_BURCH RecName: Full=Putative iron-sulfur cluster insertion
   51::123     2e-11  36%  123 aa  ERPA_BURCC RecName: Full=Putative iron--sulfur cluster insertion
   51::123     2e-11  36%  123 aa  ERPA_BURCA RecName: Full=Putative iron-sulfur cluster insertion
   51::123     2e-11  36%  123 aa  ERPA_BURA4 RecName: Full=Putative iron--sulfur cluster insertion
   11::116     2e-11  36%  116 aa  ERPA_AERHH RecName: Full=Iron-sulfur cluster insertion protein
   41::113     2e-11  42%  113 aa  ERPA_ACTPJ RecName: Full=Iron--sulfur cluster insertion protein
   42::112     2e-11  42%  115 aa  ERPA_BAUCH RecName: Full=Iron-sulfur cluster insertion protein
   41::113     2e-11  46%  113 aa  ERPA_ALISL RecName: Full=Iron--sulfur cluster insertion protein
    8::113     3e-11  39%  113 aa  ERPA_VIBCM RecName: Full=Iron--sulfur cluster insertion protein
    8::113     3e-11  39%  113 aa  ERPA_VIBCH RecName: Full=Iron-sulfur cluster insertion protein
    8::113     3e-11  39%  113 aa  ERPA_VIBC3 RecName: Full=Iron-sulfur cluster insertion protein
   11::116     3e-11  34%  116 aa  ERPA_SHEPW RecName: Full=Iron--sulfur cluster insertion protein
   44::116     3e-11  37%  116 aa  ERPA_SHEHH RecName: Full=Iron--sulfur cluster insertion protein
   44::116     3e-11  38%  116 aa  ERPA_SHEFN RecName: Full=Iron-sulfur cluster insertion protein
    7::116     3e-11  36%  116 aa  ERPA_IDILO RecName: Full=Iron-sulfur cluster insertion protein
   50::122     3e-11  37%  122 aa  ERPA_BURTA RecName: Full=Putative iron-sulfur cluster insertion
   50::122     3e-11  37%  122 aa  ERPA_BURPS RecName: Full=Putative iron-sulfur cluster insertion
   50::122     3e-11  37%  122 aa  ERPA_BURP6 RecName: Full=Putative iron-sulfur cluster insertion
   50::122     3e-11  37%  122 aa  ERPA_BURP1 RecName: Full=Putative iron-sulfur cluster insertion
   50::122     3e-11  37%  122 aa  ERPA_BURP0 RecName: Full=Putative iron-sulfur cluster insertion
   50::122     3e-11  37%  122 aa  ERPA_BURMS RecName: Full=Putative iron-sulfur cluster insertion
   50::122     3e-11  37%  122 aa  ERPA_BURMA RecName: Full=Putative iron-sulfur cluster insertion
   50::122     3e-11  37%  122 aa  ERPA_BURM9 RecName: Full=Putative iron-sulfur cluster insertion
   50::122     3e-11  37%  122 aa  ERPA_BURM7 RecName: Full=Putative iron-sulfur cluster insertion
   47::119     3e-11  34%  119 aa  ERPA_ALCBS RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-11  38%  116 aa  ERPA_SHESW RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-11  38%  116 aa  ERPA_SHESR RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-11  38%  116 aa  ERPA_SHESM RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-11  38%  116 aa  ERPA_SHESA RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-11  38%  116 aa  ERPA_SHEPC RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-11  38%  116 aa  ERPA_SHEPA RecName: Full=Iron--sulfur cluster insertion protein
   44::116     4e-11  38%  116 aa  ERPA_SHEON RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-11  38%  116 aa  ERPA_SHELP RecName: Full=Iron-sulfur cluster insertion protein
   44::116     4e-11  38%  116 aa  ERPA_SHEAM RecName: Full=Iron-sulfur cluster insertion protein
   20::126     4e-11  33%  126 aa  ERPA_PSYCK RecName: Full=Iron-sulfur cluster insertion protein
   20::126     4e-11  33%  126 aa  ERPA_PSYA2 RecName: Full=Iron-sulfur cluster insertion protein
   45::115     4e-11  34%  117 aa  ERPA_METFK RecName: Full=Putative iron-sulfur cluster insertion
   41::113     4e-11  42%  113 aa  ERPA_ACTSZ RecName: Full=Iron-sulfur cluster insertion protein
   42::114     5e-11  45%  114 aa  ERPA_PSEA6 RecName: Full=Iron-sulfur cluster insertion protein
    9::114     5e-11  34%  114 aa  ERPA_HAEDU RecName: Full=Iron-sulfur cluster insertion protein
   52::124     6e-11  45%  124 aa  ERPA_VIBSL RecName: Full=Iron--sulfur cluster insertion protein
   44::116     6e-11  38%  116 aa  ERPA_SHEB9 RecName: Full=Iron--sulfur cluster insertion protein
   44::116     6e-11  38%  116 aa  ERPA_SHEB8 RecName: Full=Iron-sulfur cluster insertion protein
   44::116     6e-11  38%  116 aa  ERPA_SHEB5 RecName: Full=Iron-sulfur cluster insertion protein
   44::116     6e-11  38%  116 aa  ERPA_SHEB2 RecName: Full=Iron--sulfur cluster insertion protein
   50::122     6e-11  34%  122 aa  ERPA_RALEJ RecName: Full=Putative iron-sulfur cluster insertion
   50::122     6e-11  34%  122 aa  ERPA_RALEH RecName: Full=Putative iron-sulfur cluster insertion
   46::116     6e-11  37%  118 aa  ERPA_PSYIN RecName: Full=Iron-sulfur cluster insertion protein
   49::121     6e-11  39%  121 aa  ERPA_NITEC RecName: Full=Putative iron-sulfur cluster insertion
   50::122     6e-11  34%  122 aa  ERPA_CUPTR RecName: Full=Putative iron--sulfur cluster insertion
   36::110     8e-11  41%  110 aa  Y063_RICPR RecName: Full=Uncharacterized protein RP063;
   41::113     8e-11  45%  113 aa  ERPA_VIBHB RecName: Full=Iron-sulfur cluster insertion protein
   45::117     8e-11  36%  117 aa  ERPA_CHRVO RecName: Full=Putative iron-sulfur cluster insertion
   41::113     8e-11  39%  113 aa  ERPA_ACTP7 RecName: Full=Iron--sulfur cluster insertion protein
   41::113     8e-11  39%  113 aa  ERPA_ACTP2 RecName: Full=Iron-sulfur cluster insertion protein
   13::123     1e-10  32%  139 aa  ISCA1_DICDI RecName: Full=Iron-sulfur cluster assembly 1 homolog,
   45::117     1e-10  33%  117 aa  ERPA_VESOH RecName: Full=Iron-sulfur cluster insertion protein
   38::110     1e-10  39%  110 aa  ERPA_MARAV RecName: Full=Iron-sulfur cluster insertion protein
   50::122     1e-10  33%  122 aa  ERPA_RALME RecName: Full=Putative iron-sulfur cluster insertion
   45::117     1e-10  37%  117 aa  ERPA_CHRSD RecName: Full=Iron-sulfur cluster insertion protein
   49::121     1e-10  34%  121 aa  ERPA_BURPP RecName: Full=Putative iron--sulfur cluster insertion
   42::114     1e-10  33%  114 aa  ERPA_BUCAT RecName: Full=Iron--sulfur cluster insertion protein
   42::114     1e-10  33%  114 aa  ERPA_BUCA5 RecName: Full=Iron--sulfur cluster insertion protein
   49::121     1e-10  34%  121 aa  ERPA1_BURXL RecName: Full=Putative iron-sulfur cluster insertion
   40::112     2e-10  36%  112 aa  ERPA_NEIMF RecName: Full=Putative iron-sulfur cluster insertion
   40::112     2e-10  36%  112 aa  ERPA_NEIMB RecName: Full=Putative iron-sulfur cluster insertion
   40::112     2e-10  36%  112 aa  ERPA_NEIMA RecName: Full=Putative iron-sulfur cluster insertion
   40::112     2e-10  36%  112 aa  ERPA_NEIG1 RecName: Full=Putative iron-sulfur cluster insertion
   49::121     2e-10  33%  121 aa  ERPA_BURP8 RecName: Full=Putative iron--sulfur cluster insertion
   13::122     2e-10  33%  124 aa  ERPA_ACIF5 RecName: Full=Iron--sulfur cluster insertion protein
   13::122     2e-10  33%  124 aa  ERPA_ACIF2 RecName: Full=Iron--sulfur cluster insertion protein
   83::156     3e-10  37%  158 aa  ISAM2_ARATH RecName: Full=Iron-sulfur assembly protein IscA-like 2,
   41::113     3e-10  38%  113 aa  ERPA_HAEPS RecName: Full=Iron--sulfur cluster insertion protein
   42::114     3e-10  33%  114 aa  ERPA_BUCAI RecName: Full=Iron-sulfur cluster insertion protein
   16::121     3e-10  33%  124 aa  ERPA_ACISJ RecName: Full=Putative iron-sulfur cluster insertion
   42::114     4e-10  33%  114 aa  ERPA_BUCAP RecName: Full=Iron-sulfur cluster insertion protein
   39::111     4e-10  41%  111 aa  ERPA_ACIBY RecName: Full=Iron--sulfur cluster insertion protein
   39::111     4e-10  41%  111 aa  ERPA_ACIBT RecName: Full=Iron-sulfur cluster insertion protein
   39::111     4e-10  41%  111 aa  ERPA_ACIBC RecName: Full=Iron--sulfur cluster insertion protein
   39::111     4e-10  41%  111 aa  ERPA_ACIB5 RecName: Full=Iron--sulfur cluster insertion protein
   39::111     4e-10  41%  111 aa  ERPA_ACIB3 RecName: Full=Iron--sulfur cluster insertion protein
   47::132     5e-10  39%  134 aa  ERPA_COXBU RecName: Full=Iron-sulfur cluster insertion protein
   47::132     5e-10  39%  134 aa  ERPA_COXBR RecName: Full=Iron--sulfur cluster insertion protein
   39::111     5e-10  39%  111 aa  ERPA_ACIBS RecName: Full=Iron--sulfur cluster insertion protein
   49::121     5e-10  38%  121 aa  ERPA_ACIAC RecName: Full=Putative iron-sulfur cluster insertion
   16::119     7e-10  32%  121 aa  ERPA_VEREI RecName: Full=Putative iron-sulfur cluster insertion
   40::112     7e-10  41%  112 aa  ERPA_PSEHT RecName: Full=Iron-sulfur cluster insertion protein
   52::124     7e-10  32%  124 aa  ERPA_DELAS RecName: Full=Putative iron--sulfur cluster insertion
   47::132     7e-10  39%  134 aa  ERPA_COXBN RecName: Full=Iron--sulfur cluster insertion protein
   44::114     9e-10  42%  116 aa  ERPA_THIDA RecName: Full=Putative iron-sulfur cluster insertion
   39::111     9e-10  41%  111 aa  ERPA_ACIAD RecName: Full=Iron-sulfur cluster insertion protein
   44::114     1e-09  32%  116 aa  ERPA_JANMA RecName: Full=Putative iron-sulfur cluster insertion
   44::114     1e-09  32%  116 aa  ERPA_HERAR RecName: Full=Putative iron-sulfur cluster insertion
   49::119     1e-09  37%  120 aa  ERPA_RHOFD RecName: Full=Putative iron-sulfur cluster insertion
   49::119     2e-09  37%  121 aa  ERPA_POLSJ RecName: Full=Putative iron-sulfur cluster insertion
   44::114     3e-09  41%  116 aa  ERPA_NITOC RecName: Full=Iron-sulfur cluster insertion protein
   46::124     3e-09  33%  130 aa  ERPA_LEGPL RecName: Full=Iron-sulfur cluster insertion protein
   46::124     3e-09  33%  130 aa  ERPA_LEGPH RecName: Full=Iron-sulfur cluster insertion protein
   42::114     4e-09  36%  114 aa  ERPA_HAMD5 RecName: Full=Iron--sulfur cluster insertion protein
   45::117     6e-09  41%  117 aa  ERPA_SACD2 RecName: Full=Iron-sulfur cluster insertion protein
    2::112     1e-08  26%  114 aa  YCF83_PORPU RecName: Full=Uncharacterized protein ycf83;AltName:
   42::114     1e-08  32%  114 aa  ERPA_WIGBR RecName: Full=Iron-sulfur cluster insertion protein
  131::204     3e-08  34%  205 aa  ISA2_SCHPO RecName: Full=Iron sulfur assembly protein 2;
   47::106     3e-08  45%  128 aa  ERPA1_METCA RecName: Full=Iron-sulfur cluster insertion protein
   52::124     4e-08  30%  124 aa  ERPA_RALPJ RecName: Full=Putative iron--sulfur cluster insertion
   52::124     5e-08  30%  124 aa  ERPA_RALSO RecName: Full=Putative iron-sulfur cluster insertion
   77::124     2e-07  38%  130 aa  ERPA_LEGPC RecName: Full=Iron-sulfur cluster insertion protein
   77::124     2e-07  38%  130 aa  ERPA_LEGPA RecName: Full=Iron-sulfur cluster insertion protein
   44::116     3e-07  32%  116 aa  ERPA_ALTMD RecName: Full=Iron--sulfur cluster insertion protein
   52::124     7e-07  35%  124 aa  ERPA2_BURVG RecName: Full=Putative iron-sulfur cluster insertion
   36::104     2e-06  32%  125 aa  YNIU_AZOBR RecName: Full=Uncharacterized protein in nifU
   49::108     2e-06  32%  121 aa  ERPA_METPP RecName: Full=Putative iron-sulfur cluster insertion
    5::103     6e-06  29%  135 aa  YNIU_FRAAL RecName: Full=Uncharacterized protein in nifB-nifU
   47::97      4e-05  33%  192 aa  NFUA_SHESH RecName: Full=Fe/S biogenesis protein nfuA;
   49::108     5e-05  34%  121 aa  ERPA1_POLNA RecName: Full=Putative iron-sulfur cluster insertion
    1::97      6e-05  25%  192 aa  NFUA_TOLAT RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      6e-05  33%  192 aa  NFUA_SHEHH RecName: Full=Fe/S biogenesis protein nfuA;
    1::97      6e-05  26%  192 aa  NFUA_AERS4 RecName: Full=Fe/S biogenesis protein nfuA;
    1::97      6e-05  26%  192 aa  NFUA_AERHH RecName: Full=Fe/S biogenesis protein nfuA;
    9::104     1e-04  27%  199 aa  NFUA_ACTPJ RecName: Full=Fe/S biogenesis protein nfuA;
    9::104     1e-04  27%  199 aa  NFUA_ACTP7 RecName: Full=Fe/S biogenesis protein nfuA;
    9::104     1e-04  27%  199 aa  NFUA_ACTP2 RecName: Full=Fe/S biogenesis protein nfuA;
    1::97      1e-04  24%  192 aa  NFUA_PSEA6 RecName: Full=Fe/S biogenesis protein nfuA;
    1::97      1e-04  27%  192 aa  NFUA_ALTMD RecName: Full=Fe/S biogenesis protein nfuA;
   39::111     1e-04  27%  111 aa  ERPA_BUCCC RecName: Full=Iron-sulfur cluster insertion protein
   47::97      2e-04  31%  192 aa  NFUA_SHEWM RecName: Full=Fe/S biogenesis protein nfuA;
    1::97      2e-04  25%  192 aa  NFUA_SHEDO RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      3e-04  31%  192 aa  NFUA_SHEPW RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      3e-04  31%  192 aa  NFUA_SHEPA RecName: Full=Fe/S biogenesis protein nfuA;
   76::115     3e-04  38%  115 aa  ERPA_BUCBP RecName: Full=Iron-sulfur cluster insertion protein
   47::97      4e-04  31%  192 aa  NFUA_SHESR RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      4e-04  31%  192 aa  NFUA_SHESM RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      4e-04  31%  192 aa  NFUA_SHESA RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      4e-04  31%  192 aa  NFUA_SHELP RecName: Full=Fe/S biogenesis protein nfuA;
    1::97      4e-04  25%  191 aa  NFUA_PSEHT RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      5e-04  31%  192 aa  NFUA_SHESW RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      5e-04  31%  192 aa  NFUA_SHEPC RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      5e-04  27%  192 aa  NFUA_IDILO RecName: Full=Fe/S biogenesis protein nfuA;
    1::97      5e-04  25%  191 aa  NFUA_EDWI9 RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      7e-04  33%  191 aa  NFUA_PECCP RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      0.001  31%  192 aa  NFUA_SHEB9 RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      0.001  31%  192 aa  NFUA_SHEB8 RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      0.001  31%  192 aa  NFUA_SHEB5 RecName: Full=Fe/S biogenesis protein nfuA;
   47::97      0.001  31%  192 aa  NFUA_SHEB2 RecName: Full=Fe/S biogenesis protein nfuA;
    1::97      0.001  24%  192 aa  NFUA_PROMH RecName: Full=Fe/S biogenesis protein nfuA;
    1::113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFDSKAKMISMTEKAAKHVARYLEXXXXXXXXXXXXXXXXCSGLAYKLEYVDEVLPEDQVFETHGIKVIV
ISCA_XENNE      --------ISLTESAAQRIVAFLDNXXXXXXXXXXXXTSGCSGMAYVLEFADVVNEEDQVFEDKGVKVIV
ISCA_HAEIN      --------ITLTEKAAQRVKAFLDNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFEQYGVNIIV
ISCA_YERPY      --------ISISDSAAQRVSAFLNHXXXXXXXXXXXXTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVII
ISCA_YERPS      --------ISISDSAAQRVSAFLNHXXXXXXXXXXXXTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVII
ISCA_YERPP      --------ISISDSAAQRVSAFLNHXXXXXXXXXXXXTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVII
ISCA_YERPN      --------ISISDSAAQRVSAFLNHXXXXXXXXXXXXTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVII
ISCA_YERPG      --------ISISDSAAQRVSAFLNHXXXXXXXXXXXXTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVII
ISCA_YERPE      --------ISISDSAAQRVSAFLNHXXXXXXXXXXXXTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVII
ISCA_YERPB      --------ISISDSAAQRVSAFLNHXXXXXXXXXXXXTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVII
ISCA_YERPA      --------ISISDSAAQRVSAFLNHXXXXXXXXXXXXTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVII
ISCA_YERP3      --------ISISDSAAQRVSAFLNHXXXXXXXXXXXXTSGCSGMAYVLEFVDEINDDDIVFEDKGVKVII
ISCA_PHOLL      --------ISLTESAAQRVSSFLSHXXXXXXXXXXXXTSGCSGMAYLLEFADMINEDDTVFEDKGVKVIV
ISCA_ENT38      --------ITLSDSAAARVSSFLENRGKGYGLRLGVRTSGCSGMAYVLEFVDEPATDDTVFEDKGVKVVI
ISCA_EDWI9      --------ITMSDSAAKRVQTFXXXXXXXXXXXXXXXXSGCSGMAYVLEFVDVLNEDDVVFEDQGVKVIV
ISCA_PROMH      --------ISLTEAAANRVRSFLANRGKGEGLRLGVRTSGCSGMAYVLEFADVINDEDTVFEDKGVKVII
ISCA_SERP5      --------ITMSDSAAQRVQAFMNNXXXXXXXXXXXXTSGCSGMAYVLEFVDDMNDDDIVFENKGVKVII
ISCA_ERWCT      --------ISLSESAAQRVSAFIANXXXXXXXXXXXXTSGCSGMAYVLEFVDDLNDGDTVFEDKGVKVIV
ISCA_KLEP7      --------ITLSDSAAARVNAFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPAAEDTVFEDKGVKVVI
ISCA_KLEP3      --------ITLSDSAAARVNSFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPAAEDTVFEDKGVKVVI
ISCA_YERE8      --------ISISDSAAQRVSAFXXXXXXXXXXXXXVRTSGCSGMAYILEFVDEMNDDDIVFEDKGVKVII
ISCA_PECCP      --------ISLSESAAQRVSAFIANXXXXXXXXXXXXTSGCSGMAYVLEFVDDLNDGDTVFEDKGIKVIV
ISCA_SHISS      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_SHIFL      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_SHIDS      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_SHIBS      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ESCF3      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECOSM      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECOSE      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECOLU      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECOLI      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECOLC      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECOL6      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECOL5      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECOK1      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECODH      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECOBW      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECO8A      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECO81      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECO7I      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECO57      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECO55      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECO45      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_ECO27      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEXXXXXXXX
ISCA_SALNS      --------ITLSDSAAARVNIFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPMAEDTVFEXXXXXXXX
ISCA_SALTY      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALTI      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALSV      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALPK      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALPC      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALPB      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALPA      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALHS      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALG2      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALEP      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALDC      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALCH      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALAR      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_SALA4      --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEXXXXXXXX
ISCA_ENTS8      --------ITLSDTAAARVNAFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDAPQPEDTVFEXXXXXXXX
SUFA_ECOLI      --------LTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFEHDGAKLFV
Y484_RICPR      -------VISLTDAAAKQVKLLIEKRAKPTFGIRVGIKSGCAGQTYYVEYADNKNQFDEVVEEKGVRILI
ISAM1_ARATH     ----RKQVLTLTDEAASRVHHLLQQRQKPFLRLGVKARG-CNGLSYTLNYADEKGKFDELVEEKGVRILV
ISA1_YEAST      -------LITLSPKAIKHL-RALLAQPEPKLIRVSARNRGCSGLTYDLQYITEPGKFDEVVEQDGVKIVI
Y1417_SYNY3     ---TQAKGIQLSDAALKHLLALKEQQGKDLCLRVGVRQGGCSGMSYMMDFEERATEHDEVFDYEGFQIIC
ISCAP_ARATH     --------ISLSENALKHLSKMRSERGEDLCLRIGVKQGGCSGMSYTMDFENRARPDDSTIEYQGFTIVC
ISAM3_ARATH     ----------------------------------------CNGLSYVLNYAQEKGKFDEVVEEKGVKILV
YCF83_PORYE     --------ITITKPALKQIAILKNDHENDVHLRIGVRQGGCSGMSYSMEHVDKLKDTDERLRLDNFSVVC
ISCA1_CHICK     --------LTLTPSAVQKIKQLLKDQPEHVGVKVGVRTRGCNGLSYTLEYTKSKGDSDEEVVQDGVRVFI
ISCA1_MOUSE     --------LTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYSLEYTKTKGDSDEEVIQDGVRVFI
HESB_PLEBO      ----------------------------------------CSGYQYTLDIANEPKPDDVIEQQGRVKIYI
ISCA1_RAT       --------LTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYSLEYTKTKGDADEEVIQDGVRVFI
YNIU_AZOVI      -------MITLTESAKSAVTRFISSTGKPIAGLRIRVEGGCSGLKYSLKLEEAGAEDDQLVDCDGITLLI
Y1755_BRAJA     ----------------------------------------CNGFKYKMGIADEPKPDDTVIDCDGLKVFV
ISCA1_MACFA     --------LTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFI
ISCA1_HUMAN     --------LTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFI
ISCA1_DANRE     --------LTLTPSAVNKVKQLLDNKPEYIGLKVGVRTRGCNGLTYTLDYTKNKEQSDEEVLQDGVRVFI
ISCA1_BOVIN     --------LTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFI
YNIU_RHOSH      ----------------------------------------CAGLKYGMSLELTEAPDDLVVEAEGLRVLI
HESB_ANASP      ----------------------------------------CSGYEYLMDVTSQPQPDDLVTQQGSVLVYV
Y2227_MYCBO     ----------------------------------------CAGLRYNLFFDDRTLDGDQTAEFGGVRLIV
Y2204_MYCTU     ----------------------------------------CAGLRYNLFFDDRTLDGDQTAEFGGVRLIV
ISA1_SCHPO      ----------------------------------------CAGQAYSLEYIEKPDKFDEIVKQDGISIIV
HESB2_ANAVT     ----------------------------------------CSGYQYSIKIINAPQADDMVLQQGKLRIYV
HESB1_ANAVT     ----------------------------------------CSGYEYLMDVTSQPQPDDLVSQQGSVLVYV
ERPA_XYLFM      ----------------------------------------CSGFQYGFEFDENRADDDLVLETDGVVLLV
Y114_BUCAP      ----KWKGIKITEQAIEQILFLINKNPKNKGIRIGTKKSGCAGFRYTMELVKNNTIEDIVFYYNNILVYI
ISCA2_MOUSE     ----------------------------------------CSGFQYKFSLDTVINPDDRVFEQGGARVVV
ISCA2_PONAB     ----------------------------------------CSGFQYKFSLDTVINPDDRVFEQGGARVVV
ISCA2_HUMAN     ----------------------------------------CSGFQYKFSLDTVINPDDRVFEQGGARVVV
ISCA2_BOVIN     ----------------------------------------CSGFQYKFSLDTVINPDDRVFEKGGARVVV
ERPA_XYLFT      ----------------------------------------CSGFQYGFEFDENRADDDLALETDGVVLLV
ERPA_XYLFA      ----------------------------------------CSGFQYGFEFDENRADDDLALETDGVVLLV
ERPA_XYLF2      ----------------------------------------CSGFQYGFEFDENRADDDLALETDGVVLLV
ERPA_PSEU5      ----------------------------------------CSGFQYGFTFDEDVADDDTVIEREGVSLVV
ERPA_PSEF5      ----------------------------------------CSGFQYGFTFDEEVAEDDTIVEREGVSLVV
ERPA_CITK8      MSDDVALPLQFTEAAAKKVKSLIDEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_AZOVD      ----------------------------------------CSGFQYGFTFDEDVAEDDTIVEREGVSLVV
Y1565_SYNY3     ----------------------------------------CAGWLYHLDFVPEITADDLEYESGGVTVLV
ERPA_STRMK      -YQSLERPLNFTESAAAKVKSLIEEGNPDLALRVYIEGGGCSGFQYGFEFDENRAEDDLAVQTSGVTLLV
ERPA_STRM5      -YQSLERPLNFTESAAAKVKSLIEEGNLDLALRVYIEGGGCSGFQYGFEFDENRAEDDLAVQTSGVTLLV
ERPA_YERE8      MSDETVLPLQFTEAAAKKVKLLIDEENPNLKLRVYITGGGCSGFQYGFTFDDQINDGDMTIEKQGVELVV
ERPA_PSEU2      ----------------------------------------CSGFQYGFTFDEDVADDDTIVEREGVSLVV
ERPA_PSESM      ----------------------------------------CSGFQYGFTFDEDVADDDTIVEREGVSLVV
ERPA_PSEAE      ----------------------------------------CSGFQYGFTFDEDIADDDTVIERDGVGLVV
ERPA_PSEAB      ----------------------------------------CSGFQYGFTFDEDIADDDTVIERDGVGLVV
ERPA_PSEA8      ----------------------------------------CSGFQYGFTFDEDIADDDTVIERDGVGLVV
ERPA_PSEA7      ----------------------------------------CSGFQYGFTFDEDIADDDTVIERDGVGLVV
ERPA_PSE14      ----------------------------------------CSGFQYGFTFDEDVADDDTIVEREGVSLVV
ERPA_KLEP7      MSDDVALPLEFTEAAANKVKHLIDEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ENT38      MSDDVALPLQFTEAAAKKVKVLIDENNPELKLRVYITGGGCSGFQYGFTFDDQINDGDMTIEKQGVALVV
ERPA_AZOSE      ----------------------------------------CSGFQYGFTFDEEVNEDDTAFEKNGVTLLV
ERPA_PSEPK      ----------------------------------------CSGFQYGFTFDEDVAEDDTIVEREGVSLVV
ERPA_PSEPF      ----------------------------------------CSGFQYGFTFDEDVAEDDTIVEREGVSLVV
ERPA_PSEFS      ----------------------------------------CSGFQYGFTFDEDVADDDTIVEREGVSLVV
ERPA_KLEP3      MSDDVALPLEFTEAAANKVKHLIDEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_YERPY      ----------------------------------------CSGFQYGFTFDDQVNDGDMTIEKQGVELVV
ERPA_YERPS      ----------------------------------------CSGFQYGFTFDDQVNDGDMTIEKQGVELVV
ERPA_YERPP      ----------------------------------------CSGFQYGFTFDDQVNDGDMTIEKQGVELVV
ERPA_YERPN      ----------------------------------------CSGFQYGFTFDDQVNDGDMTIEKQGVELVV
ERPA_YERPG      ----------------------------------------CSGFQYGFTFDDQVNDGDMTIEKQGVELVV
ERPA_YERPE      ----------------------------------------CSGFQYGFTFDDQVNDGDMTIEKQGVELVV
ERPA_YERPB      ----------------------------------------CSGFQYGFTFDDQVNDGDMTIEKQGVELVV
ERPA_YERPA      ----------------------------------------CSGFQYGFTFDDQVNDGDMTIEKQGVELVV
ERPA_YERP3      ----------------------------------------CSGFQYGFTFDDQVNDGDMTIEKQGVELVV
ERPA_XANCP      ----------------------------------------CSGFQYGFEFDENRAEDDLAVATDGVTLLV
ERPA_XANCB      ----------------------------------------CSGFQYGFEFDENRAEDDLAVATDGVTLLV
ERPA_XANC8      ----------------------------------------CSGFQYGFEFDENRAEDDLAVATDGVTLLV
ERPA_XANC5      ----------------------------------------CSGFQYGFEFDENRAEDDLAVATDGVTLLV
ERPA_XANAC      ----------------------------------------CSGFQYGFEFDENRAEDDLAVATDGVTLLV
ERPA_PSEE4      ----------------------------------------CSGFQYGFTFDEDVAEDDTIVEREGVALVV
ERPA_AZOSB      ----------------------------------------CSGFQYGFTFDEEVNEDDTAFEKNGVTLLI
YNIU_RHOCA      ----------------------------------------CAGLKYGMALELEAQPDDASLTFGEVTVLI
Y1857_AQUAE     ----------------------------------------CSGFQYAMGFDDTVEEGDHVFEYDGVKVVI
ERPA_XANOR      ----------------------------------------CSGFQYGFEFDENRAEDDLAVVTDGVTLLV
ERPA_XANOM      ----------------------------------------CSGFQYGFEFDENRAEDDLAVVTDGVTLLV
ERPA_SODGM      ----------------------------------------CSGFQYGFTFDDKVNEDDFTIEKQGVALVV
ERPA_SERP5      MSDETALPLQFTEAAASKVKVLIDEENPDLKLRVYITGGGCSGFQYGFTFDDKVNDGDMTIEKQGVALVV
ERPA_HALHL      ----------------------------------------CSGFQYGFTFDETVEEGDTIIEKRGVKIVV
Y4VC_RHISN      ----------------------------------------CSGFKYHLGLDSESRDGDAVIEAGGVKVYV
ERPA_SHISS      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SHIFL      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SHIF8      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SHIDS      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SHIBS      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SHIB3      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALTY      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALTI      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALSV      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALPB      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALPA      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALNS      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALHS      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALG2      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALEP      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALDC      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALCH      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALAR      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_SALA4      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ESCF3      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ERWCT      ----------------------------------------CSGFQYGFTFDDQINDGDMTIEKQGVALVV
ERPA_ENTS8      ----------------------------------------CSGFQYGFTFDDQINDGDMTIEKQGVSLVV
ERPA_ECOUT      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECOSM      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECOSE      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECOLU      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECOLI      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECOLC      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECOL6      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECOL5      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECOK1      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECOHS      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECODH      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECOBW      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECO8A      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECO81      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECO7I      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECO5E      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECO57      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECO55      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECO45      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECO27      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA_ECO24      ----------------------------------------CSGFQYGFTFDDQVNEGDMTIEKQGVGLVV
ERPA2_METCA     --DMSAETIKFTDSAAQRVSELLEEGDQNLKLRVYVTGGGCSGFQYGFTFXXXXXXXXXXXXKNGVSVLV
ERPA_HAEIN      MIDDMAVPLTFTDAAANKVKSLIEEENTDLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIEKSGVQLVI
ERPA_HAEIG      MIDDMAVPLTFTDAAANKVKSLIEEENTNLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIEKSGVQLVI
ERPA_HAEI8      MIDDMAVPLTFTDAAANKVKSLIEEENTNLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIEKSGVQLVI
ERPA_BORPD      ----------------------------------------CSGFQYGFTFDEAVNEDDTVLDKNGVQLLV
YCF83_GALSU     ----------------------------------------CSGLSYFMTYEKKISDNDLVYDYDNFTLVC
ERPA_ERWT9      ----------------------------------------CSGFQYGFTFDDKVNEGDMTIEKSGVALVV
ERPA_SHEDO      ----------------------------------------CSGFQYGFTFDEKSSADDFVIEKQGVKLVV
ERPA_PHOLL      ----------------------------------------CSGFQYGFTFDDQINEGDMTIEKQGVELVV
ERPA_HAES2      ----------------------------------------CSGFQYGFTFDEKTNDGDLIVENSGVKLVV
ERPA_HAES1      ----------------------------------------CSGFQYGFTFDEKTNDGDLIVENSGVKLVV
ERPA_HAEIE      MIDDIAVPLTFTDAAANKVKSLIEEENTDLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIEKSGVQLVI
YUTM_BACSU      ---------------------------------------------------------DSVFDQHGITVLV
ERPA_POLSQ      ----------------------------------------CSGFQYGFTFDDAVNEDDTLFEKNGVTLLV
ERPA_HAHCH      ----------------------------------------CSGFQYGFSFDEAVNEDDTIVEKDGVRLVV
ERPA_FRATW      ----------------------------------------CSGFQYAFAFDNEVKEDDMVITKNGVRLLV
ERPA_FRATT      ----------------------------------------CSGFQYAFAFDNEVKEDDMVITKNGVRLLV
ERPA_FRATO      ----------------------------------------CSGFQYAFAFDNEVKEDDMVITKNGVRLLV
ERPA_FRATN      ----------------------------------------CSGFQYAFAFDNEVKEDDMVITKNGVRLLV
ERPA_FRATM      ----------------------------------------CSGFQYAFAFDNEVKEDDMVITKNGVRLLV
ERPA_FRATH      ----------------------------------------CSGFQYAFAFDNEVKEDDMVITKNGVRLLV
ERPA_FRATF      ----------------------------------------CSGFQYAFAFDNEVKEDDMVITKNGVRLLV
ERPA_FRAT1      ----------------------------------------CSGFQYAFAFDNEVKEDDMVITKNGVRLLV
ERPA_DECAR      ----------------------------------------CSGFQYGFTFDEEVNEDDTTMEKNGVTLLI
ERPA_BORA1      ----------------------------------------CSGFQYGFTFDEVVNEDDTVLDKEGVQLLV
ERPA2_POLNA     ----------------------------------------CSGFSYGFAFDDQTAEDDTLIVTEGVALVV
ERPA_PSEMY      ----------------------------------------CSGFQYGFTFDEDVAEDDTIVEREGVSLVV
ERPA_FRAP2      ----------------------------------------CSGFQYAFAFDNEIKEDDMVITKNGVRLLV
ERPA_BORPE      ----------------------------------------CSGFQYGFTFDEVVNDDDTVLDKAGVQLLV
ERPA_BORPA      ----------------------------------------CSGFQYGFTFDEVVNDDDTVLDKAGVQLLV
ERPA_BORBR      ----------------------------------------CSGFQYGFTFDEVVNDDDTVLDKAGVQLLV
Y116_BUCBP      ----------------------------------------CAGFKYCMEEVVDTSTNEIIFYANDVSIIV
ERPA_THICR      ----------------------------------------CSGFQYGFTFDESQAEDDTVVEKDGVKLMI
ERPA_MANSM      --------LTFTDAAAKKVKNLIEEENQDLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIENDGVKLVI
ERPA_EDWI9      ----------------------------------------CSGFQYGFTFDDKVNDGDMTIEKLGVALVV
ERPA_ALHEH      ----------------------------------------CSGFQYGFTFDERIEEGDSVVEKDGVTFLV
ERPA_VIBFM      ----------------------------------------CSGFQYGFTFDEDVNEGDMTIENDGVTLVV
ERPA_VIBF1      ----------------------------------------CSGFQYGFTFDEDVNEGDMTIENDGVTLVV
ERPA_PHOPR      ----------------------------------------CSGFQYGFTFDEKVNDGDMTIENSGVTLVV
ERPA_NITMU      ----------------------------------------CSGFKYGFTFDELISEDDTVMEKNGVKLLV
ERPA_BLOPB      ----------------------------------------CSGFQYRFILDDKISSDDCIVENNGVSLVI
ERPA_BLOFL      ----------------------------------------CGGFQYKFILDDQVSNDDCVIESNGAIVVV
ERPA_AERS4      --------IQMTDAAANKVKNLIEEENPELKLRVYITGGGCSGFQYGFTFDEKINEGDTVVEKSGVTMVI
ERPA2_BURXL     -------LLEFTRQAAAKVASLIEEEGNPNLKLRLYVSGGCSGFQYGFAFDDQVADDDMQTVTDGVTLLV
ERPA1_BURVG     ----------------------------------------CSGFQYGFTFDEEVNEDDTVMDKNGVQLLI
ERPA_VIBVY      ----------------------------------------CSGFQYGFTFDESVNEGDTTIENSGVTLVV
ERPA_VIBVU      ----------------------------------------CSGFQYGFTFDESVNEGDTTIENSGVTLVV
ERPA_RUTMC      ----------------------------------------CSGFSYGFNFDETYKEGDSSVENNGVQLVV
ERPA_PASMU      ----------------------------------------CSGFQYGFTFDEKVNDGDLTIEKSGVHLVI
ERPA_NITEU      ----------------------------------------CSGFQYGFTFDEIVNEDDFVMEKQGVKLLV
ERPA_BURS3      ----------------------------------------CSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
ERPA_VIBPA      ----------------------------------------CSGFQYGFTFDENVNDGDTTIENSGVTLVV
ERPA_PROMH      ----------------------------------------CSGFQYGFTFDDAMNEGDMTIEKQGVALVI
ERPA_COLP3      ----------------------------------------CSGFQYGFTFDEKVNDGDMTIEKQGVMMVI
ERPA_BURM1      ----------------------------------------CSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
ERPA_BURCM      ----------------------------------------CSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
ERPA_BURCJ      ----------------------------------------CSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
ERPA_BURCH      ----------------------------------------CSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
ERPA_BURCC      ----------------------------------------CSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
ERPA_BURCA      ----------------------------------------CSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
ERPA_BURA4      ----------------------------------------CSGFQYGFTFDEEVNEDDTVMNKNGVQLLI
ERPA_AERHH      --------IQMTDAAANKVKTLIEEENPELKLRVYITGGGCSGFQYGFTFDEKINEGDTVVEKSGVTMVI
ERPA_ACTPJ      ----------------------------------------CSGFQYGFTFDDQVNDGDLTIENQNVGLVV
ERPA_BAUCH      ----------------------------------------CSGLQYGFTFDDKVNEEDIAIEKQGVVLIV
ERPA_ALISL      ----------------------------------------CSGFQYGFTFDEEVNEGDMTLVNDGVTLVV
ERPA_VIBCM      --------LSFSDAAAKRVALIAEEENPSLMLRVYITGGGCSGFQYGFTFDETVNEGDTKIENSGVILVV
ERPA_VIBCH      --------LSFSDAAAKRVALIAEEENPSLMLRVYITGGGCSGFQYGFTFDETVNEGDTKIENSGVILVV
ERPA_VIBC3      --------LSFSDAAAKRVALIAEEENPSLMLRVYITGGGCSGFQYGFTFDETVNEGDTKIENSGVILVV
ERPA_SHEPW      --------ISFTDAAALKVKTLLEEENDALKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTVEKQGVQLVV
ERPA_SHEHH      ----------------------------------------CSGFQYGFTFDEKINEGDYTVEKQGVQLVV
ERPA_SHEFN      ----------------------------------------CSGFQYGFTFDEKVNEGDFTIEKQGVQLVV
ERPA_IDILO      ----QAMPIEFTEQAASKVGKLIEEENPNLKLRVYVTGGGCSGFQYGFTFDEKKNPGDMEIEKNGVTLLV
ERPA_BURTA      ----------------------------------------CSGFQYGFTFDEEVNEDDTVLNKNGVVLLV
ERPA_BURPS      ----------------------------------------CSGFQYGFTFDEEVNEDDTVLNKNGVVLLV
ERPA_BURP6      ----------------------------------------CSGFQYGFTFDEEVNEDDTVLNKNGVVLLV
ERPA_BURP1      ----------------------------------------CSGFQYGFTFDEEVNEDDTVLNKNGVVLLV
ERPA_BURP0      ----------------------------------------CSGFQYGFTFDEEVNEDDTVLNKNGVVLLV
ERPA_BURMS      ----------------------------------------CSGFQYGFTFDEEVNEDDTVLNKNGVVLLV
ERPA_BURMA      ----------------------------------------CSGFQYGFTFDEEVNEDDTVLNKNGVVLLV
ERPA_BURM9      ----------------------------------------CSGFQYGFTFDEEVNEDDTVLNKNGVVLLV
ERPA_BURM7      ----------------------------------------CSGFQYGFTFDEEVNEDDTVLNKNGVVLLV
ERPA_ALCBS      ----------------------------------------CAGFSYGFTFDETVNEDDTSVEKEGVILLV
ERPA_SHESW      ----------------------------------------CSGFQYGFTFDEKVNEGDFTVEKQGVQLVV
ERPA_SHESR      ----------------------------------------CSGFQYGFTFDEKVNEGDFTVEKQGVQLVV
ERPA_SHESM      ----------------------------------------CSGFQYGFTFDEKVNEGDFTVEKQGVQLVV
ERPA_SHESA      ----------------------------------------CSGFQYGFTFDEKVNEGDFTVEKQGVQLVV
ERPA_SHEPC      ----------------------------------------CSGFQYGFTFDEKVNEGDFTVEKQGVQLVV
ERPA_SHEPA      ----------------------------------------CSGFQYGFTFDEKVNEGDFTVEKQGVQLVV
ERPA_SHEON      ----------------------------------------CSGFQYGFTFDEKVNEGDFTVEKQGVQLVV
ERPA_SHELP      ----------------------------------------CSGFQYGFTFDEKVNEGDFTVEKQGVQLVV
ERPA_SHEAM      ----------------------------------------CSGFQYGFTFDEKVNDGDFTVEKQGVQLVV
ERPA_PSYCK      -------VLNLTDSAAQKVRRLREEEGDSNLMLRVYVTGGCSGFSYGFNFANELNEDDANFDNNDVTLVV
ERPA_PSYA2      -------VLNLTDSAAQKVRRLREEEGDSNLMLRVYVTGGCSGFSYGFNFANELNEDDANFDNNDVTLVV
ERPA_METFK      ----------------------------------------CSGFQYGFTFEETINEDDTTVDKDGVTLLI
ERPA_ACTSZ      ----------------------------------------CSGFQYGFTFDEKVNEGDLTVENAGVQLVI
ERPA_PSEA6      ----------------------------------------CSGFQYGFTFDEKVNDGDTTIDKDQVTLVV
ERPA_HAEDU      --------LTFTDAAAKKVKSLIEGEDNPNLRLRVYITGGCSGFQYGFTFDDKINEGDLTIENQNVGLIV
ERPA_VIBSL      ----------------------------------------CSGFQYGFTFDEKVNDGDTTIVNSGVTLVV
ERPA_SHEB9      ----------------------------------------CSGFQYGFTFDEKVNDGDFTIEKQGVLLVV
ERPA_SHEB8      ----------------------------------------CSGFQYGFTFDEKVNDGDFTIEKQGVLLVV
ERPA_SHEB5      ----------------------------------------CSGFQYGFTFDEKVNDGDFTIEKQGVLLVV
ERPA_SHEB2      ----------------------------------------CSGFQYGFTFDEKVNDGDFTIEKQGVLLVV
ERPA_RALEJ      ----------------------------------------CSGFQYGFTFDEEVNEDDTTMVKNGVTLLI
ERPA_RALEH      ----------------------------------------CSGFQYGFTFDEEVNEDDTTMVKNGVTLLI
ERPA_PSYIN      ----------------------------------------CSGFSYGFTFAETANEDDTKIENAGVTLLV
ERPA_NITEC      ----------------------------------------CSGFQYGFTF-DEIINEDDVIEKQGVRLLV
ERPA_CUPTR      ----------------------------------------CSGFQYGFTFDEEVNEDDTTMVKNGVTLLI
Y063_RICPR      ----------------------------------------CSGLMYNYELVDNIEKDDYVFTRHNATIII
ERPA_VIBHB      ----------------------------------------CSGFQYGFTFDERVNEGDTTIVNSGVTLVV
ERPA_CHRVO      ----------------------------------------CSGFQYGFTFDEIANEDDTAIERQGVTFLV
ERPA_ACTP7      ----------------------------------------CSGFQYGFTFDDQINEGDLTIENQNVGLVV
ERPA_ACTP2      ----------------------------------------CSGFQYGFTFDDQINEGDLTIENQNVGLVV
ISCA1_DICDI     ---SKKAIFSMTDSALKRVKEIMKKIDNCIGLRLGIKERGCSGMSYTLDFATQKNKFDEVVADKDINIIV
ERPA_VESOH      ----------------------------------------CSGFSYGFTFDEKRKEGDSSVTNNGVQLVI
ERPA_MARAV      ----------------------------------------CSGFQYGFSFDESQEEDDTVIERDGVKLLV
ERPA_RALME      ----------------------------------------CSGFQYGFTFDEDVNEDDTTMVKNGVTLLI
ERPA_CHRSD      ----------------------------------------CSGFQYGFDFADTVGDEDTIIENGTASMVV
ERPA_BURPP      ----------------------------------------CSGFQYGFTFDEAVNEDDTVMNKSGVQLLI
ERPA_BUCAT      ----------------------------------------CSGFQYQFIFDTSINEDDIIITQSEVSLII
ERPA_BUCA5      ----------------------------------------CSGFQYQFIFDTSINEDDIIITQSEVSLII
ERPA1_BURXL     ----------------------------------------CSGFQYGFTFDEAVNEDDTVMNKSGVQLLI
ERPA_NEIMF      ----------------------------------------CSGFQYGFTFDEIKNDDDFEIEKNGLVFLV
ERPA_NEIMB      ----------------------------------------CSGFQYGFTFDEIKNDDDFEIEKNGLVFLV
ERPA_NEIMA      ----------------------------------------CSGFQYGFTFDEIKNDDDFEIEKNGLVFLV
ERPA_NEIG1      ----------------------------------------CSGFQYGFTFDEIKNDDDFEIEKNGLVFLV
ERPA_BURP8      ----------------------------------------CSGFQYGFTFDEAINEDDTVMNKSGVQLLI
ERPA_ACIF5      --DSIPPVMTLTQNAADKIASLIEEEGSDDLKLRVFVTGGCSGFQYGFTFDENMNEGDTEVHQLGVSLLI
ERPA_ACIF2      --DSIPPVMTLTQNAADKIASLIEEEGSDDLKLRVFVTGGCSGFQYGFTFDENMNEGDTEVHQLGVSLLI
ISAM2_ARATH     ----------------------------------------CSGFQYKFELDNRTNPDDRVFEKNGVKLVV
ERPA_HAEPS      ----------------------------------------CSGFQYGFTFDDKLNEGDLTIENLDVALVI
ERPA_BUCAI      ----------------------------------------CSGFQYQFIFDTSINEDDIIITQSEVSLII
ERPA_ACISJ      --------ILFTDSAAAKVAELIEEGNPDLKLRVFVQGGGCSGFQYGFTF-DEITNEDDTTMTNGVSLLI
ERPA_BUCAP      ----------------------------------------CSGFQYQFIFDEKINEDDILVKKLNICLVI
ERPA_ACIBY      ----------------------------------------CSGFSYGFNFAESVNEDDAEFVNGDVKMLV
ERPA_ACIBT      ----------------------------------------CSGFSYGFNFAESVNEDDAEFVNGDVKMLV
ERPA_ACIBC      ----------------------------------------CSGFSYGFNFAESVNEDDAEFVNGDVKMLV
ERPA_ACIB5      ----------------------------------------CSGFSYGFNFAESVNEDDAEFVNGDVKMLV
ERPA_ACIB3      ----------------------------------------CSGFSYGFNFAESVNEDDAEFVNGDVKMLV
ERPA_COXBU      ----------------------------------------CSGFQYGFTFDEAINSDDLVIEKQLVKLLV
ERPA_COXBR      ----------------------------------------CSGFQYGFTFDEAINSDDLVIEKQLVKLLV
ERPA_ACIBS      ----------------------------------------CSGFSYGFNFAESINEDDAEFVNGDVKMLV
ERPA_ACIAC      ----------------------------------------CSGFQYGFTF-DEITNEDDTTMTNGVSLLI
ERPA_VEREI      --------ILFTDSAAAKVAQLIEEGNPELKLRVFVQGGGCSGFQYGFTF-DEITNEDDTTMTNGVSLLI
ERPA_PSEHT      ----------------------------------------CSGFQYGFTFDEKANPGDLEIVKNGVMLVV
ERPA_DELAS      ----------------------------------------CSGFQYGFTFDEITNDDDTTMTKNGVSLLI
ERPA_COXBN      ----------------------------------------CSGFQYGFTFDEAINSDDLVIEKQLVKLLV
ERPA_THIDA      ----------------------------------------CSGFQYGFTFDEAQNADDTVMVKNGVTLLV
ERPA_ACIAD      ----------------------------------------CSGFSYGFNFADSPNEDDAEFVNGDVKMLV
ERPA_JANMA      ----------------------------------------CSGFQYGFTFDEIVNEDDTTMTKNGVQLLI
ERPA_HERAR      ----------------------------------------CSGFQYGFTFDEIVNEDDTTMTKNGVQLLI
ERPA_RHOFD      ----------------------------------------CSGFQYGFTF-DEITNEDDTTMTNGVSLLI
ERPA_POLSJ      ----------------------------------------CSGFQYGFTF-DEITNEDDTTMTNGVSLLI
ERPA_NITOC      ----------------------------------------CSGFQYGFTFDETSHEGDTRVKNGGVTLLI
ERPA_LEGPL      ----------------------------------------CSGFQYGFSFDEQINDDDTVIIQQSVKLLI
ERPA_LEGPH      ----------------------------------------CSGFQYGFSFDEQINDDDTIVIQQSVKLLV
ERPA_HAMD5      ----------------------------------------CNGFKYMFTLDDKVNEGDLAINKQGVSLVV
ERPA_SACD2      ----------------------------------------CSGFQYGXXXXXXXXXXXXKIERDGVTVVV
YCF83_PORPU     --EENMNFITLTEPAARQIKILKSNFDNEVCLRIGVKQGGCSGMSYSMNFVSSLRETDEVLMLDSFLVAC
ERPA_WIGBR      ----------------------------------------CNGFQYNFILDEKINKEDHLILFLDVEIVI
ISA2_SCHPO      ----------------------------------------CHGYQVSFRMDNKIGNADTVFVRGKARVVA
ERPA1_METCA     ----------------------------------------CSGMQYGFAFEEAVNEDDTTVEKDGVVLLV
ERPA_RALPJ      ----------------------------------------CSGFQYGFXXXXXXXXXXXXXXKNGVSLLI
ERPA_RALSO      ----------------------------------------CSGFQYGXXXXXXXXXXXXXMTKNGVTLLI
ERPA_LEGPC      -----------------------------------------------------------------VKLLI
ERPA_LEGPA      -----------------------------------------------------------------VKLLI
ERPA_ALTMD      ----------------------------------------CSGFQYGFTFDEKVNEGDMTIEKDSVTLVV
ERPA2_BURVG     ----------------------------------------CSGFQYGXXXXXXXXXXXXXXXXXGVTLLI
YNIU_AZOBR      ----------------------------------------CAGHKYQMGL--EATAGDDVLTFGPVTIFV
ERPA_METPP      ----------------------------------------CSGFQYGFTFDEIVNDDDTKMEKNGVMLLI
YNIU_FRAAL      -----ATVIELTDKAVAQVRHLLTPGHRGLRLRIGVDPGGCSGYTYKLALVPGAETGDVVLPQDGFDVVV
NFUA_SHESH      ---------------------------------------------------DAVEADDMEFEFNGFNAMV
ERPA1_POLNA     ----------------------------------------CSGFQYGFTF-DEITNEDDTTMTNGVSLLI
NFUA_TOLAT      -------MITISESAQAHFRKLLEKQAENTNIRVFVMNPGTPNAECGVSYCDAVEPEDSRQPFDGFDAII
NFUA_SHEHH      ---------------------------------------------------DAVEADDTEFEFNGFNAMV
NFUA_AERS4      -------MISISDTAQAHFRKLLKKQPDGTNIRVFVVNPGTQNAECGVSYCDAVDPEDQHLPFSGFDCLV
NFUA_AERHH      -------MISISDTAQAHFRKLLEKQPDGTNIRVFVVNPGTQNAECGVSYCDAVDPEDQHLPFSGFDCLV
NFUA_ACTPJ      --------ISISEAAQTHFRRLLEQQEENTNIRIFVVNPGTPNAECGVSYCNAVEETDTQFEYNGFSAFV
NFUA_ACTP7      --------ISISEAAQTHFRRLLEQQEENTNIRIFVVNPGTPNAECGVSYCNAVEETDTQFEYNGFSAFV
NFUA_ACTP2      --------ISISEAAQTHFRRLLEQQEENTNIRIFVVNPGTPNAECGVSYCNAVEETDTQFEYNGFSAFV
NFUA_PSEA6      -------MISISDTAQAHFCKLLEKQEPDTNIRVFVVNPGTPSAECGVSYCDAVESTDTTLEFNGFDAVV
NFUA_ALTMD      -------MITISEEAQAHFVKLLSKQESGTNIRVFVVNPGTSSAECGVSYC----PPDAVEETNGFDAVV
ERPA_BUCCC      ----------------------------------------CSGFQYGFELEKITKKNDXXXXXXXXXXXX
NFUA_SHEWM      ---------------------------------------------------DAVEADDMELEYNGFNAMV
NFUA_SHEDO      -------MISISDSAQAHFVKLLADQPAGTHIRVFVISPGTSQAECGVSYCDAVESDDVELEFNGFNAMV
NFUA_SHEPW      ---------------------------------------------------DAVEADDTELEFNGFNAMV
NFUA_SHEPA      ---------------------------------------------------DAVEADDTEIEFNGFNAMV
ERPA_BUCBP      ----------------------------------------------------------------------
NFUA_SHESR      ---------------------------------------------------DAVESDDIELEFNGFSAMV
NFUA_SHESM      ---------------------------------------------------DAVESDDIELEFNGFSAMV
NFUA_SHESA      ---------------------------------------------------DAVESDDIELEFNGFSAMV
NFUA_SHELP      ---------------------------------------------------DAVEADDIELEFNGFHAMV
NFUA_PSEHT      -------MISISETAQAHFAKLLADQAQQTNIRVFVVNPGTSQAECGVSYCPEDAVEDSDIRLNGFDGVV
NFUA_SHESW      ---------------------------------------------------DAVESDDIELEFNGFNAMV
NFUA_SHEPC      ---------------------------------------------------DAVESDDIELEFNGFNAMV
NFUA_IDILO      ---------------------------------------------------DSVEPDDERLPFNGFDAVV
NFUA_EDWI9      -------MIRITEAAQEHFAKLLANQEPGTQIRVFVINPGTPNAECGVSYCDAVEANDRKLDFEQLSAYV
NFUA_PECCP      ---------------------------------------------------DAVEASDTVLKFEKISAYV
NFUA_SHEB9      ---------------------------------------------------DAVESDDIEIEFTGFNAMV
NFUA_SHEB8      ---------------------------------------------------DAVESDDIEIEFTGFNAMV
NFUA_SHEB5      ---------------------------------------------------DAVESDDIEIEFTGFNAMV
NFUA_SHEB2      ---------------------------------------------------DAVESDDIEIEFTGFNAMV
NFUA_PROMH      -------MITITDAAQAHFAKLLANQEPNTQIRVFVINPGTPNAECGVSYCDAVEPNDTEIKFEKLSAYV


                         .         .         *         .         .         .         .:140
query           DPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDECGCGESFRV
ISCA_XENNE      DGKSILYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFHV
ISCA_HAEIN      DPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV
ISCA_YERPY      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV
ISCA_YERPS      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV
ISCA_YERPP      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV
ISCA_YERPN      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV
ISCA_YERPG      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV
ISCA_YERPE      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV
ISCA_YERPB      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV
ISCA_YERPA      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV
ISCA_YERP3      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESFNV
ISCA_PHOLL      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV
ISCA_ENT38      DGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_EDWI9      DGKSLVYLDGTELDFVKEGLNEGFKFNNPNVKNECGCGESFNV
ISCA_PROMH      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVANECGCGESFTV
ISCA_SERP5      DGKSLVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV
ISCA_ERWCT      DGKSLVYLDGTELDFVKEGLNEGFKFNNPNISGECGCGESFNV
ISCA_KLEP7      DGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFNV
ISCA_KLEP3      DGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFNV
ISCA_YERE8      DGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV
ISCA_PECCP      DGKSLVYLDGTELDFVKEGLNEGFKFNNPNSSGECGCGESFNV
ISCA_SHISS      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_SHIFL      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_SHIDS      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_SHIBS      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ESCF3      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECOSM      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECOSE      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECOLU      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECOLI      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECOLC      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECOL6      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECOL5      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECOK1      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECODH      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECOBW      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECO8A      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECO81      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECO7I      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECO57      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECO55      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECO45      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_ECO27      XXXSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV
ISCA_SALNS      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALTY      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALTI      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALSV      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALPK      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALPC      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALPB      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALPA      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALHS      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALG2      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALEP      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALDC      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALCH      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALAR      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_SALA4      XXXSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV
ISCA_ENTS8      XXXSLQFLNGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFNV
SUFA_ECOLI      PLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV
Y484_RICPR      DPKTLMYILGSEMDYVETNFKSQFTFTNPNEKANCGCGKSFSV
ISAM1_ARATH     EPKALMHVIGTKMDFVDDKLRSEFVFINPNSQGQCGCGESF--
ISA1_YEAST      DSKALFSIIGSEMDWIDDKLASKFVFKNPNSKGTCGCGESFMV
Y1417_SYNY3     DRKSLLYLYGLMLDYSNALIGGGFQFTNPNANQTCGCGKSFGV
ISCAP_ARATH     DPKSMLFLFGMQLDYSDALIGGGFSFSNPNATQTCGCGKSF--
ISAM3_ARATH     DPKAVMHVIGTEMDFVDDKLRSEFVFVNPNA-TKCGCGESF--
YCF83_PORYE     DPKSLLYLYGLSLDFSSELIGGGFQFSNPNASQTCGCGKSF--
ISCA1_CHICK     EKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI
ISCA1_MOUSE     EKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFHV
HESB_PLEBO      DPQAAALINGVVVDFVEGLMDSGFKFSNPNATDTCGCGQSFQ-
ISCA1_RAT       EKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNV
YNIU_AZOVI      DSASAPLLDGVTMDFVESMEGSGFTFVNPNATNSCGCGKSF--
Y1755_BRAJA     DSKSREHLAGTTIDFVLAPESSGFTFHNPNAATNCSCGKSF--
ISCA1_MACFA     EKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI
ISCA1_HUMAN     EKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI
ISCA1_DANRE     EKKAQLTLLGTEMDFVETKLSSEFVFNNPNIKGTCGCGESFNI
ISCA1_BOVIN     EKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI
YNIU_RHOSH      DPQSGTYLNGVTIDFVTSLEGTGFVFDNPNAKGGCGCGKSF--
HESB_ANASP      DAKSAPLLEGIVIDFVEGLVESGFKFTNPNATSTCGCGKSFKV
Y2227_MYCBO     DRMSAPYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSF--
Y2204_MYCTU     DRMSAPYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSF--
ISA1_SCHPO      ARRALLQIIGSVMDYRDDDLQSRFIFSNPNVKSTCGCGESF--
HESB2_ANAVT     DSQSAPLLEGVVVDFVDGLLESGFKFSNPNATDTCGCGKSFQ-
HESB1_ANAVT     DAKSAPLLEGIVIDFVEGLVESGFKFTNPNATSTCGCGKSFK-
ERPA_XYLFM      DPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSI
Y114_BUCAP      SLKEAPFLNGIKIDFVKDSINEVFKYCNPRIKTFCGCGESFSI
ISCA2_MOUSE     DSDSLAFVKGAQVDFSQELIRSSFQLNNPQAQQGCSCGSSFSV
ISCA2_PONAB     DSDSLAFVKGAQVDFSQELIRSSFQLNNPQAQQGCSCGSSFSI
ISCA2_HUMAN     DSDSLAFVKGAQVDFSQELIRSSFQLNNPQAQQGCSCGSSFSI
ISCA2_BOVIN     DSDSLAFVKGAHVDFSQELIRSSFQLNNPQAQQGCSCGSSFSV
ERPA_XYLFT      DPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSV
ERPA_XYLFA      DPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSV
ERPA_XYLF2      DPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSFSV
ERPA_PSEU5      DPMSYQYLAGAEVDY-QEGL-EGSRFKNPNATTTCGCGQSFSI
ERPA_PSEF5      DPMSFQYLAGAEVDY-QEGL-EGSRFKNPNATTTCGCGSSFSI
ERPA_CITK8      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_AZOVD      DPMSFQYLAGAEVDY-QEGL-EGSRFKNPNAATTCGCGQSFSV
Y1565_SYNY3     DSQSAGYLHNLKLDYAEDLMGGGFRFTNPNAAQVCSCSLSF--
ERPA_STRMK      DPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSF--
ERPA_STRM5      DPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSF--
ERPA_YERE8      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_PSEU2      DPMSFQYLAGAEVDY-QEGL-EGSRFKNPNASTTCGCGSSFSI
ERPA_PSESM      DPMSFQYLAGAEVDY-QEGL-EGSRFKNPNASTTCGCGSSFSI
ERPA_PSEAE      DPMSFQYLAGSEVDY-QEGL-EGSRFKNPNAATTCGCGQSFSI
ERPA_PSEAB      DPMSFQYLAGSEVDY-QEGL-EGSRFKNPNAATTCGCGQSFSI
ERPA_PSEA8      DPMSFQYLAGSEVDY-QEGL-EGSRFKNPNAATTCGCGQSFSI
ERPA_PSEA7      DPMSFQYLAGSEVDY-QEGL-EGSRFKNPNAATTCGCGQSFSI
ERPA_PSE14      DPMSFQYLAGAEVDY-QEGL-EGSRFKNPNASTTCGCGSSFSI
ERPA_KLEP7      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSV
ERPA_ENT38      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_AZOSE      DPMSYQYLVGAEIDYS-EGL-EGSQFRNPNATSTCGCGSSF--
ERPA_PSEPK      DPMSFQYLAGAEVDY-QEGL-EGSRFKNPNAATTCGCGSSFSI
ERPA_PSEPF      DPMSFQYLAGAEVDY-QEGL-EGSRFKNPNATTTCGCGSSFSI
ERPA_PSEFS      DPMSFQYLAGAEVDY-QEGL-EGSRFKNPNATTTCGCGSSFSI
ERPA_KLEP3      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSV
ERPA_YERPY      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_YERPS      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_YERPP      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_YERPN      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_YERPG      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_YERPE      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_YERPB      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_YERPA      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_YERP3      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_XANCP      DPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV
ERPA_XANCB      DPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV
ERPA_XANC8      DPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV
ERPA_XANC5      DPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV
ERPA_XANAC      DPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV
ERPA_PSEE4      DPMSFQYLAGAEVDY-QEGL-EGSRFKNPNATTTCGCGSSFSI
ERPA_AZOSB      DPMSYQYLVGAEIDYT-EGL-EGSQFRNPNATSTCGCGSSF--
YNIU_RHOCA      DPLTREHIEGTKIDFVSNLEGAGFTFDNPNAKSACGCGKSF--
Y1857_AQUAE     DPFSMPYVNGAELDYVVDFMGGGFTIRNPN-------------
ERPA_XANOR      DPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV
ERPA_XANOM      DPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSV
ERPA_SODGM      DPMSLQYLVGGSVDYS-EGL-EGSRFTNPNAKTTCGCGSSFSI
ERPA_SERP5      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKTTCGCGSSFSV
ERPA_HALHL      DPVSGIYLQGAEVDFSSGLEGEQFIIRNPNATTTCGCGSSFAI
Y4VC_RHISN      DSASQPHVSGMTVDFTTGVDSAGFIFDNPNARENCACGKSF--
ERPA_SHISS      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SHIFL      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SHIF8      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SHIDS      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SHIBS      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SHIB3      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALTY      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALTI      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALSV      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALPB      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALPA      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALNS      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALHS      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALG2      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALEP      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALDC      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALCH      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALAR      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_SALA4      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ESCF3      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ERWCT      DPMSLQYLVGGAVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSV
ERPA_ENTS8      DPMSLQYLVGGAVDYT-EGL-EGSRFNNPNATSTCGCGSSFSI
ERPA_ECOUT      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECOSM      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECOSE      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECOLU      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECOLI      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECOLC      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECOL6      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECOL5      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECOK1      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECOHS      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECODH      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECOBW      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECO8A      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECO81      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECO7I      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECO5E      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECO57      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECO55      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECO45      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECO27      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_ECO24      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA2_METCA     DPMSLQYLQGAEIDYTENVSGSQFVIRNPNATTTCGCGSSFSV
ERPA_HAEIN      DPMSLQYLIGGTVDYT-EGL-EGSRFNNPNATSTCGCGSSFSI
ERPA_HAEIG      DPMSLQYLIGGTVDYT-EGL-EGSRFNNPNATSTCGCGSSFSI
ERPA_HAEI8      DPMSLQYLIGGTVDYT-EGL-EGSRFNNPNATSTCGCGSSFSI
ERPA_BORPD      DPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV
YCF83_GALSU     DNKSILYLYGISLDYSSSLIDGGFKFLNPNAKQTCGCGKSF--
ERPA_ERWT9      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNAKTTCGCGSSFSI
ERPA_SHEDO      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNASSTCGCGASFSV
ERPA_PHOLL      DPMSLQYLVGGCVDYT-EGL-EGSRFTNPNAKTTCGCGSSFSI
ERPA_HAES2      DPMSLQYLVGGTVDYT-EGL-EGSRFNNPNASTTCGCGSSFSI
ERPA_HAES1      DPMSLQYLVGGTVDYT-EGL-EGSRFNNPNASTTCGCGSSFSI
ERPA_HAEIE      DPMSLQYLIGGTVDYT-EGL-EGSRFNNPNATSTCGCGSSFSI
YUTM_BACSU      DKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSSFR-
ERPA_POLSQ      DSMSFQYLVGAEIDYKEDINGSQFVIKNPNATTTCGCGSSF--
ERPA_HAHCH      DSLSYQYLVGAEVDF-REGL-EGAQFKNPNASTTCGCGSSFSI
ERPA_FRATW      DSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV
ERPA_FRATT      DSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV
ERPA_FRATO      DSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV
ERPA_FRATN      DSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV
ERPA_FRATM      DSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV
ERPA_FRATH      DSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV
ERPA_FRATF      DSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV
ERPA_FRAT1      DSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV
ERPA_DECAR      DPMSYQYLVGAEIDYT-EGL-EGSQFRNPNATSTCGCGSSF--
ERPA_BORA1      DPMSFQYLVGAEIDYKEDLEGAQFVIRNPNATTTCGCGSSFSV
ERPA2_POLNA     DAMSLQYVLGARVDF-EDGL-EGSRFHNPNAQSTCGCGSSFSV
ERPA_PSEMY      DAMSFQYLVGSEVDY-QEGL-EGSRFKNPNATTTCGCGSSFSI
ERPA_FRAP2      DSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV
ERPA_BORPE      DPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV
ERPA_BORPA      DPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV
ERPA_BORBR      DPMSFQYLVGAEIDYKEDLEGAQFVIRNPNASTTCGCGSSFSV
Y116_BUCBP      NTNELHMLDGVKIDFVKEGLNYSFKFSHTKIKNFCGCGNSF--
ERPA_THICR      DPMSFQYLMGAKIDYLEDLQGARFVIENPNASTTCGCGSSFGV
ERPA_MANSM      DPMSLQYLIGGTVDYT-EGL-EGSRFHNPNATTTCGCGSSFSI
ERPA_EDWI9      DAMSLQYLVGGSVDYT-EGL-EGSRFNNPNAKTTCGCGSSFSI
ERPA_ALHEH      DPMSSQYLMGAEIDFVEGIEGEQFVIRNPNATTTCGCGSSFSI
ERPA_VIBFM      DPMSLQYLIGGKVDYT-EGL-EGSRFDNPNATTTCGCGASFSV
ERPA_VIBF1      DPMSLQYLIGGKVDYT-EGL-EGSRFDNPNATTTCGCGASFSV
ERPA_PHOPR      DPMSLQYLVGGIVDYT-EGL-EGSRFNNPNATTTCGCGASFSV
ERPA_NITMU      DAMSFQYLAGAEIDYQENAEGAQFIIKNPGAASTCGCGSSFSV
ERPA_BLOPB      DPMSLQYLFGGIIDYY-EGL-EGSRFVNPNAKNTCSCGSSFSV
ERPA_BLOFL      DPMSLQYLFGGIIDYY-EGL-EGSKFLNPNAKGVCSCGSSFNI
ERPA_AERS4      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNASTTCGCGSSFSI
ERPA2_BURXL     DSMSLQYLPGARVDY-EDGL-EGSRFHNPNAQSTCGCGSSFSV
ERPA1_BURVG     DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_VIBVY      DPMSLQYLIGGVVDYT-EGL-EGSRFNNPNATTTCGCGASFSV
ERPA_VIBVU      DPMSLQYLIGGVVDYT-EGL-EGSRFNNPNATTTCGCGASFSV
ERPA_RUTMC      DPMSYQYLIGATVDYLEDLQGARFIIHNPNAKTTCGCGSSFSV
ERPA_PASMU      DPMSLQYLIGGTVDYT-EGL-EGSRFNNPNASTTCGCGSSFSI
ERPA_NITEU      DSMSFQYLVGAEIDYQESAQGAQFVIKNPSAASTCGCGSSFSV
ERPA_BURS3      DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNASTTCGCGSSFSV
ERPA_VIBPA      DPMSLQYLIGGIVDYT-EGL-EGARFNNPNATTTCGCGASFSV
ERPA_PROMH      DPMSLQYLVGGCVDYT-EGL-EGSRFTNPNAKSTCGCGSSFSI
ERPA_COLP3      DPMSLQYLVDGEVDYLESLEGSRFVVNNPNATTTCGCGSSFSI
ERPA_BURM1      DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURCM      DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURCJ      DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURCH      DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURCC      DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURCA      DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURA4      DSMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_AERHH      DPMSLQYLVGGSVDYT-EGL-EGSRFTNPNATTTCGCGSSFSI
ERPA_ACTPJ      DPMSLQYLIGGTVDYT-EGLDGSFVVNNPNATSTCGCGSSFSI
ERPA_BAUCH      DPISLQYLLGGLVDYSEGLKGSRFFIINPNVQTTCSCGSSF--
ERPA_ALISL      DPMSLQYLIGGIVDYT-EGL-EGSRFNNPNATTTCGCGASFSV
ERPA_VIBCM      DPMSLQYLIGGVVDYT-EGL-EGSRFNNPNATTTCGCGASFSV
ERPA_VIBCH      DPMSLQYLIGGVVDYT-EGL-EGSRFNNPNATTTCGCGASFSV
ERPA_VIBC3      DPMSLQYLIGGVVDYT-EGL-EGSRFNNPNATTTCGCGASFSV
ERPA_SHEPW      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHEHH      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHEFN      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_IDILO      DPMSLQYLMGGVVSY-EEGL-QGSRFDNPNATTTCGCGSSFSV
ERPA_BURTA      DAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURPS      DAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURP6      DAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURP1      DAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURP0      DAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURMS      DAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURMA      DAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURM9      DAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_BURM7      DAMSYQYLVGAEIDYKDDLNGAQFVIKNPNATTTCGCGSSFSV
ERPA_ALCBS      DAMSIQYLDGSVVDYEKGLMGSRFVVSNPNAATTCGCGSSFSV
ERPA_SHESW      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHESR      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHESM      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHESA      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHEPC      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHEPA      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHEON      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHELP      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHEAM      DPMSLQYLMGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_PSYCK      DSLSYQYLQGSTVDYT-EGL-EGARFTNPNATTTCGCGSSFSI
ERPA_PSYA2      DSLSYQYLQGSTVDYT-EGL-EGARFTNPNATTTCGCGSSFSI
ERPA_METFK      DPMSLQYLVGAEIDYQDSLQGSQFVIRNPNATTTCGCGSSF--
ERPA_ACTSZ      DPMSLQYLIGGTVDYT-EGL-EGSRFQNPNASSTCGCGSSFSI
ERPA_PSEA6      DPMSLQYLLGGEVDYT-EGL-EGSRFNNPNATTTCGCGASFTV
ERPA_HAEDU      DPMSLQYLIGGSVDYT-EGLDGSFVVQNPNASSTCGCGSSFSI
ERPA_VIBSL      DPMSLQYLMGGMVDYT-EGL-EGARFNNPNATTTCGCGASFSV
ERPA_SHEB9      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHEB8      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHEB5      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_SHEB2      DPMSLQYLVGGEVDYTSGLEGSRFFVKNPNATTTCGCGASFSV
ERPA_RALEJ      DSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV
ERPA_RALEH      DSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV
ERPA_PSYIN      DPMSLQYLVGGTVDYTNGLEGSRFFVNNPNATATCGCGSSF--
ERPA_NITEC      DSMSVQYLLGAEIDYQENAQGAQFVIKNPAAASTCGCGSSFSV
ERPA_CUPTR      DSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV
Y063_RICPR      DSISQKFMLNCTLDFIEELGSSYFNVSNPQAKAKCGCGNSFSV
ERPA_VIBHB      DPMSLQYLIGGVVDYT-EGL-EGARFNNPNATTTCGCGASFSV
ERPA_CHRVO      DPMSYQYLVGAEIDYQESLEGSQFVIRNPNATTTCGCGSSFSV
ERPA_ACTP7      DPMSLQYLIGGTVDYT-EGLDGSFVVQNPNASSTCGCGSSFSI
ERPA_ACTP2      DPMSLQYLIGGTVDYT-EGLDGSFVVQNPNASSTCGCGSSFSI
ISCA1_DICDI     DSKALLSVIGTEMDYXXXXXXXXXXXXNPNATNTCGCGESF--
ERPA_VESOH      DPMSYQYLIGATVDYLEDLQGARFIIHNPNAKTTCGCGSSFSV
ERPA_MARAV      DSMSYQYLVGATIDY-QEGLQGSFVVQNPNASSTCGCGSSFSI
ERPA_RALME      DSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV
ERPA_CHRSD      DALSYQYLVGSTVDFEEGLAGARFIIKNPNATSTCGCGASFAV
ERPA_BURPP      DSMSYQYLVGAEIDYKDDINGAQFVIKNPNATTTCGCGSSFSV
ERPA_BUCAT      DPISLQYLYGGQIDYLENLEGSKFIVSNPNAKNTCGCGSSFSI
ERPA_BUCA5      DPISLQYLYGGQIDYLENLEGSKFIVSNPNAKNTCGCGSSFSI
ERPA1_BURXL     DSMSYQYLVGAEIDYKDDINGAQFVIKNPNATTTCGCGSSFSV
ERPA_NEIMF      DPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV
ERPA_NEIMB      DPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV
ERPA_NEIMA      DPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV
ERPA_NEIG1      DPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV
ERPA_BURP8      DSMSYQYLVGAEIDYKDDINGAQFVIKNPNATTTCGCGSSFSV
ERPA_ACIF5      DPMSYQYLVGAEIDYS-EGL-EGAQFKNPNATTTCGCGSSF--
ERPA_ACIF2      DPMSYQYLVGAEIDYS-EGL-EGAQFKNPNATTTCGCGSSF--
ISAM2_ARATH     DNVSYDLVKGATIDYEEELIRAAFVVANPSAVGGCSCKSSFMV
ERPA_HAEPS      DPMSLQYLIGATIDYV-EGLDGSFVVQNPNASSTCGCGASFSI
ERPA_BUCAI      DPISLQYLYGGQIDYLENLEGSKFIVYNPNAKNTCGCGSSFSI
ERPA_ACISJ      DAMSYQYLVGAEIDYKEDLQGAQFVIKNPNAASTCGCGSSFSV
ERPA_BUCAP      DPISLQYLHGGTIDYLENLEGSKFIVSNPNAKNTCGCGLSFSI
ERPA_ACIBY      DSLSYQYLVGSVVDYV-EGL-EGSRFQNPNATTTCGCGSSFSI
ERPA_ACIBT      DSLSYQYLVGSVVDYV-EGL-EGSRFQNPNATTTCGCGSSFSI
ERPA_ACIBC      DSLSYQYLVGSVVDYV-EGL-EGSRFQNPNATTTCGCGSSFSI
ERPA_ACIB5      DSLSYQYLVGSVVDYV-EGL-EGSRFQNPNATTTCGCGSSFSI
ERPA_ACIB3      DSLSYQYLVGSVVDYV-EGL-EGSRFQNPNATTTCGCGSSFSI
ERPA_COXBU      DPLSLQYLQGAEIDYREDVSGAQFVIRNPNAKTTCGCGSSF--
ERPA_COXBR      DPLSLQYLQGAEIDYREDVSGAQFVIRNPNAKTTCGCGSSF--
ERPA_ACIBS      DSLSYQYLVGSVVDYV-EGL-EGSRFQNPNATTTCGCGSSFSI
ERPA_ACIAC      DAMSYQYLVGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFSV
ERPA_VEREI      DAMSYQYLVGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSF--
ERPA_PSEHT      DPMSLQYLVDGEVDYT-EGL-EGARFTNPHATTTCGCGSSFTI
ERPA_DELAS      DAMSYQYLVGAEIDYKEDLQGAQFVIKNPNASTTCGCGSSFSV
ERPA_COXBN      DPLSLQYLQGAEIDYHEDVSGAQFVIRNPNAKTTCGCGSSF--
ERPA_THIDA      DSMSFQYLVGAEIDYS-EGL-EGAQFKNPNATTTCGCGSSF--
ERPA_ACIAD      DSLSYQYLVGSVVDYI-EGL-EGSRFQNPNATTTCGCGSSFSI
ERPA_JANMA      DSMSYQYLVGAEIDYKDDLEGAQFVIKNPNATTTCGCGSSF--
ERPA_HERAR      DSMSYQYLVGAEIDYKDDLEGAQFVIKNPNATTTCGCGSSF--
ERPA_RHOFD      DAMSYQYLVGAEIDYKEDLEGAQFVIKNPNATTTCGCGSSF--
ERPA_POLSJ      DAMSYQYLVGAEIDYKDDLEGAQFVIKNPNATSTCGCGSSF--
ERPA_NITOC      DPTSYQYLVGAEIDYT-EGL-EGAQFRNPNAETTCGCGSSF--
ERPA_LEGPL      DSMSYQYLHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSI
ERPA_LEGPH      DSMSYQYLHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSI
ERPA_HAMD5      DPLSLGYLIGGIVDYVESIEYSRFIVKNLNAKTTCGCGSSFSV
ERPA_SACD2      DAMSYPYLVGAQVDY-EEGL-KGSKFANPNASTTCGCGSSFSI
YCF83_PORPU     DPKXXXXXXXXXXXXXXXXIGGGFQFSNPNASQTCGCGKSF--
ERPA_WIGBR      DSISLQYLIGGVVDYKEELLESCFFVINPNAKTTCSCGTSFSI
ISA2_SCHPO      DNISLPLISGSEIEYTNELIGSSFQLNNPRAKTSCGCNVSFDV
ERPA1_METCA     DPTSLQYLQGAEIDY-QEGL-EGSRFKNPN-------------
ERPA_RALPJ      DSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV
ERPA_RALSO      DSMSYQYLVGAEIDYKEDINGAQFVIKNPNASTTCGCGSSFSV
ERPA_LEGPC      DSMSYQYLHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSI
ERPA_LEGPA      DSMSYQYLHDAEIDYIKGIQGEQFVIRNPNAKTTCGCGSSFSI
ERPA_ALTMD      DPMSLQXXXXXXXXXXXXXXXSRFLVQNPNATTTCGCGASFSV
ERPA2_BURVG     DAMSRQYLAGARVDY-EDGL-EGSRFQNPNAQSTCGCGSSFSV
YNIU_AZOBR      DPTSQPFLTXXXXXXXXXXXXXXXKFDNPNATGSCGCGKSF--
ERPA_METPP      DAMSLQYLVGAEIDYKEDLEGAQFVIKNPN-------------
YNIU_FRAAL      HTTGVDLLRGMRVDYTETLTSSGFTFANPNAK-----------
NFUA_SHESH      DEKSAPFLEEASIDFVTDQLGSQLTLKAPNAK-----------
ERPA1_POLNA     DAMSYQYLVGAEIDYKDDLEGAQFVIKNPN-------------
NFUA_TOLAT      DPNSAPFLEEAAIDFISDQMGSQLTLKAPNAK-----------
NFUA_SHEHH      DEKSAPFLEEATIDFVTDQLGSQLTLKAPNAK-----------
NFUA_AERS4      DPLSAPYLVDATIDFVTDQMGSQLTLKAPNAK-----------
NFUA_AERHH      DPLSAPFLVDATIDFVTDQMGSQLTLKAPNAK-----------
NFUA_ACTPJ      DEISLPFLDEAEIDYVTDPMGSQLTLKAPNAK-----------
NFUA_ACTP7      DEISLPFLDEAEIDYVTDPMGSQLTLKAPNAK-----------
NFUA_ACTP2      DEISLPFLDEAEIDYVTDPMGSQLTLKAPNAK-----------
NFUA_PSEA6      DAESAPFLSEAEIDFVTDQMGSQLTLKAPNAK-----------
NFUA_ALTMD      DEESAPYLDEAEIDYVTDQMGSQLTLKAPNAK-----------
ERPA_BUCCC      XXXXXQYLLGGKIDYIENLEGSKFVISNPNAKRTCGCGLSFSI
NFUA_SHEWM      DEKSAPFLEDATIDFVTDQLGSQLTLKAPNAK-----------
NFUA_SHEDO      DAKSVAYLEDASIDFVTDQLGSQLTLKAPNAK-----------
NFUA_SHEPW      DEKSAPFLEEATIDFVTDQLGSQLTLKAPNAK-----------
NFUA_SHEPA      DEKSAPFLEEATIDFVTDQLGSQLTLKAPNAK-----------
ERPA_BUCBP      ---SLQYLRGGQIDYIENLEGSKFIILNPKAKHTCGCGSSFSI
NFUA_SHESR      DEKSAPFLEEASIDFVTDQLGSQLTLKAPNAK-----------
NFUA_SHESM      DEKSAPFLEEASIDFVTDQLGSQLTLKAPNAK-----------
NFUA_SHESA      DEKSAPFLEEASIDFVTDQLGSQLTLKAPNAK-----------
NFUA_SHELP      DEKSAPFLEDASIDFVTDQLGSQLTLKAPNAK-----------
NFUA_PSEHT      DAESAPFLEDAEIDFVTDKMGTQLTLKAPNAK-----------
NFUA_SHESW      DEKSAPFLEEATIDFVTDQLGSQLTLKAPNAK-----------
NFUA_SHEPC      DEKSAPFLEEATIDFVTDQLGSQLTLKAPNAK-----------
NFUA_IDILO      DSGSAPFLEDAAIDFEEQEMGSQLTLKAPNAK-----------
NFUA_EDWI9      DEISAPFLDDAEIDFVTDQLGSQLTLKAPNAK-----------
NFUA_PECCP      DELSAPYLEDAEIDFVTDQLGSQLTLKAPNAK-----------
NFUA_SHEB9      DEKSAPFLEDATIDFVTDQLGSQLTLKAPNAK-----------
NFUA_SHEB8      DEKSAPFLEDATIDFVTDQLGSQLTLKAPNAK-----------
NFUA_SHEB5      DEKSAPFLEDATIDFVTDQLGSQLTLKAPNAK-----------
NFUA_SHEB2      DEKSAPFLEDATIDFVTDQLGSQLTLKAPNAK-----------
NFUA_PROMH      DDISAPFLEDAEIDFVTDQLGSQLTLKAPNAK-----------