[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07921.1

[Show Plain Result]


## Summary of Sequence Search
    1::256
   28::244     1e-31  37%  249 aa  BZRD_BACCE RecName: Full=Benzil reductase;         EC=1.1.1.n7;
   73::229     4e-26  40%  243 aa  BZRD_BACSU RecName: Full=Benzil reductase;         EC=1.1.1.n7;
   31::225     7e-18  33%  247 aa  YB45_SCHPO RecName: Full=Uncharacterized oxidoreductase C30D10.05c;
   31::215     2e-13  31%  254 aa  YIV5_YEAST RecName: Full=Uncharacterized oxidoreductase YIR035C;   
   62::246     2e-12  34%  261 aa  SPRE_XENTR RecName: Full=Sepiapterin reductase;         Short=SPR; 
   83::227     7e-12  35%  263 aa  YIV6_YEAST RecName: Full=Uncharacterized oxidoreductase YIR036C;   
   49::251     7e-12  35%  262 aa  SPRE_MERUN RecName: Full=Sepiapterin reductase;         Short=SPR; 
   64::210     2e-11  33%  263 aa  SPRE_XENLA RecName: Full=Sepiapterin reductase;         Short=SPR; 
   95::250     1e-10  34%  261 aa  SPRE_HUMAN RecName: Full=Sepiapterin reductase;         Short=SPR; 
  151::251     9e-10  36%  262 aa  SPRE_RAT RecName: Full=Sepiapterin reductase;         Short=SPR;   
   33::223     3e-09  28%  248 aa  Y4EK_RHISN RecName: Full=Uncharacterized short-chain type
  151::251     1e-08  34%  261 aa  SPRE_MOUSE RecName: Full=Sepiapterin reductase;         Short=SPR; 
  156::256     2e-08  34%  267 aa  SPRE_BOVIN RecName: Full=Sepiapterin reductase;         Short=SPR; 
   67::188     4e-07  33%  236 aa  FABG_SCHPO RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   72::222     5e-07  29%  252 aa  DLTE_BACSU RecName: Full=Uncharacterized oxidoreductase dltE;      
   79::232     5e-07  29%  261 aa  DHG2_BACME RecName: Full=Glucose 1-dehydrogenase 2;       
   87::193     9e-07  34%  251 aa  DCXR_CAEEL RecName: Full=Probable L-xylulose reductase;       
   84::241     9e-07  25%  259 aa  CMTB_PSEPU RecName: Full=2,3-dihydroxy-2,3-dihydro-p-cumate
   84::241     9e-07  25%  259 aa  CMTB_PSEP1 RecName: Full=2,3-dihydroxy-2,3-dihydro-p-cumate
   50::232     3e-06  28%  259 aa  YI13_SCHPO RecName: Full=Uncharacterized oxidoreductase C521.03;   
   87::225     3e-06  31%  548 aa  Y4VI_RHISN RecName: Full=Uncharacterized short-chain type
   64::226     3e-06  25%  242 aa  FABG_HAEIN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   76::210     3e-06  31%  261 aa  DHG_BACME RecName: Full=Glucose 1-dehydrogenase;       
  136::255     6e-06  34%  330 aa  HSDL1_HUMAN RecName: Full=Hydroxysteroid dehydrogenase-like protein
  136::238     6e-06  34%  330 aa  HSDL1_BOVIN RecName: Full=Hydroxysteroid dehydrogenase-like protein
   38::228     6e-06  24%  248 aa  FABG_CHLPN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   39::196     8e-06  29%  263 aa  UCPA_ECOLI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   39::196     8e-06  29%  263 aa  UCPA_ECO57 RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   32::193     8e-06  23%  245 aa  NODG_RHIS3 RecName: Full=Nodulation protein G;
  148::255     8e-06  36%  330 aa  HSDL1_PONAB RecName: Full=Hydroxysteroid dehydrogenase-like protein
   76::210     8e-06  28%  261 aa  DHGA_BACME RecName: Full=Glucose 1-dehydrogenase A;       
   76::210     8e-06  30%  261 aa  DHG1_BACME RecName: Full=Glucose 1-dehydrogenase 1;       
   76::193     1e-05  29%  261 aa  DHG4_BACME RecName: Full=Glucose 1-dehydrogenase 4;       
   32::193     1e-05  23%  245 aa  NODG_RHIME RecName: Full=Nodulation protein G;AltName:
  158::242     2e-05  33%  267 aa  SPRE_DICDI RecName: Full=Sepiapterin reductase;         Short=SPR; 
   32::191     2e-05  27%  247 aa  FABG_PSEAE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   76::193     2e-05  29%  261 aa  DHG3_BACME RecName: Full=Glucose 1-dehydrogenase 3;       
  142::230     2e-05  36%  251 aa  YJDA_BACSU RecName: Full=Uncharacterized oxidoreductase yjdA;      
  115::282     2e-05  27%  325 aa  DRS7B_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   87::196     4e-05  31%  254 aa  YJNK_SCHPO RecName: Full=Uncharacterized oxidoreductase C24B10.20; 
   76::232     5e-05  28%  261 aa  DHG_BACSU RecName: Full=Glucose 1-dehydrogenase;       
   71::196     7e-05  29%  263 aa  UCPA_SALTY RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   71::196     7e-05  29%  263 aa  UCPA_SALTI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   55::198     7e-05  25%  248 aa  FABG_CHLTR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  219::282     7e-05  33%  378 aa  DHS5_CAEEL RecName: Full=Uncharacterized oxidoreductase dhs-5;     
   63::199     9e-05  26%  242 aa  YMFI_BACSU RecName: Full=Uncharacterized oxidoreductase ymfI;      
   70::191     9e-05  30%  253 aa  BACC2_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
  141::231     1e-04  36%  278 aa  FABG_YEAST RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   75::226     2e-04  29%  244 aa  FABG_VIBHA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   31::192     2e-04  24%  244 aa  FABG_SHIFL RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   31::192     2e-04  24%  244 aa  FABG_ECOLI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  126::208     2e-04  31%  248 aa  ENTA_ECOLI RecName: Full=2,3-dihydro-2,3-dihydroxybenzoate
  200::238     2e-04  44%  330 aa  HSDL1_RAT RecName: Full=Hydroxysteroid dehydrogenase-like protein
  200::238     2e-04  44%  330 aa  HSDL1_MOUSE RecName: Full=Hydroxysteroid dehydrogenase-like protein
   55::194     2e-04  26%  248 aa  FABG_CHLMU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   84::191     2e-04  30%  253 aa  BACC_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
   44::192     3e-04  26%  244 aa  NOG4_RHIME RecName: Full=Nodulation protein G;AltName:
  137::204     3e-04  35%  247 aa  FABG1_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  183::279     3e-04  30%  317 aa  DHRS7_ANOGA RecName: Full=Dehydrogenase/reductase SDR family
   95::241     3e-04  26%  260 aa  DHRS4_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
  150::212     3e-04  38%  305 aa  DHB3_MOUSE RecName: Full=Testosterone 17-beta-dehydrogenase 3;     
   33::193     3e-04  26%  236 aa  CBR4_RAT RecName: Full=Carbonyl reductase family member 4;       
  121::229     4e-04  28%  309 aa  DRS7B_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
   64::188     4e-04  23%  246 aa  DER_CHICK RecName: Full=D-erythrulose reductase;       
   65::189     4e-04  22%  237 aa  CBR4_BOVIN RecName: Full=Carbonyl reductase family member 4;       
   68::240     4e-04  26%  258 aa  BUTA_STAAW RecName: Full=Acetoin(diacetyl) reductase;       
   68::240     4e-04  26%  258 aa  BUTA_STAAS RecName: Full=Acetoin(diacetyl) reductase;       
   68::240     4e-04  26%  258 aa  BUTA_STAAR RecName: Full=Acetoin(diacetyl) reductase;       
   68::240     4e-04  26%  258 aa  BUTA_STAAN RecName: Full=Acetoin(diacetyl) reductase;       
   68::240     4e-04  26%  258 aa  BUTA_STAAM RecName: Full=Acetoin(diacetyl) reductase;       
   68::240     4e-04  26%  258 aa  BUTA_STAAC RecName: Full=Acetoin(diacetyl) reductase;       
   95::241     6e-04  25%  260 aa  DHRS4_PONAB RecName: Full=Dehydrogenase/reductase SDR family member
   95::241     6e-04  25%  260 aa  DHRS4_PIG RecName: Full=Dehydrogenase/reductase SDR family member
   65::186     6e-04  23%  244 aa  DCXR_RAT RecName: Full=L-xylulose reductase;         Short=XR;     
  128::189     6e-04  34%  244 aa  DCXR_MESAU RecName: Full=L-xylulose reductase;         Short=XR;   
   35::195     7e-04  24%  253 aa  YCP9_SCHPO RecName: Full=Uncharacterized oxidoreductase C663.09c;  
   80::189     7e-04  31%  241 aa  FABG_RICTY RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   80::189     7e-04  31%  241 aa  FABG_RICPR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   84::193     7e-04  33%  245 aa  FABG_BUCBP RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  113::250     7e-04  26%  323 aa  DRS7B_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
  105::221     0.001  30%  313 aa  DR9C7_BOVIN RecName: Full=Short chain dehydrogenase/reductase
  108::212     0.001  32%  306 aa  DHB3_RAT RecName: Full=Testosterone 17-beta-dehydrogenase 3;       
   70::192     0.001  26%  254 aa  BACC_BACAM RecName: Full=Bacilysin biosynthesis oxidoreductase
    1::256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRVIGVARSRNPELEAEATASGVRVAWHLQDLSQPGP
BZRD_BACCE      -----------------------------------VISISRRENKELTKLAEQYNSNCIFHSLDLQDVHN
BZRD_BACSU      ----------------------------------------------------------------------
YB45_SCHPO      ----------------------------------KVIAVSRSLTPELETLLIQNPDSFVHVKGDVTEVGK
YIV5_YEAST      -----------------------------------VYGVARSEAP-LKKLKEKYGDRFFYVVGDITEDSV
SPRE_XENTR      ------------------------------------------------------GVRVRWEAADL---GT
YIV6_YEAST      ----------------------------------------------------------------------
SPRE_MERUN      ------------------------------------------RRLEEELGAQQPGLRVVRAAADL---GT
SPRE_XENLA      ------------------------------------------------------GVRVRWAAADLSTTEG
SPRE_HUMAN      ----------------------------------------------------------------------
SPRE_RAT        ----------------------------------------------------------------------
Y4EK_RHISN      ----------------------------------RVLALGRDRAALDELHSTAGIVPVVFDLSDVSEVGK
SPRE_MOUSE      ----------------------------------------------------------------------
SPRE_BOVIN      ----------------------------------------------------------------------
FABG_SCHPO      ----------------------------------------------------------------------
DLTE_BACSU      ----------------------------------------------------------------------
DHG2_BACME      ----------------------------------------------------------------------
DCXR_CAEEL      ----------------------------------------------------------------------
CMTB_PSEPU      ----------------------------------------------------------------------
CMTB_PSEP1      ----------------------------------------------------------------------
YI13_SCHPO      ---------------------------------------------ELESKYEVSVLPLKLDVSDLKS---
Y4VI_RHISN      ----------------------------------------------------------------------
FABG_HAEIN      ----------------------------------------------------------------------
DHG_BACME       ----------------------------------------------------------------------
HSDL1_HUMAN     ----------------------------------------------------------------------
HSDL1_BOVIN     ----------------------------------------------------------------------
FABG_CHLPN      -------------------------------------GLNEERGQAVIESLTGLGGEVSFARVDVSHNGG
UCPA_ECOLI      -------------------------------------------SPEIEKELCGRGHRCTAVVADVRDPAS
UCPA_ECO57      -------------------------------------------SPEIEKELCGRGHRCTAVVADVRDPAS
NODG_RHIS3      -----------------------------------IVGLHGTRVEKLETLAAELGDRVKLFPANLSNRDE
HSDL1_PONAB     ----------------------------------------------------------------------
DHGA_BACME      ----------------------------------------------------------------------
DHG1_BACME      ----------------------------------------------------------------------
DHG4_BACME      ----------------------------------------------------------------------
NODG_RHIME      -----------------------------------IVGLHGTQIEKLETLATELGDRVKLFPANLANRDE
SPRE_DICDI      ----------------------------------------------------------------------
FABG_PSEAE      -----------------------------------VIGTATSASGAEKIAETANGVEGAGLVLDVS----
DHG3_BACME      ----------------------------------------------------------------------
YJDA_BACSU      ----------------------------------------------------------------------
DRS7B_BOVIN     ---------------------------------------------------------------DLADPGA
YJNK_SCHPO      ----------------------------------------------------------------------
DHG_BACSU       ----------------------------------------------------------------------
UCPA_SALTY      ----------------------------------------------------------------------
UCPA_SALTI      ----------------------------------------------------------------------
FABG_CHLTR      -----------------------------------------------------TGRQVSFALVDVSKNDM
DHS5_CAEEL      ----------------------------------------------------------------------
YMFI_BACSU      ----------------------------------------------------------------------
BACC2_BACSU     ----------------------------------------------------------------------
FABG_YEAST      ----------------------------------------------------------------------
FABG_VIBHA      ----------------------------------------------------------------------
FABG_SHIFL      ----------------------------------KVIGTATSENGA-QAISDYLGANGKGLMLNVTDPAS
FABG_ECOLI      ----------------------------------KVIGTATSENGA-QAISDYLGANGKGLMLNVTDPAS
ENTA_ECOLI      ----------------------------------------------------------------------
HSDL1_RAT       ----------------------------------------------------------------------
HSDL1_MOUSE     ----------------------------------------------------------------------
FABG_CHLMU      -----------------------------------------------------TGSKVSFALVDVSKNDM
BACC_BACSU      ----------------------------------------------------------------------
NOG4_RHIME      ------------------------------------------RHWQLSLETGSSCSRLIWPIETKSR---
FABG1_SYNY3     ----------------------------------------------------------------------
DHRS7_ANOGA     ----------------------------------------------------------------------
DHRS4_HUMAN     ----------------------------------------------------------------------
DHB3_MOUSE      ----------------------------------------------------------------------
CBR4_RAT        -----------------------------------------ARNLEV-AKATASGIHLAFRCNIAKE---
DRS7B_DANRE     ----------------------------------------------------------------------
DER_CHICK       ----------------------------------------------------------------------
CBR4_BOVIN      ----------------------------------------------------------------------
BUTA_STAAW      ----------------------------------------------------------------------
BUTA_STAAS      ----------------------------------------------------------------------
BUTA_STAAR      ----------------------------------------------------------------------
BUTA_STAAN      ----------------------------------------------------------------------
BUTA_STAAM      ----------------------------------------------------------------------
BUTA_STAAC      ----------------------------------------------------------------------
DHRS4_PONAB     ----------------------------------------------------------------------
DHRS4_PIG       ----------------------------------------------------------------------
DCXR_RAT        ----------------------------------------------------------------------
DCXR_MESAU      ----------------------------------------------------------------------
YCP9_SCHPO      --------------------------------------------------ASARKPEAATELQEWSKSHP
FABG_RICTY      ----------------------------------------------------------------------
FABG_RICPR      ----------------------------------------------------------------------
FABG_BUCBP      ----------------------------------------------------------------------
DRS7B_MOUSE     ---------------------------------------------------------------DLADPGT
DR9C7_BOVIN     ----------------------------------------------------------------------
DHB3_RAT        ----------------------------------------------------------------------
BACC_BACAM      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SAGWLASVLDAVEEAPASITLILNAGVVEPIGPITQLHDSTLVPHLQTNLVTPMTMTGAFIEHTVRFDCP
BZRD_BACCE      LETNFKEIISSIEDNVSSIHLINNAGTVAPMKPIEKAESEQFITNVHINLLAPMILTSTFMKHTKEWKVD
BZRD_BACSU      ----------------SGITLINNAGMVTPIKRAGEASLDELQRHYQLNLTAPVLLSQLFTKRFASYSGK
YB45_SCHPO      -----ASIETAIKKFGKLDSVILNAGVLEPIAKIADADINEWRKLFDINFFSVVETVKYAIPHLRK--TK
YIV5_YEAST      ----LKQLVNAAVKGHGKISLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLVGIALPELKKTN--
SPRE_XENTR      SEGVSAAVRAAGEGAAQKLLIINNAG---SIGDVSKMFPKEVTDYMMFNVSSPLCLTASLLKTFPRRDLQ
YIV6_YEAST      --------------------IVANAGMLEPVKSISQSHDIKQWERLDVNFFSIVSLVALCLPLLKSSPFV
SPRE_MERUN      EAG-LRQVLRAVRELPKPLLLINNAGTLGDVSKVLNVNDPAEVNNYWANLTSMLCLTSGTLNAFP--DSP
SPRE_XENLA      VSATVRAARELQAGTAHRLLIINNAG---SIGDVSKMFVDFSAPYMKFNVSSPLCLTASLLKTFPRRDLQ
SPRE_HUMAN      ------------------LLLINNAGSLGDVSKFVDLSDSTQVNNYWANLTSMLCLTSSVLKAFP--DSP
SPRE_RAT        ----------------------------------------------------------------------
Y4EK_RHISN      IAGEKIDV------------LVNNAGLLTASASLVDLSEDDIDAMIDINIRSVFKLTRHVLKQMIERRRG
SPRE_MOUSE      ----------------------------------------------------------------------
SPRE_BOVIN      ----------------------------------------------------------------------
FABG_SCHPO      ----LKSIFESVE-----IDTVVHAAGVLQSSLCVRTSEKEIDSIICTNLVSAIKLSKMAILEWFRSERD
DLTE_BACSU      ----------ALKEYPNLNVLVNNAGIQKEID-FKKGTEELFVDEIELNFQAPVHLSALFTPHLMK-QPE
DHG2_BACME      ----------AVKEFGSLDVMINNAGVENPV-PSHELSLENWNQVIDTNLTGAFLGSREAIKYFVENDIK
DCXR_CAEEL      --------------------LVNNAGIAHAIGQITQQSDRTFAVNVRGPILIAQLVARNFVDRQIK----
CMTB_PSEPU      ----------AAVERFGSVQILVNCAGGGVIRPFLEHTPETLKATIDRNLWTALWCSRVFLPDMLARQYG
CMTB_PSEP1      ----------AAVERFGSVQILVNCAGGGVIRPFLEHTPETLKATIDRNLWTALWCSRVFLPDMLARQYG
YI13_SCHPO      ----IPGVIESLPKEFADIVLINNAGLALGTDKVIDLNIDDAVTMITTNVLGMMAMTRAVLP---IFYSK
Y4VI_RHISN      --------------------LVNNAG----IGPTMAATADTALEDFQRALAINLVGAYSVACETAKLMKP
FABG_HAEIN      ----IETLLEQIKNDFGDIDILVNNAGITRDNLLMRMKDEEWFDIMQTNLTSVYHLSKAMLRSMMKKRFG
DHG_BACME       -------VQSAIKEFGKLDVMINNAGLENPVSS----HEMSLS---DWNKVIDTNLTGAFIKYFVENDIK
HSDL1_HUMAN     -------IREALKDKDVGI-LVNNVGVFYPYPQFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVE----
HSDL1_BOVIN     -------IREALQDRDIGI-LVNNVGVFYPYPQFTQVSEDTLWDIVNVNIAAASLMVHIVLPGMVE----
FABG_CHLPN      VKDCVQKFLDKHNKIDI---LVNNAGITRD-NLLMRMSEDDWQSVISTNLTSLYYTCSSVIRHMIKARSG
UCPA_ECOLI      VA---AAIKRAKEKEGRIDILVNNAGVCR-LGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMIARKDG
UCPA_ECO57      VA---AAIKRAKEKEGRIDILVNNAGVCR-LGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMIARKDG
NODG_RHIS3      ----VKALGQKAEADLEGVDILVNNAGITKDGLFVRMSDADWDTVLEVNLTAVFRLTRE-LTHPMMRRRH
HSDL1_PONAB     --------------------LVNNVGVFYPYPQFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVE----
DHGA_BACME      -------VQTAIKEFGTLDVMINNAGVENPV-PSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIK
DHG1_BACME      -------VQSSIKEFGKLDVMINNAGMENPVSS----HEMSLS---DWNKVIDTNLTGAFIKYFVENDIK
DHG4_BACME      -------VQTAIKEFGTLDVMINNAGVENPV-PSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIK
NODG_RHIME      ----VKALGQRAEADLEGVDILVNNAGITKDGLFLHMADPDWDIVLEVNLTAMFRLTREITQQMIRRRNG
SPRE_DICDI      ----------------------------------------------------------------------
FABG_PSEAE      SDESVAATLEHIQQHLGQPLIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWG
DHG3_BACME      -------VQTAIKEFGTLDVMINNAGVENPV-PSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIK
YJDA_BACSU      ----------------------------------------------------------------------
DRS7B_BOVIN     IAGAASEILQCFGHVDV---LINNAGISYR-GAIVDTSPDVDKRVMETNYFGPVALTKALLPAMIRRR-Q
YJNK_SCHPO      --------------------LWVNSGISKSFQPVLKTSDELWMSHYQTNVLGPIHVYQAFY-HLLKEGKL
DHG_BACSU       -------VQTAIKEFGTLDIMINNAGLENPV-------PSHEMPLKDWDKVIGTNLTGAFIKYFVENDIK
UCPA_SALTY      -----AAVARAKETEGRIDILVNNAGVCR-LGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDG
UCPA_SALTI      -----AAVARAKETEGRIDILVNNAGVCR-LGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDG
FABG_CHLTR      VS---AQVQNFLAEYNTIDVIVNNAGITRD-ALLMRMSEEEWSSVINTNLGSIYNVCSAVIRPMIKARSG
DHS5_CAEEL      ----------------------------------------------------------------------
YMFI_BACSU      ------SAQDGADKLTSSIVIVLNSGRSH-FGLITDVDNATVQEMVQLHVASPYMLTRNLLPGMIR-NKS
BACC2_BACSU     ------AIRSAVDKFGGLDVLINNAGI-EIVAPIHEMELSNW------NKVLNVNLTGMFLKHALKYMLK
FABG_YEAST      ---------------------------------------------MNVNFMSPVTMTNICIKYMMKSQ--
FABG_VIBHA      ------------DECGAIDILVNNAGITRD-NLLMRMKDDEWNDIINTNLTPIYRMSKAVLRGMMKKRAG
FABG_SHIFL      ----IESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHG
FABG_ECOLI      ----IESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHG
ENTA_ECOLI      ----------------------------------------------------------------------
HSDL1_RAT       ----------------------------------------------------------------------
HSDL1_MOUSE     ----------------------------------------------------------------------
FABG_CHLMU      VS---AQVQKFLAEYGTIDVVVNNAGITRD-SLLMRMSEEEWSSVIDTNLGSIYNVCSAVIRPMIKARSG
BACC_BACSU      --------------------LINNAGI-EIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKG
NOG4_RHIME      -----RLVRERKPILKASTSWSTNAGITKD-GLFLHMADPDWDIVLEVNLTAMFRLTREITQQMIRRRNG
FABG1_SYNY3     ----------------------------------------------------------------------
DHRS7_ANOGA     ----------------------------------------------------------------------
DHRS4_HUMAN     --------------------LVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEK-RXX
DHB3_MOUSE      ---------------------------------------------IHCNITSVVKMTQLVLKH---MESR
CBR4_RAT        --GDVHSTFEEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMLSQLHTNLLGTMLTCRAAMRTMIQQXXX
DRS7B_DANRE     ------------------VDVLINIAGVSYRGNILDTHVSVQREVMETNYFGPVALTQAILPSMVDRGSG
DER_CHICK       -ADWDAT--EAAVGAAGPFELLVNNAAVAMLQPFLQVTREAVERSFDVNFRAVLHVSQIVARQMIAQGLP
CBR4_BOVIN      ------NTFEEIEKNLGRVNFLVNAAGINRDNLLVRTNTEDMLSQLHTNLLGSMLTCRAALKTMIKQQ-R
BUTA_STAAW      -------VFNAVRQTAAQFVMVNNAGL-GPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHG
BUTA_STAAS      -------VFNAVRQTAAQFVMVNNAGL-GPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHG
BUTA_STAAR      -------VFNAVRQTAAQFVMVNNAGL-GPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHG
BUTA_STAAN      -------VFNAVRQTAAQFVMVNNAGL-GPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHG
BUTA_STAAM      -------VFNAVRQTAAQFVMVNNAGL-GPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHG
BUTA_STAAC      -------VFNAVRQTAAQFVMVNNAGL-GPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHG
DHRS4_PONAB     --------------------LVSNAAVNPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEK-RXX
DHRS4_PIG       --------------------LVSNAAVNPFFGNIIDATEEVWDKILHVNVKATVLMTKAVVPEMEK-RXX
DCXR_RAT        ---------EATEQALSNVDLLVNNAAVATLQPFLEVTKEACDTSFNVNFRAVVQVSQIVARGMIARGVP
DCXR_MESAU      ---------------------------------------------------------------------P
YCP9_SCHPO      NVKTVVTSQQSANEAAQSVALWLNSGICQSYYTVMEAPEEVWNAHYQTNVLGPIHVFKAFYPLLTKKKTR
FABG_RICTY      --------------------LVCNAGITSDTLAI-RMKDQDFDKVIDINLKANFILNREAIKKMIQKRYG
FABG_RICPR      --------------------LVCNAGITSDTLAI-RMKDQDFDKVIDINLKANFILNREAIKKMIQKRYG
FABG_BUCBP      --------------------LINNAGIIRDINMKTQDWNSVL----NVNLNSIFYMSKSVIRNMIK-NKQ
DRS7B_MOUSE     IAAAAAEILQCF----GYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKALLPSMVE----
DR9C7_BOVIN     --------------------LVNNAGVGLPSGPNEWLTKEDFVKVINVNLVGLIEVTLHMLPMVKK--AR
DHB3_RAT        -------IYDHIEEQLKGLVLVNNVGMLPNLLPLSTSGESQSVIHC--NITSVVKMTQLVLKH---MESR
BACC_BACAM      ------AILSAVDKFGGLDVLINNAGI-EIVAPIHEMELSDWNKVLNVNLTGMFLMSKHALKYMLKSGKG


                         +         .         .         .         .         *         .:210
query           RKVLAISSGAARNPVPGWSAYCAGKAGLDMFIRSVNTEYASVPEPRTLRAVALAPGVVDTGMQETIRGAD
BZRD_BACCE      KRVINISSGAGKNPYFGWGAYCTTKAGVNMFTQCVATE--EVEKEYPVKIVAFAPGVVDTNMQAQIRETD
BZRD_BACSU      KTVVNITSGAAKNPYKGWSAYCSSKAGLDMFTRTFGFEQED--EELPVNMISFSPGVMDTEMQAVIRSSD
YB45_SCHPO      GTIVIVSSGAAVRVFPAWAAYCCSKAAINMLVMNLGSE-----EP-DIMSVAVRPGVVDTPMQVSIRNDS
YIV5_YEAST      GNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE------ERQVKAIAVAPGIVDTDMQVNIRSMS
SPRE_XENTR      RVVVNVSSLAALQPFKSWALYCSGKAARDMIFRVL------AEEEKDVRVLNYAPGPLDTDMHVVARTAD
YIV6_YEAST      GNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPS----DKVRAVCIAPGVVDTQMQKDIRGMT
SPRE_MERUN      KTVVNISSLCALQPFKGWGLYCTGKAARDMLCQVLAAEEPSV------RVLSYAPGPLDTDMQQLARSMD
SPRE_XENLA      RLVVNVSSLAALQPYKSWVLYCSGKAARDMMFRVLAEEEDDV------RVLSYAPGPLDTDMHE------
SPRE_HUMAN      RTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALE-----EP-NVRVLNYAPGPLDTDMQQLARSVD
SPRE_RAT        KTVVNISSLCALQPFKGWGLYCAGKAARDMLYQVLAVEEPSV------RVLSYAPGPLDTNMQQLARSMD
Y4EK_RHISN      HIFFTGSSGGLA-PHPNSSVYGATKAAVSLFSSALRCDLIGLP----IRVTELFPGRVETNLYRTALGKE
SPRE_MOUSE      KTVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSV------RVLSYAPGPLDNDMQQLARSKD
SPRE_BOVIN      RTVVNISSICALQPFKGWGLYCAGKAARNMMFQVLAAEEPSV------RVLSYGPGPLDTDMQQLARSVD
FABG_SCHPO      RLILNISSRLSTYALPGTSVYAASKAGLESFTKVLAAEVAS----KGIRVNAISPGYVDTPM--------
DLTE_BACSU      AAIVQVTSGLAFNPLAVYPVYCATKAALHSFSLTLRHQLRDT----SVEVIEMAPPMVDTGLNQTYRGIS
DHG2_BACME      GNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYA----PKGIRVNNIGPGAIDT----PINAEK
DCXR_CAEEL      GSIVNISSQAAIRPLDNHTVYCASKAALDMVTRCLANELGS----QNIRVNSVNPTVVMTDM--------
CMTB_PSEPU      R-IINIGADSVRNGLPDHAAYNAAKGGMHGLTTGLAREFAR----QGVTVNTVAPCAVNTEVWVRIKNAN
CMTB_PSEP1      R-IINIGADSVRNGLPDHAAYNAAKGGMHGLTTGLAREFAR----QGVTVNTVAPCAVNTEVWVRIKNAN
YI13_SCHPO      NKILNVGSIAGRESYVGGSVYCSTKSALAQFTSALRKETIDT----RIRIMEVDPGLVETEFSVVRFHGD
Y4VI_RHISN      AAIVNVASLAGLLGNPKRSAYAASKAGLISITKSLACRWAS----RGIRVTAVAPGHVRTPMVAELERAG
FABG_HAEIN      R-IINIGSVVGSTGNPGQTNYCAAKAGVVGFSKSLAKEVAA----RGITVNVVAPGFIATDMTEVLTDEQ
DHG_BACME       GTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYA----PKGIRVNNIGPGAINT----PINAEK
HSDL1_HUMAN     RKIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYAS----KGIFVQSLIPFYVATSM--------
HSDL1_BOVIN     RKIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYAS-----------------------------
FABG_CHLPN      -SIINVASIVAKIGSAGQTNYAAAKAGIIAFTKSLAKEVAA----RNIRVNCLAPGFIETDMTSVLN--D
UCPA_ECOLI      RIVMMSSVTGDMVADPGETAYALTKAAIVGLTKSLAVEYAQ----SGIRVNAICPGYVRTPMAESI----
UCPA_ECO57      RIVMMSSVTGDMVADPGETAYALTKAAIVGLTKSLAVEYAQ----SGIRVNAICPGYVRTPMAESI----
NODG_RHIS3      GRIINITSVVGVTGNPGQTNYCASKAGMIGFSKSLAQEIAT----RNITVNCVAPGFIESAMTDKL----
HSDL1_PONAB     RKIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYAS----KGIFVQSLIPFYVATSM--------
DHGA_BACME      GNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYA----PKGIRVNNIGPGAMNT----PINAEK
DHG1_BACME      GTVINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYA----PKGIRVNNIGPGAINT----PINAEK
DHG4_BACME      GNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYA----PKGIRVNNIGPGAMNT----------
NODG_RHIME      R-IINVTSVAGAIGNPGQTNYCASKAGMIGFSKSLAQEIAT----RNITVNCVAPGFIESAMTDKL----
SPRE_DICDI      ------SSLCAIKAFPTWSLYCSSRAYRDMFFQALSLEYKLNDKFKVLN---YSLGVLDTDMQSQVREEC
FABG_PSEAE      R-IINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGS----RAITVNAVAPGFIDTDM--------
DHG3_BACME      GNVINMSSVHEMIPWPLFVHYAASKGGMKQMTETLALEYA----PKGIRVNNIGPGAMNT----------
YJDA_BACSU      -RIINMTSGQDLGPLPGELAYAATKGAISAFTRSLSQELA----PLGITVNAVNPGPTDTWMTDEIRNFL
DRS7B_BOVIN     GHVVAISSIQGKISLPFRSAYAASKHATQAFFDCLRAEV----EQHDIEVTVISPGYIHTNLSLNAVTAD
YJNK_SCHPO      KNIVFTSSMAAGGVRPNYSAYGQSKAALNYTMKEISFEL----EKDGFVVVSIHPGVVNTDM--------
DHG_BACSU       GNVINMSSVHEVIPWPLFVHYAASKGGIKLMTETLALEYA----PKGIRVNNIGPGAINTPINAE-KFAD
UCPA_SALTY      RIVMMSSVTGDMVADPGETAYALSKAAIVGLTKSLAVEYAQ----SGIRVNAICPGYVRTPMAESI----
UCPA_SALTI      RIVMMSSVTGDMVADPGETAYALSKAAIVGLTKSLAVEYAQ----SGIRVNAICPGYVRTPMAESI----
FABG_CHLTR      A-IINISSIVGLRGSPGQTNYAAAKAGIIGFSKALSKEVGS----KNIRVNCIAPGFIDTDMTKSL----
DHS5_CAEEL      -QIVVLSSSQGVRPIPMLAAYCATKALMTFLCESIDREYS------TINVQTLIPALVATKMTYYTKGST
YMFI_BACSU      GAIVAVSSIWGETGASCEVLYSMAKGAQHSFVKGLAKELA----PSGIRVNAVAPGAVDTNMMNQFTPAE
BACC2_BACSU     SGKGNIINTCSVGGVVAWPAYNASKGGVLQLTRSMAVDYAK----HNIRVNCVCPGIIDTPLNE------
FABG_YEAST      RRWPELSGQSARPTVPGTSVYSASKAALSRFTEVLAAEM----EPRNIRCFTISPGLV------------
FABG_VIBHA      R-IINVGSVVGTMGNAGQTNYAAAKAGVIGFTKSMAREVAS----RGVTVNTVAPGFIETDMTKALRAAT
FABG_SHIFL      R-IITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVAS----RGITVNVVAPGFIETDMTRAL----
FABG_ECOLI      R-IITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVAS----RGITVNVVAPGFIETDMTRAL----
ENTA_ECOLI      --IVTVASDAAHTPRIGMSAYGXXXXXXXXXXXXVGLELAG----SGVRCNVVSPGSTDTDMQRTLWVSD
HSDL1_RAT       --IVTVSSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYAS-----------------------------
HSDL1_MOUSE     --IVTVSSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYAS-----------------------------
FABG_CHLMU      A-IVNISSIVGLRGSPGQTNYAAAKAGIIGFSKALSKEVGS----KNIRVNCIAPGFIDTDM--------
BACC_BACSU      NIINTCSVGGL-VAWPDIPAYNASKGGVLQLTKSMAVDYAK----HQIRVNCVCPGIIDTPLNE------
NOG4_RHIME      R-IINVTSVAGAIGNPGQTNYCASKAGMIGFSKSWRRR-----STRNITVNCVAPGFIESAMTDKL----
FABG1_SYNY3     -RIINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELAS----RGVTVNAVAPGFIATDMTENLNAEP
DHRS7_ANOGA     -RIVSISSVQGKFAIPHRSAYSASKHAMQAFCDSLRAEVAK----DNIKVTLISPGYINTALSLTGTGAS
DHRS4_HUMAN     XXXXXXXXXAAFSPSPGFSPYNVSXXXXXXXXXXXXIELA----PRNIRVNCLAPGLIKTSFSRML-WMD
DHB3_MOUSE      RKILNISSGAALRPWPLYSLYSASKAFVYTFSKALSVEY-------------------------------
CBR4_RAT        XXXXXXXXXLKGNV--GQAAYSATKGGLIGFSRSLAKEVAR----KKIRVNVVAPGFIHTDMTKHLKEEH
DRS7B_DANRE     H-IVVISSVQGKISIPYRSAYAASKHAMQAYYDCLRAEVDSL----GLHVSVLSPGYVRTNM--------
DER_CHICK       GAIVNVSSQASQRALRDHAVYCSTKSALDMLSKVMAMELG----PHKIRVNTVNPTVVMTDM--------
CBR4_BOVIN      GSIVNVGSVVGLKGNSGQSVYSASKGGLVGFSRALAKEVAK----KKIRVNVVAPGFIHTDMTKDL----
BUTA_STAAW      GKIINATSQAGVEGNPGLSLYCSTK----FAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVAT
BUTA_STAAS      GKIINATSQAGVEGNPGLSLYCSTK----FAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVAT
BUTA_STAAR      GKIINATSQAGVEGNPGLSLYCSTK----FAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVAT
BUTA_STAAN      GKIINATSQAGVEGNPGLSLYCSTK----FAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVAT
BUTA_STAAM      GKIINATSQAGVEGNPGLSLYCSTK----FAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVAT
BUTA_STAAC      GKIINATSQAGVEGNPGLSLYCSTK----FAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVAT
DHRS4_PONAB     XXXXXXXXXAAFSPSPGFSPYNVSXXXXXXXXXXXXIELA----PRNIRVNCLAPGLIKTSFSRML-WMD
DHRS4_PIG       XXXXXXXXXXAYHPFPNLGPYNVSKTALLGLTKNLAVELA----PRNIRVNCLAPGLIKTNFSQVL-WMD
DCXR_RAT        GAIVNVSSQASQRALTNHTVYCSTKGALDMLTKVMALELG----PHKIRVNAVNPTVVMTPM--------
DCXR_MESAU      GAIVNVSSQASQRALANHSVYCSTKGALDMLTKMMALELG----PHKIRVNAVNPTVVMTSMGRT-----
YCP9_SCHPO      QVIFTSSECGSMGDATGFSAYGQSKAAINFTMKELSVELAD----EHFTFISIHPGVVKTDM--------
FABG_RICTY      R-IINISSGIAGNP--GQANYCASKAGLIGMTKSLSYEVAT----RGITVNAVAPGFIKSDMTDKL----
FABG_RICPR      R-IINISSGIAGNP--GQANYCASKAGLIGMTKSLSYEVAT----RGITVNAVAPGFIKSDMTDKL----
FABG_BUCBP      GKIITIGSVIAHIGNCGQTNYSAAKLGLVGFHKSLALELA----PKGITVNMIAPGLIKTGMTNNL----
DRS7B_MOUSE     RKIVAISSIQGKISIPFRSAYSASKHATQAFFDCLRAEM----EEANIKVTVISPGYIHTNLSVNAVTAD
DR9C7_BOVIN     GRVVNMSSSGGRVAVIG-GGYCISKFGVEAFSDSIRRELVSIIEPGNFRTAILGKDGLEKHMRK------
DHB3_RAT        RRILNISSGVGVRPWPLYSLYSASKAFVCTFSKALNVEY-------------------------------
BACC_BACAM      NIINTCSVGGAWPDIPAYNASKGGVLQTDAFYRP------SIIAKHNIRVNCVCPGIIDTPLNE------


                         .         .         .         +         .         .         .:280
query           FAQVQRFRDLKDNEQLASPDDTARRIVAYLARPDFGTTELxxxxxx
BZRD_BACCE      FTNLDRFIALKEEGKLLSPEYVAKAIRNLLETEEFPQGEV------
BZRD_BACSU      FHHIERFRKLNETGSLRSPDFIAGTLLSLLEK--------------
YB45_SCHPO      NKEAMGFKELKTSGQLVAPQDIAKAL--------------------
YIV5_YEAST      AEQLKMFRGLKENNQL------------------------------
SPRE_XENTR      -PELRRFMDRKEKGKMVDIQVSAKKMLDLL----------------
YIV6_YEAST      PKALERFTQLYKTSSLLDP---------------------------
SPRE_MERUN      PELRNRLQRLKSEGELVDCGTSAQKLLNLLQKDTF-----------
SPRE_XENLA      ----------------------------------------------
SPRE_HUMAN      PDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEF-----------
SPRE_RAT        PELRSRLQKLNSEGELVDCGTSAQKLLSLLQRDTF-----------
Y4EK_RHISN      GAK----KKLYDDNEAIQPEHMARLLRTALELPDF-----------
SPRE_MOUSE      PELRSKLQKLKSDGALVDCGTSAQKLLGLLQKDTF-----------
SPRE_BOVIN      PDLRKSLQELKRKGELVDCKISAQKLLSLLQNDKF-----------
FABG_SCHPO      ----------------------------------------------
DLTE_BACSU      SEEVQYFLDLKEGKQ-------------------------------
DHG2_BACME      FADPEQRADVESMGYIGKPEEIA-SVAAFLA---------------
DCXR_CAEEL      ----------------------------------------------
CMTB_PSEPU      PELAQRFLDVIPMGRVGEIEEVA-SMVGYLAQPE------------
CMTB_PSEP1      PELAQRFLDVIPMGRVGEIEEVA-SMVGYLAQPE------------
YI13_SCHPO      ---KQKADNVYKNSEPLTPEDIAEVILFALTR--------------
Y4VI_RHISN      KLDVSAIRRRVPLGRIARPDEIARAV--------------------
FABG_HAEIN      KAGI---LSNVPAGRLGEAKDIA-KAVAFLASDDAG----------
DHG_BACME       FADPEQRADVE-----------------------------------
HSDL1_HUMAN     ----------------------------------------------
HSDL1_BOVIN     ----------------------------------------------
FABG_CHLPN      NLKAEWLKSIPLG-RAGTPEDVA-RVALFLA---------------
UCPA_ECOLI      ----------------------------------------------
UCPA_ECO57      ----------------------------------------------
NODG_RHIS3      ----------------------------------------------
HSDL1_PONAB     ----------------------------------------------
DHGA_BACME      FADPEQRADVE-----------------------------------
DHG1_BACME      FADPEQRADVE-----------------------------------
DHG4_BACME      ----------------------------------------------
NODG_RHIME      ----------------------------------------------
SPRE_DICDI      SEDDKSFYGLKNDGKLINPNRSA-----------------------
FABG_PSEAE      ----------------------------------------------
DHG3_BACME      ----------------------------------------------
YJDA_BACSU      SPKFPMGR-------IGTPDDAA-RMIAFLA---------------
DRS7B_BOVIN     GSKYGVMDE--TTAQGRSPVQVAQDILAALGK--------------
YJNK_SCHPO      ----------------------------------------------
DHG_BACSU       PKQKADVESMIPMGYIGEPEEIA-AVAAWLA---------------
UCPA_SALTY      ----------------------------------------------
UCPA_SALTI      ----------------------------------------------
FABG_CHLTR      ----------------------------------------------
DHS5_CAEEL      F---------------------------------------------
YMFI_BACSU      KEEI------------------------------------------
BACC2_BACSU     ----------------------------------------------
FABG_YEAST      ----------------------------------------------
FABG_VIBHA      LSNVPAGR-LGDPREIAS-------AVVFLASPE------------
FABG_SHIFL      ----------------------------------------------
FABG_ECOLI      ----------------------------------------------
ENTA_ECOLI      DAEEQRIRGFGEQFKLGIP---------------------------
HSDL1_RAT       ----------------------------------------------
HSDL1_MOUSE     ----------------------------------------------
FABG_CHLMU      ----------------------------------------------
BACC_BACSU      ----------------------------------------------
NOG4_RHIME      ----------------------------------------------
FABG1_SYNY3     ILQ-------------------------------------------
DHRS7_ANOGA     YGKMD-----AATAGGASPQDTASSILKAIARDE------------
DHRS4_HUMAN     KEKEESMKETLRIRRLGEPEDCA-GIVSFLCSED------------
DHB3_MOUSE      ----------------------------------------------
CBR4_RAT        F---------------------------------------------
DRS7B_DANRE     ----------------------------------------------
DER_CHICK       ----------------------------------------------
CBR4_BOVIN      ----------------------------------------------
BUTA_STAAW      AEEAEQFTSQIALGRVSQPEDVS-NVVSFLAGKD------------
BUTA_STAAS      AEEAEQFTSQIALGRVSQPEDVS-NVVSFLAGKD------------
BUTA_STAAR      AEEAEQFTSQIALGRVSQPEDVS-NVVSFLAGKD------------
BUTA_STAAN      AEEAEQFTSQIALGRVSQPEDVS-NVVSFLAGKD------------
BUTA_STAAM      AEEAEQFTSQIALGRVSQPEDVS-NVVSFLAGKD------------
BUTA_STAAC      AEEAEQFTSQIALGRVSQPEDVS-NVVSFLAGKD------------
DHRS4_PONAB     KEKEESMKETLRIRRLGEPEDCA-GIVSFLCSED------------
DHRS4_PIG       KARKEYMKESLRIRRLGNPEDCA-GIVSFLCSED------------
DCXR_RAT        ----------------------------------------------
DCXR_MESAU      ----------------------------------------------
YCP9_SCHPO      ----------------------------------------------
FABG_RICTY      ----------------------------------------------
FABG_RICPR      ----------------------------------------------
FABG_BUCBP      ----------------------------------------------
DRS7B_MOUSE     ----------------------------------------------
DR9C7_BOVIN     ----------------------------------------------
DHB3_RAT        ----------------------------------------------
BACC_BACAM      ----------------------------------------------