[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07939.1

[Show Plain Result]


## Summary of Sequence Search
    1::289
    1::289     e-163  97%  289 aa  KDSA_RALEJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::289     e-162  97%  289 aa  KDSA_RALEH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::289     e-162  97%  289 aa  KDSA_CUPTR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-136  84%  284 aa  KDSA_BURMS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-136  84%  284 aa  KDSA_BURMA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-136  84%  284 aa  KDSA_BURM9 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-136  84%  284 aa  KDSA_BURM7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-136  84%  284 aa  KDSA1_BURPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase
    1::283     e-134  83%  284 aa  KDSA_BURM1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-134  83%  284 aa  KDSA_RALPJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-134  82%  284 aa  KDSA_RALSO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-133  82%  284 aa  KDSA_BURCJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-133  82%  285 aa  KDSA_VARPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-133  82%  284 aa  KDSA_BURCC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-133  82%  284 aa  KDSA_BURCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-133  82%  284 aa  KDSA_BURCA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-132  82%  284 aa  KDSA_BURVG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-132  81%  284 aa  KDSA_BURP8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-130  80%  285 aa  KDSA_METPP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-129  79%  285 aa  KDSA_POLNA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::284     e-127  79%  285 aa  KDSA_DELAS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::276     e-125  79%  279 aa  KDSA_AZOSE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-125  77%  284 aa  KDSA_BORPD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::284     e-122  76%  285 aa  KDSA_ACIAC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-121  76%  284 aa  KDSA_BURXL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-120  75%  285 aa  KDSA_RHOFD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::284     e-119  74%  285 aa  KDSA_POLSJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::274     e-119  75%  283 aa  KDSA_LARHH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    2::284     e-116  72%  285 aa  KDSA_BORPE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    2::284     e-116  72%  285 aa  KDSA_BORPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::276     e-115  74%  278 aa  KDSA_DECAR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    2::284     e-115  72%  285 aa  KDSA_BORBR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::276     e-113  73%  279 aa  KDSA_AZOSB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::272     e-113  73%  276 aa  KDSA_STRM5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::272     e-113  72%  276 aa  KDSA_STRMK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::283     e-111  74%  283 aa  KDSA_METCA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::284     e-109  68%  285 aa  KDSA_ACISJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::284     e-108  68%  285 aa  KDSA_DIAST RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::276     e-108  70%  276 aa  KDSA_XYLFT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::276     e-108  70%  276 aa  KDSA_XYLFM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::276     e-108  70%  276 aa  KDSA_XYLFA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::276     e-108  70%  276 aa  KDSA_XYLF2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::269     e-106  71%  274 aa  KDSA_LEGPH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::269     e-106  71%  274 aa  KDSA_LEGPC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::269     e-106  71%  274 aa  KDSA_LEGPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::283     e-105  69%  285 aa  KDSA_LEPCP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::269     e-105  70%  274 aa  KDSA_LEGPL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::276     e-105  67%  279 aa  KDSA_METFK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::275     e-105  67%  281 aa  KDSA_ACIF5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::275     e-105  67%  281 aa  KDSA_ACIF2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::277     e-104  68%  280 aa  KDSA_THISH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::272     e-103  68%  276 aa  KDSA_XANOP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::272     e-103  68%  276 aa  KDSA_XANOM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::272     e-102  68%  276 aa  KDSA_XANCP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::272     e-102  68%  276 aa  KDSA_XANCB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::272     e-102  68%  276 aa  KDSA_XANC8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::274     e-102  67%  277 aa  KDSA_ALHEH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::272     e-102  68%  276 aa  KDSA_XANC5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::275     e-101  65%  277 aa  KDSA_THICR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::274     e-100  66%  280 aa  KDSA_THIDA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::272     e-100  67%  276 aa  KDSA_XANAC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::268     e-100  70%  277 aa  KDSA_DICNV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::278     e-100  64%  280 aa  KDSA_COXB1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::278     1e-99  63%  280 aa  KDSA_COXBU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::278     1e-99  63%  280 aa  KDSA_COXB2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::278     2e-99  63%  280 aa  KDSA_COXBN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::268     1e-98  66%  275 aa  KDSA_FRATN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::268     2e-98  66%  275 aa  KDSA_FRAP2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::276     3e-98  62%  277 aa  KDSA_VESOH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::268     6e-98  66%  275 aa  KDSA_FRATH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::268     2e-97  66%  275 aa  KDSA_FRATM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::284     2e-97  62%  285 aa  KDSA_VEREI RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    1::277     2e-96  64%  280 aa  KDSA_NITOC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    9::273     1e-85  59%  273 aa  KDSA_GEOSM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    9::273     3e-85  58%  273 aa  KDSA_GEOBB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     6e-84  56%  277 aa  KDSA_PELCD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   21::280     1e-83  58%  282 aa  KDSA_GRABC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   19::271     3e-83  57%  280 aa  KDSA_DESPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::272     3e-81  59%  272 aa  KDSA_GEOUR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   18::279     6e-81  59%  287 aa  KDSA_MAGSM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::264     5e-79  60%  273 aa  KDSA_CYAP4 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     8e-79  54%  274 aa  KDSA_RICCK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::265     8e-79  58%  279 aa  KDSA_DESOH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   15::281     1e-78  55%  284 aa  KDSA_SYNP6 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   15::281     1e-78  55%  284 aa  KDSA_SYNE7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::272     2e-78  58%  272 aa  KDSA_GEOLS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::251     9e-78  59%  272 aa  KDSA_GEOSF RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   18::276     9e-78  54%  278 aa  KDSA_BARQU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::274     1e-77  52%  281 aa  KDSA_HAHCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   18::276     2e-77  53%  279 aa  KDSA_BARHE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   17::276     2e-77  54%  278 aa  KDSA_FUSNN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::275     7e-77  54%  282 aa  KDSA_BARBK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::270     2e-76  53%  288 aa  KDSA_SYNFM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   14::280     8e-76  51%  289 aa  KDSA_LEPIN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   14::280     8e-76  51%  289 aa  KDSA_LEPIC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    8::279     8e-76  51%  281 aa  KDSA2_BURPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase
   19::280     1e-75  54%  287 aa  KDSA_RHOPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   19::279     1e-75  55%  282 aa  KDSA_BRAJA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   23::280     3e-75  54%  287 aa  KDSA_RHOPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    9::272     3e-75  53%  272 aa  KDSA_PELPD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::275     3e-75  57%  277 aa  KDSA_OCHA4 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   23::280     4e-75  54%  287 aa  KDSA_RHOPT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   23::280     7e-75  55%  287 aa  KDSA_RHOP2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     1e-74  53%  274 aa  KDSA_RICTY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   18::276     1e-74  53%  278 aa  KDSA_BART1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     3e-74  53%  274 aa  KDSA_RICFE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::251     3e-74  56%  272 aa  KDSA_GEOSL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     4e-74  53%  275 aa  KDSA_RICPR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   19::268     6e-74  56%  287 aa  KDSA_NITHX RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::272     6e-74  54%  272 aa  KDSA_GEOMG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     1e-73  53%  274 aa  KDSA_RICAH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     2e-73  53%  274 aa  KDSA_RICRS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     2e-73  53%  274 aa  KDSA_RICRO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     2e-73  53%  274 aa  KDSA_RICCN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     2e-73  53%  274 aa  KDSA_RICAE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    9::265     6e-73  57%  278 aa  KDSA_ACIBL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     8e-73  52%  274 aa  KDSA_RICPU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   10::279     3e-72  50%  288 aa  KDSA_BDEBA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   16::273     4e-72  49%  282 aa  KDSA_SHEAM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     4e-72  48%  281 aa  KDSA_PSYIN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   26::265     7e-72  52%  273 aa  KDSA_DESAA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   15::272     1e-71  51%  280 aa  KDSA_PSEPW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    4::253     2e-71  53%  267 aa  KDSA_AQUAE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   15::272     2e-71  50%  280 aa  KDSA2_PSEPK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase
    6::275     3e-71  47%  284 aa  KDSA_HAEPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::275     3e-71  55%  277 aa  KDSA_BRUSU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::275     3e-71  55%  277 aa  KDSA_BRUSI RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::275     3e-71  55%  277 aa  KDSA_BRUO2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::275     3e-71  55%  277 aa  KDSA_BRUME RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::275     3e-71  55%  277 aa  KDSA_BRUMB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::275     3e-71  55%  277 aa  KDSA_BRUC2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     8e-71  47%  284 aa  KDSA_ACTSZ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     1e-70  47%  284 aa  KDSA_MANSM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::275     1e-70  54%  277 aa  KDSA_BRUAB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::275     1e-70  54%  277 aa  KDSA_BRUA2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   20::275     1e-70  54%  277 aa  KDSA_BRUA1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    8::277     2e-70  47%  286 aa  KDSA_ACTPL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     2e-70  47%  284 aa  KDSA_ACTPJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     2e-70  47%  284 aa  KDSA_ACTP7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     2e-70  47%  284 aa  KDSA_PASHA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   16::283     3e-70  47%  283 aa  KDSA_SYNPX RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::261     3e-70  54%  278 aa  KDSA_ACAM1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   15::272     5e-70  50%  281 aa  KDSA_JANMA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     1e-69  47%  282 aa  KDSA_SHEPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     1e-69  47%  282 aa  KDSA_SHEHH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     1e-69  46%  284 aa  KDSA_HAEIN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   10::272     1e-69  48%  280 aa  KDSA_COLP3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     2e-69  46%  284 aa  KDSA_HAES1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     2e-69  46%  284 aa  KDSA_HAEI8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   16::275     2e-69  49%  283 aa  KDSA_PROMM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     2e-69  46%  284 aa  KDSA_HAES2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     2e-69  46%  284 aa  KDSA_HAEIE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    8::273     3e-69  47%  282 aa  KDSA_SHEPW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   14::280     3e-69  48%  283 aa  KDSA_SHEFN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     3e-69  46%  284 aa  KDSA_HAEIG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   16::277     4e-69  47%  286 aa  KDSA_SHEDO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     6e-69  51%  274 aa  KDSA_RICBR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    5::272     6e-69  51%  274 aa  KDSA_RICB8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    8::257     6e-69  53%  269 aa  KDSA_CHLPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    8::251     7e-69  53%  269 aa  KDSA_CHLFF RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     9e-69  46%  284 aa  KDSA_SALPK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     9e-69  46%  284 aa  KDSA_SALPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   16::258     9e-69  55%  290 aa  KDSA_PEA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;  
    6::273     9e-69  46%  281 aa  KDSA_MARAV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     2e-68  47%  281 aa  KDSA_PSEE4 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     2e-68  47%  284 aa  KDSA_PHOLL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   19::268     2e-68  52%  287 aa  KDSA_NITWN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    8::273     3e-68  47%  282 aa  KDSA_SHEWM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALTY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALTI RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALSV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALPC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALPB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALNS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALHS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALG2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALEP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALDC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     3e-68  46%  284 aa  KDSA_SALA4 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     3e-68  46%  284 aa  KDSA_PASMU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     4e-68  46%  282 aa  KDSA_SHEB9 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     4e-68  46%  282 aa  KDSA_SHEB8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     4e-68  46%  282 aa  KDSA_SHEB5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     4e-68  46%  282 aa  KDSA_SHEB2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     4e-68  47%  281 aa  KDSA_PSEU5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::284     4e-68  46%  284 aa  KDSA_PHOPR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     4e-68  47%  284 aa  KDSA_EDWI9 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   15::258     4e-68  55%  290 aa  KDSA_ARATH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     5e-68  46%  284 aa  KDSA_SALAR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   25::287     5e-68  51%  287 aa  KDSA_CAUCR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   25::287     5e-68  51%  287 aa  KDSA_CAUCN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   19::279     6e-68  53%  286 aa  KDSA_BRASB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     8e-68  46%  282 aa  KDSA_SHELP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     1e-67  47%  284 aa  KDSA_YERE8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::281     1e-67  46%  284 aa  KDSA_CITK8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     1e-67  46%  282 aa  KDSA_SHEON RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::272     1e-67  46%  284 aa  KDSA_PSEHT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    9::274     1e-67  47%  275 aa  KDSA_PARUW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   17::274     1e-67  52%  276 aa  KDSA_MESSB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::254     2e-67  54%  263 aa  KDSA_WOLSU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     2e-67  46%  281 aa  KDSA_PSEPG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   19::279     2e-67  52%  287 aa  KDSA_BRASO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    8::251     2e-67  54%  269 aa  KDSA_CHLPN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    8::251     2e-67  53%  269 aa  KDSA_CHLCV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     2e-67  46%  281 aa  KDSA1_PSEPK RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase
    8::273     3e-67  46%  282 aa  KDSA_SHESH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     3e-67  46%  281 aa  KDSA_PSEMY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::267     3e-67  55%  276 aa  KDSA_HELP2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   17::274     3e-67  48%  282 aa  KDSA_BORA1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   18::279     4e-67  51%  281 aa  KDSA_RHOBA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     4e-67  45%  284 aa  KDSA_ENTS8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     4e-67  46%  284 aa  KDSA_ENT38 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     5e-67  46%  284 aa  KDSA_YERPY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     5e-67  46%  284 aa  KDSA_YERPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     5e-67  46%  284 aa  KDSA_YERPP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     5e-67  46%  284 aa  KDSA_YERPN RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     5e-67  46%  284 aa  KDSA_YERPG RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     5e-67  46%  284 aa  KDSA_YERPE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     5e-67  46%  284 aa  KDSA_YERPB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     5e-67  46%  284 aa  KDSA_YERPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     5e-67  46%  284 aa  KDSA_YERP3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_SHISS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_SHIFL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_SHIF8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_SHIDS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_SHIBS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_SHIB3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     5e-67  45%  282 aa  KDSA_SHESR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     5e-67  45%  282 aa  KDSA_SHESA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECOUT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECOSM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECOSE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECOLU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECOLI RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECOLC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECOL6 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECOK1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECOHS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECODH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECOBW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECO8A RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECO81 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECO7I RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECO5E RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECO57 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECO55 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECO45 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECO27 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     5e-67  46%  284 aa  KDSA_ECO24 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     7e-67  45%  282 aa  KDSA_SHESW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     7e-67  45%  282 aa  KDSA_SHEPC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     7e-67  46%  284 aa  KDSA_ESCF3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   22::277     7e-67  48%  285 aa  KDSA_ACIBY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   22::277     7e-67  48%  285 aa  KDSA_ACIBT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   22::277     7e-67  48%  285 aa  KDSA_ACIBC RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   22::277     7e-67  48%  285 aa  KDSA_ACIB3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     9e-67  45%  282 aa  KDSA_SHESM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::267     9e-67  53%  276 aa  KDSA_HELPY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     9e-67  46%  284 aa  KDSA_ECOL5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::274     1e-66  47%  281 aa  KDSA_AZOVD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   16::275     2e-66  48%  283 aa  KDSA_SYNPW RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     2e-66  45%  284 aa  KDSA_SERP5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     2e-66  45%  284 aa  KDSA_KLEP7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     2e-66  45%  284 aa  KDSA_KLEP3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   22::277     2e-66  48%  285 aa  KDSA_ACIBS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   16::275     3e-66  46%  284 aa  KDSA_SODGM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     3e-66  45%  284 aa  KDSA_ERWCT RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::272     4e-66  47%  280 aa  KDSA_NEIMF RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   27::281     4e-66  53%  282 aa  KDSA_AGRT5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   27::279     6e-66  53%  280 aa  KDSA_RHIME RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::267     8e-66  53%  276 aa  KDSA_HELPH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::267     1e-65  54%  276 aa  KDSA_HELPJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::283     1e-65  44%  284 aa  KDSA_ERWT9 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::275     1e-65  45%  284 aa  KDSA_PECCP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::267     2e-65  52%  276 aa  KDSA_HELAH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   22::277     3e-65  47%  285 aa  KDSA_ACIAD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::273     5e-65  45%  281 aa  KDSA_PSEFS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   18::275     5e-65  45%  284 aa  KDSA_PROMH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::273     6e-65  46%  281 aa  KDSA_PSEPF RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::266     6e-65  53%  276 aa  KDSA_HELPS RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::279     8e-65  44%  281 aa  KDSA_PSEU2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::273     8e-65  45%  281 aa  KDSA_PSEF5 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::272     8e-65  46%  280 aa  KDSA_NEIM0 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::273     1e-64  46%  281 aa  KDSA_PSEA7 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    6::279     1e-64  43%  281 aa  KDSA_PSE14 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    8::257     1e-64  51%  269 aa  KDSA_CHLAB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    2::268     1e-64  51%  271 aa  KDSA_CAMJJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::273     2e-64  46%  281 aa  KDSA_PSEAE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::273     2e-64  46%  281 aa  KDSA_PSEAB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::279     2e-64  44%  281 aa  KDSA_PSESM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::272     3e-64  46%  280 aa  KDSA_NEIG2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::272     3e-64  46%  280 aa  KDSA_NEIG1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    2::268     3e-64  50%  271 aa  KDSA_CAMJR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    2::268     3e-64  50%  271 aa  KDSA_CAMJE RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::272     4e-64  46%  280 aa  KDSA_NEIMB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    7::276     5e-64  44%  284 aa  KDSA_VIBFM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    7::276     5e-64  44%  284 aa  KDSA_VIBF1 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    2::267     7e-64  50%  267 aa  KDSA_CAMJD RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    4::231     1e-63  53%  269 aa  KDSA_CHLTR RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    4::231     1e-63  53%  269 aa  KDSA_CHLTA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::272     2e-63  45%  280 aa  KDSA_NEIMA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    4::231     2e-63  53%  269 aa  KDSA_CHLTB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    4::231     2e-63  53%  269 aa  KDSA_CHLT2 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    3::265     2e-63  50%  270 aa  KDSA_HELHP RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::274     2e-63  46%  282 aa  KDSA_CHRVO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    2::268     3e-63  50%  271 aa  KDSA_CAMJ8 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   17::276     8e-63  44%  284 aa  KDSA_VIBSL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    9::231     1e-62  53%  269 aa  KDSA_CHLMU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     1e-62  43%  283 aa  KDSA_VIBCM RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     1e-62  43%  283 aa  KDSA_VIBCH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     1e-62  43%  283 aa  KDSA_VIBC3 RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
    7::276     1e-62  44%  284 aa  KDSA_ALISL RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   14::276     5e-62  43%  284 aa  KDSA_VIBVY RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   14::276     5e-62  43%  284 aa  KDSA_VIBVU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     5e-62  43%  283 aa  KDSA_VIBPA RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   13::275     7e-62  43%  283 aa  KDSA_VIBHB RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   23::281     7e-62  50%  284 aa  KDSA_METRJ RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   22::275     1e-61  49%  277 aa  KDSA_RHILO RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   12::275     6e-61  43%  286 aa  KDSA_HAEDU RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   18::266     2e-58  46%  273 aa  KDSA_DESVV RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   18::266     2e-58  46%  273 aa  KDSA_DESVH RecName: Full=2-dehydro-3-deoxyphosphooctonate aldolase;
   95::329     7e-22  32%  338 aa  AROF_THEMA RecName: Full=Phospho-2-dehydro-3-deoxyheptonate
  122::353     1e-17  31%  358 aa  AROG_BACSU RecName: Full=Protein aroA(G);Includes:  RecName:
    1::289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLCGFDVGLDKPFFLIAGPCVIESEQMALDTAGELKAITGELGIPFIYKSSFDKANRSSGKSFRGLGME
KDSA_RALEJ      MKLCGFEVGLDKPFFLIAGPCVIESEQMALDTAGELKAITGELGIPFIYKSSFDKANRSSGKSFRGLGME
KDSA_RALEH      MKLCGFEAGLDKPFFLIAGPCVIESEQMALDTAGELKAITAELGIPFIYKSSFDKANRSSGKSFRGLGME
KDSA_CUPTR      MKLCGFEVGLDKPFFLIAGPCVIESEQMALDTAGELKAITTELGIPFIYKSSFDKANRSSGKSFRGLGME
KDSA_BURMS      MNLAGFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_BURMA      MNLAGFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_BURM9      MNLAGFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_BURM7      MNLAGFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSFRGLGMD
KDSA1_BURPS     MNLAGFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICATLGVPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_BURM1      MKLCDFEVGLDKPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNIPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_RALPJ      MKLCDFEVGLDKPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASFRGLGME
KDSA_RALSO      MKLCDFEIGLDRPFFLIAGTCVIESEQMAIDTAGTLKEITGALGIPFIYKSSFDKANRSSDASFRGLGME
KDSA_BURCJ      MKLCDFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_VARPS      MKLCGFDIGLDQPFFLIAGPCVVESEQLQMDTAGTLKEITSSLGIPFIFKSSFDKANRSSGTSFRGPGRE
KDSA_BURCC      MKLCDFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_BURCH      MKLCDFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_BURCA      MKLCDFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICEKLNVPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_BURVG      MKLCDFEVGLDQPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNVPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_BURP8      MKLGDFEIGLDKPFFLIAGTCVVESEQMTIDTAGKLKEICAKLKIPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_METPP      MKLCGFDVGLDRPFFLISGPCVVESEQLQMDVAGRLKEITAALGIPFIFKSSYDKANRSSGTSFRGPGME
KDSA_POLNA      MKLCGFDIGLDQPFFLIAGPCVVESEQLQMDTAGTLKEITASLGIPFIFKSSYDKANRSSGTSFRGPGME
KDSA_DELAS      MKLCGFDVGLDRRFFLIAGPCVVESEQLQMDVAGHLKEITAALGIHFIFKSSYDKANRSSGASFRGPGMD
KDSA_AZOSE      MKLCGFEAGLDKPFFLIAGPCVIESRDMAFETAGALKEICVELGIPFIYKSSYDKANRSSGKSYRGMGME
KDSA_BORPD      MKACGFDIGLEHPFFLIAGPCVIESRELAFDTAGRLKEITSRLGIPFIYKSSFDKANRSSGKSFRGLGID
KDSA_ACIAC      MKLCGFDVGLDRPFFLIAGPCVIESEQLQMDVAGRLKETTAALGIPFIFKSSFDKANRSSGTSFRGPGRE
KDSA_BURXL      MKLGDFEIGLDRPFFLIAGTCVVESEQMTIDTAGRLKEICAKLNIPFIYKSSYDKANRSSGKSFRGLGMD
KDSA_RHOFD      MKLCGFEVGLNQPLFLIAGPCVIESEQLQMDTAGTLKEITASLGIAFIFKSSFDKANRSSGSTFRGPGIE
KDSA_POLSJ      MKLCGFDIGLNQPFFLIAGPCVVESEQLQMDTAGTLKEITSSLGIPFIFKSSYDKANRSSGTSFRGPGMV
KDSA_LARHH      MKLCGFDAGLDQPLFLIAGPCVIEGEQFAIDTAGQLKEMAGRLGLPFIYKSSYDKANRSSDQSFRGFGID
KDSA_BORPE      MKACGFDIGLDHPFFLIAGPCVIESRELAFETAGRLKEITGKLGVPFIYKSSFDKANRSSGKSFRGPGMD
KDSA_BORPA      MKACGFDIGLDHPFFLIAGPCVIESRELAFETAGRLKEITGKLGVPFIYKSSFDKANRSSGKSFRGPGMD
KDSA_DECAR      MKLCGFEAGLDQPFFLIAGPCTAESEQLCLDVAGHMKEVCARLGINYIFKASYDKANRSSGKSVRGLGLE
KDSA_BORBR      MKACGFDIGLDHPFFLIAGPCVIESRELAFETAGRLKEITGKLGVSFIYKSSFDKANRSSGKSFRGPGMD
KDSA_AZOSB      MNLCGFEVGLDKPVFLIAGPCVIESREMAFETAGALKDICAEVGIPFIYKSSYDKANRSSGKSYRGMGME
KDSA_STRM5      MKLCGFEVGLDQPLFLIAGPCVIESMQLQLDTAGKLKEVTDRLGVNFIFKSSFDKANRTSGTAFRGPGME
KDSA_STRMK      MKLCGFEVGLDQPLFLIAGPCVIESMQLQLDTAGKLKEVTDKLGVNFIFKSSFDKANRTSGTAFRGPGME
KDSA_METCA      -ELCGFPVGLEHPLFLIAGPCVIETEQLALDTAGALKEITDGLGIPFIYKSSFDKANRSSHASYRGPGME
KDSA_ACISJ      MQLCGFDVGLDQRFFLIAGTCSIEGLEMSLDVAGQLKEACAPLGIPLIYKGSFDKANRSSGTSKRGVGLD
KDSA_DIAST      MQLCGFNVGLDQRFFLIAGTCSIEGLEMSLDVAGQLKEACAPLGIPLIYKGSFDKANRSSGTSKRGVGLD
KDSA_XYLFT      MKLCGFEVGLNQPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSFRGPGLE
KDSA_XYLFM      MKLCGFEVGLNQPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSFRGPGLE
KDSA_XYLFA      MKLCGFEVGLNQPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSFRGPGLE
KDSA_XYLF2      MKLCGFEVGLNQPLFLIAGPCVIESLQLQLDTAGVLKEITSKLGLNFIFKSSFDKANRTSGSSFRGPGLE
KDSA_LEGPH      MRLCGFEAGLDKPLFLIAGPCVIESEELALETAGYLKEMCSQLNIPFIYKSSFDKANRSSISSYRGPGFE
KDSA_LEGPC      MRLCGFEAGLDKPLFLIAGPCVIESEELALETAGYLKEMCSQLNIPFIYKSSFDKANRSSISSYRGPGFE
KDSA_LEGPA      MRLCGFEAGLDKPLFLIAGPCVIESEELALETAGYLKEMCSQLNIPFIYKSSFDKANRSSISSYRGPGFE
KDSA_LEPCP      MKLCGFDVGIDQPFFLIAGTCSIEGLQMSLDVAGLLKEACAGLGIPLIYKGSFDKANRSSGTTNRGLGLE
KDSA_LEGPL      MRLCGFEAGLDKPLFLIAGPCVIESEELALETAGYLKEMCSQLNIPFIYKSSFDKANRSSISSYRGPGFE
KDSA_METFK      MQLCGFEVGIDQPLFLIAGPCVIESQEMAIETAGQLKEITTALGINFIYKSSYDKANRSSNKTFRGFGMD
KDSA_ACIF5      MRLCGFEAGLQHPFFLMAGPCAIESESLALRTAEDLRDICARLGIPFIYKSSYDKANRSSGQSFRGPGMD
KDSA_ACIF2      MRLCGFEAGLQHPFFLMAGPCAIESESLALRTAEDLRDICARLGIPFIYKSSYDKANRSSGQSFRGPGMD
KDSA_THISH      MKLCHFEAGLEHPIFLISGPCVIESEQLALDTAGQLKELCERVGVPFIYKSSFDKANRSSTRSFXXXXXX
KDSA_XANOP      MKLCGFEVGLDQPLFLIAGPCVIESMQLQLDVAGKLKEITGKLGVNFIFKSSFDKANRTSGTSFRGPGLE
KDSA_XANOM      MKLCGFEVGLDQPLFLIAGPCVIESMQLQLDVAGKLKEITGKLGVNFIFKSSFDKANRTSGTSFRGPGLE
KDSA_XANCP      MKLCDFEVGLDQPLFLIAGPCVIESMQLQLDVAGKLKEITGKLGINFIFKSSFDKANRTSGTSFRGPGLE
KDSA_XANCB      MKLCDFEVGLDQPLFLIAGPCVIESMQLQLDVAGKLKEITGKLGINFIFKSSFDKANRTSGTSFRGPGLE
KDSA_XANC8      MKLCDFEVGLDQPLFLIAGPCVIESMQLQLDVAGKLKEITGKLGINFIFKSSFDKANRTSGTSFRGPGLE
KDSA_ALHEH      MDLCGFRVGLDRPLFLIAGPCVVESEQLALDTAGALAEMTGELGIPFIYKSSFDKANRSSHESYRGPGLE
KDSA_XANC5      MKLCDFEVGLDQPLFLIAGPCVIESMQLQLDVAGRLKEITGKLGVNFIFKSSFDKANRTSGTSFRGPGLE
KDSA_THICR      MKLCGFDVGIDQPLFLIAGPCVIESEQLAIETAGQLKELTDALGIPFIYKSSYDKANRSSTKSFRGLGVE
KDSA_THIDA      MKLCHFEAGLDQPLFLISGPCVIESEQLAMDTAGQLKEMCAGLGIPFIYKSSFDKANRSSTKSFXXXXXX
KDSA_XANAC      MKLCDFEVGLDQPLFLIAGPCVIESMQLQLDVAGKLKEITGKLGVNFIFKSSFDKANRTSGTSFRGPGLE
KDSA_DICNV      MKLIDFDVDNDRPFFLIAGPCVIESEYLALHTAEVLKTITDELKIPFIYKSSFDKANRSSGASFRGLGLA
KDSA_COXB1      MQIADFEIGLNNPLFLIAGPCVIESEALVMDVAGELKSITQQLDMPFIFKASFDKANRSSHLSYRGPGIE
KDSA_COXBU      MQIADFEIGLNNPLFLIAGPCVIESEALVMDVAGELKSITQQLDMPFIFKASFDKANRSSHLSYRGPGIE
KDSA_COXB2      MQIADFEIGLNNPLFLIAGPCVIESEALVMDVAGELKSITQQLDMPFIFKASFDKANRSSHLSYRGPGIE
KDSA_COXBN      MQIADFEIGLNNPLFLIAGPCVIESEALVMDVAGELKSITQQLDMPFIFKASFDKANRSSHLSYRGPGIE
KDSA_FRATN      MKIANFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTRDLGINFVYKSSFDKANRSSINSFRGLGVD
KDSA_FRAP2      MKIANFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGVD
KDSA_VESOH      MKLLDFEVGINHPFFLIAGPCVIESEALALETATYLKRVTEDLGINFIYKSSYDKANRTSTNSFRGLGVK
KDSA_FRATH      MKIANFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGVD
KDSA_FRATM      MKIANFEVGNGKPFFLMSGPCVIESEQMAMDTAGYLAEVTKDLGINFVYKSSFDKANRSSINSFRGLGVD
KDSA_VEREI      MKLCGFDVGLEQRLFLIAGPCVIESAQLQMDVAGQLREITARLGMPFIFKSSFDKANXXXXXXXXXXXXD
KDSA_NITOC      MELCGFEVGLERALFLIAGPCVIESEQLALDTAGRLKEMTERLGIPFIYKSSFDKANRTAVESFRGLGME
KDSA_GEOSM      ----GVKIGGGRPLALVAGPCVIENETATLRCAERLMSICNGVGISLIFKASYDKANRTSVTAFRGPGMK
KDSA_GEOBB      ----GVKIGGGRPLALVAGPCVIENETATLRCAERLMSICNGVGISLIFKASYDKANRTSVTAFRGPGMK
KDSA_PELCD      LKVADVTFGGNHPVALIAGPCVMENEAHTLAIARQLLEVKNELGVGVVFKASFDKANRTSVSAYRGPGLE
KDSA_GRABC      --------GNDLPFVLIAGPCQIESRAHAEGVAAELHAICARLDIPLVFKASYDKANRTSVGGARGVGME
KDSA_DESPS      -------VGSGQPLLLIGGPCSLESEQLGREVAETVSKICKKLGISYVFKASFDKANRTSISSYRGPGLK
KDSA_GEOUR      -------IGGDRPLVLIAGPCVIENEVATMRCAERLMTICNGVSIPLIFKASYDKANRTSVNSFRGPGMK
KDSA_MAGSM      ------------PMTLIAGPCVIEGLEFALRTAEALKQICEGVGVELVYKSSFDKANRTSEGSFRGPGME
KDSA_CYAP4      -------IGDGQPFALIGGPCVIESEDFCLKMADQIRQICDRLQISYIFKSSFDKANRTSIDSFRGQSLE
KDSA_RICCK      VKLHNIKIGNDLPFILIAGPCQIEGQDHALFMAEKLVKLTSKLDIPFIYKSSFDKANRTSINGVRGLGIE
KDSA_DESOH      -------IGGGAPLVVIAGPCVIEDYDTTLQAAEFLKTVTDRLGIPFIFKASYDKANRSSVHSFRGPGPD
KDSA_SYNP6      -----FSIGDGCPLTLFGGPCVIEGEDFSLKMAESIAKVCDRLGVQFVFKSSFDKANRTSIGSFRGYGLE
KDSA_SYNE7      -----FSIGDGCPLTLFGGPCVIEGEDFSLKMAESIAKVCDRLGVQFVFKSSFDKANRTSIGSFRGYGLE
KDSA_GEOLS      ---------------LIAGPCVIESEEATLRHAERLMTICNGLGMPLIFKSSYDKANRTSINAFRGPGMD
KDSA_GEOSF      -------IGGDRPLVLVAGPCVIENEAATLRCAERLMTICNGVSMPLIFKASYDKANRTSVNSFRGPGLK
KDSA_BARQU      ----------ETPFSLIVGPCQMESRDHAFEMAGRIKTITDQIGIGFVYKSSYDKANRTSLGAARGIGLE
KDSA_HAHCH      VKVGGIDIANDRPFVLFGGMNVLESRDLALQVAESYVKVTQKLGIPYVFKASFDKANRSSINSYRGPGLD
KDSA_BARHE      ----------EAPFSLIAGPCQIESRDHAFEMAGRIKTITDQVGIGFVYKSSYDKANRTSLSAVRGVGLE
KDSA_FUSNN      --------GGKKRFVLIAGPCVMESQELMDEVAGGIKEICDRLGIEYIFKASFDKANRSSIYSYRGPGLE
KDSA_BARBK      ------------PLSLIVGPCQIESRDHAFEMAGRIKAIADQAGIGFVYKSSYDKANRTSLSAARGIGLE
KDSA_SYNFM      -EVLGQTVGTNR-FFVIGGPCVIENRDMTLRIAEFLRNACARLHIPCVFKSSYDKANRTSIHSYRGPGIE
KDSA_LEPIN      --LNGTKIGGDEPFFLISGPCVMENRDLLDRVCAEMIEVCGELKIPYIFKSSFDKANRSSVNSYRGPGLA
KDSA_LEPIC      --LNGTKIGGDEPFFLISGPCVMENRDLLDRVCAEMIEVCGELKIPYIFKSSFDKANRSSVNSYRGPGLA
KDSA2_BURPS     ----GVTAGNSLPFVLFGGINVLESLDFTLDVCGEYVAVTRKLGIPFVFKASFDKANRSSIHSYRGVGLD
KDSA_RHOPS      --------GNSLPLSVIAGPCQLESRAHALEVASALKEIATRLGIGLVYKTSFDKANRTSAASARGIGLD
KDSA_BRAJA      --------GNDLPISIIAGPCQLESRQHALEVASALKEIAARLNIGLVYKTSFDKANRTSASAARGLGLA
KDSA_RHOPA      ------------PLSVIAGPCQLESRAHALEVASALKEIATRLGIGLVYKTSFDKANRTSAASARGLGLD
KDSA_PELPD      ----GVKIGAKRPLALVAGPCVIESELATMRQAERLMTICNALSLPLIFKASYDKANRTSIGAYRGPGMR
KDSA_OCHA4      ------------PFALIAGPCQMETREHAFDMAGRLKEMTDKLGIDLVYKSSFDKANRTSLKAERGIGLE
KDSA_RHOPT      ------------PLSVIAGPCQLESRAHALEVASALKEIATRLGIGLVYKTSFDKANRTSAASARGLGLD
KDSA_RHOP2      ------------PLSVIAGPCQLESRAHALEVAAALQEIGKRLGIGIVYKTSFDKANRTSAASARGIGLD
KDSA_RICTY      VKLNNIKIGNDLQFVLIAGPCQIEDEDHALFMAEKLIQLTSKLSIPFIYKSSFDKANRTSINGIRGLGIE
KDSA_BART1      ----------EMPLSLIAGPCQMESRDHAFEMAGRIKTMTDQLGIGFVYKSSYDKANRTSLSAARGIGLE
KDSA_RICFE      VKLNNIKIGNDLPFVLIAGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVNGIRGLGIE
KDSA_GEOSL      -------IGGDRPLVLIAGPCVIENEAATLRCAERLMTICNGVSVSLVFKASYDKANRTSVTSFRGPGMQ
KDSA_RICPR      VKLNNIKIGNDLQFVLIAGPCQIEGKDHALFMAEKLMKLTSKLSIPFIYKSSFDKANRTSINGIRGLGIE
KDSA_NITHX      --------GQDRPLSIIAGPCQMESRAHALEVAGALKEIAARLNIGLVFKTSFDKANRTSASGARGLGLK
KDSA_GEOMG      -------MGGSRPLVLIAGPCVIENETATLRCAERLMTIVNGLSIPLIFKASYDKANRTSVTAFRGPGLK
KDSA_RICAH      VKLNNIKIGNDLPFVLIAGPCQIEGKDHALFMAEKLVKLTSKLDIAFIYKSSFDKANRTSVNGIRGVGIE
KDSA_RICRS      VKLNNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHGIRGVGIE
KDSA_RICRO      VKLNNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHGIRGVGIE
KDSA_RICCN      VKLNNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHGIRGVGIE
KDSA_RICAE      VKLNNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHGIRGVGIE
KDSA_ACIBL      ------DVEIGGPLFLIAGPCVIESEAHAMKMAEAISGVCKAMKIPYIFKASYDKANRTSLSSFRGPGLH
KDSA_RICPU      VKLNNIKIGNDLPFVLITGPCQIEGKDHALFMAEKLVKLTSKLEIPFIYKSSFDKANRTSVHGIRGVGIE
KDSA_BDEBA      VKIGNIEVANDKPFVLFAGLNVLESRDLAMQVCEHFVKVTDKLKIPYVFKSSFDKANRSSIHSYRGPGME
KDSA_SHEAM      ----------DKPFVLFGGMNVLESRDLAMSIAEKYLEVTQKLGIPYVFKASFDKANRSSINSYRGPGME
KDSA_PSYIN      IKVGNIDVANDRPFVLFGGMNVLESRDMAMRVVETYVEATTALNIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_DESAA      --------------------CVIENEEKTLEIAERIKGIVRDMDVNFVFKASFDKANRTSIDSFRGPGLE
KDSA_PSEPW      ------------PFVLFGGINVLESEDLALTACAEYVRVTEKLGIPYVFKASFDKANRSSIHSYRGPGME
KDSA_AQUAE      -------------FLVIAGPCAIESEELLLKVGEEIKRLSEKFKVEFVFKSSFDKANRSSIHSFRGHGLE
KDSA2_PSEPK     ------------PFVLFGGINVLESEDLALTACAEYVRVTQKLGIPYVFKASFDKANRSSIHSYRGPGME
KDSA_HAEPS      ISLGNIDIANDKPFVLFGGMNVLESRDMAMQVCEKYVEVTQRLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_BRUSU      ------------PLALIAGPCQMETRDHAFEMAGHLKEMTDKLGIGLVYKSSFDKANRTSLKAARGIGLE
KDSA_BRUSI      ------------PLALIAGPCQMETRDHAFEMAGHLKEMTDKLGIGLVYKSSFDKANRTSLKAARGIGLE
KDSA_BRUO2      ------------PLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVYKSSFDKANRTSLKAARGIGLE
KDSA_BRUME      ------------PLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVYKSSFDKANRTSLKAARGIGLE
KDSA_BRUMB      ------------PLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVYKSSFDKANRTSLKAARGIGLE
KDSA_BRUC2      ------------PLALIAGPCQMETRDHAFEMAGHLKEMTDKLGIGLVYKSSFDKANRTSLKAARGIGLE
KDSA_ACTSZ      VKIGNIDVANHKPFVLFGGMNVLESRDMAMQVCEKYVEVTDKLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_MANSM      VRIGDINVANDNPFVLFGGMNVLESRDMAMQVCEKYVEVTNKLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_BRUAB      ------------PLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVYKSSFDKANRTSLKAARGIGLE
KDSA_BRUA2      ------------PLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVYKSSFDKANRTSLKAARGIGLE
KDSA_BRUA1      ------------PLALIAGPCQMETRDHAFEMAGRLKEMTDKLGIGLVYKSSFDKANRTSLKAARGIGLE
KDSA_ACTPL      VKVGNIEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_ACTPJ      VKVGNIEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_ACTP7      VKVGNIEVANDKPFTLFGGMNVLESRDMAMRVCEQYVEVTNKLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_PASHA      IKLGNLEIANDKPFTLFGGMNVLESRDMAMAVCEKYVEVTNKLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_SYNPX      ----------DRPFALLGGVNVLEDLDFALRCAGHYKQVCERLGIPLVFKASYDKANRSSIHSFRGPGLE
KDSA_ACAM1      -------IGEGCPLTLLSGPCVIESEDFTLKMASGIARICEKLGISYVFKSSFDKANRTSISSFRGHPME
KDSA_JANMA      ------------PFVLFGGINVLESRDLAMRSCEEYVRVTGKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SHEPA      ISLGSIEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_SHEHH      ISLGSIEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_HAEIN      VKIGNIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_COLP3      ----GIDVANEQPFVLFGGMNVLESRDLAMKIAEHYVEVTQKLGIPYVFKASFDKANRSSVNSYRGPGLD
KDSA_HAES1      IQLGNIEIGNNKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYIFKASFDKANRSSIHSYRGPGME
KDSA_HAEI8      VKIGNIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_PROMM      ----------DAPFVLIGGINVLESREFALEVAGHYKTVCTKLGIPLVFKASFDKANRSSIHSYRGPGLR
KDSA_HAES2      IQLGNIEIGNNKPFVLFGGMNVLESRDMAMQVCEKYVEVTQKLGVPYIFKASFDKANRSSIHSYRGPGME
KDSA_HAEIE      VKIGNIDVANDKPFVLFGGMNVLESRDMAMQVCESYVKVTEKLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_SHEPW      --LGSIEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_SHEFN      -------VANDKPFVLFGGMNVLESRDLAMSIAEHYVEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_HAEIG      VKIGNIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_SHEDO      ------EIANDKPFVLFGGMNVLESRDLAMSIAEHYVEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_RICBR      IKLKDLKIGNDLPFTLIAGPCQIEGLDHALFMAEELVKLTTRLNIPFIYKSSFDKANRTSVNGARGLGID
KDSA_RICB8      IKLKDLKIGNDLPFTLIAGPCQIEGLDHALFMAEELVKLTTRLNIPFIYKSSFDKANRTSVNGARGLGID
KDSA_CHLPS      ---------------LIAGPCVIEEEETTLEIASKIQEIVAPYTIHWIFKSSYDKANRSSINSYRGPGLQ
KDSA_CHLFF      ---------------LIAGPCVIEGEEITLEIASKIHELVSPYAIHWIFKSSYDKANRSSINSYRGPGLS
KDSA_SALPK      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALPA      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_PEA        ------------PFFLLAGPNVIESEEHIMRMAKHIKTISSKFGIPLIFKSSFDKANRTSSKSFRGPGIV
KDSA_MARAV      LNVSGIEIANDRPFVLFGGMNVLESRELAFEVAEKYVDVCTRLGIPYVFKASFDKANRSSVNSFRGPGLE
KDSA_PSEE4      IRVGNIEIANDKPFVLFGGMNVLESRDLALKVCEEYVRVTEKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_PHOLL      -------VANDLPFVLFGGMNVLESRDLAMSICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_NITWN      --------GQDRPLSIIAGPCQMESRAHALEVAGALKDIAARLNVGLVFKTSFDKANRTSASGARGIGLK
KDSA_SHEWM      --LGSIEIANDKPFVLFGGMNVLESRDLAMKIAETYAETTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_SALTY      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALTI      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALSV      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALPC      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALPB      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALNS      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALHS      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALG2      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALEP      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALDC      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALCH      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SALA4      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_PASMU      IRLGEIEISNDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLGVPYVFKASFDKANRSSIHSYRGPGME
KDSA_SHEB9      INLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSINSYRGPGME
KDSA_SHEB8      INLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSINSYRGPGME
KDSA_SHEB5      INLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSINSYRGPGME
KDSA_SHEB2      INLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSINSYRGPGME
KDSA_PSEU5      IRVGNIEIANDKPFVLFGGINVLESRDLAMQACEEYVRVTEKLGIPYVFKASFDKANRSSITSFRGPGLE
KDSA_PHOPR      ------DVANDKPFVLFGGMNVLESRDLAMKICEHYVEVTNKLGIPFVFKASFDKANRSSVHSYRGPGME
KDSA_EDWI9      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ARATH      -----------EPFFLLAGPNVIESEEHILRMAKHIKDISTKVGLPLVFKSSFDKANRTSSKSFRGPGMA
KDSA_SALAR      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_CAUCR      -------IGNGEKLSIIAGPCQMESRQHALETAHALKEMADRLGVGLIYKTSYDKANRTSANAQRGIGLK
KDSA_CAUCN      -------IGNGEKLSIIAGPCQMESRQHALETAHALKEMADRLGVGLIYKTSYDKANRTSANAQRGIGLK
KDSA_BRASB      --------GNDLPLAVIAGPCQLESRGHALEVASALKEIATRLNIGLVYKTSFDKANRTSGSAARGLGLA
KDSA_SHELP      IKLGSIEIANDKPFVLFGGMNVLESRDLAMQIAETYAEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_YERE8      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_CITK8      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SHEON      IKLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_PSEHT      IKINDIELANNKPFVLFGGINVLESRDLAMRVAEHYVEVTTKLNIPYVFKASFDKANRSSINSYRGPGLD
KDSA_PARUW      -----FAIGPKEPLVIMSGPCVIESETHCLKAAETLKNMFEKYNVSLIFKSSYDKANRSAYDSFRGPGLE
KDSA_MESSB      ----------DAPLALIAGPCQLESREHAFEMAGRLKEMAEKLGLGFVYKTSFDKANRTSLLGKRGAGLD
KDSA_WOLSU      ---------------LIAGPCVIESQEMLRKIASELQPLSEDARIDFYFKASFDKANRTSLESYRGPGLE
KDSA_PSEPG      IRVGNIEIANDKPFVLFGGMNVLESRDLAMKVCEEYVRVTEKLGIPYVFKASFDKANRSSVTSYRGPGME
KDSA_BRASO      --------GNQLPLAVIAGPCQLESRGHALEVASALKEIATRLNISLVYKTSFDKANRTSGSAARGLGLA
KDSA_CHLPN      ---------------LIAGPCVIEGEDITLEIAGKLQSILAPYSIQWFFKSSYDKANRSSLNSFRGPGLT
KDSA_CHLCV      ---------------LIAGPCVIEEEETTLEIASRIQELVTPYAIHWIFKSSYDKANRSSINSYRGPGLN
KDSA1_PSEPK     IRVGNIEIANDKPFVLFGGMNVLESRDLAMKVCEEYVRVTEKLGIPYVFKASFDKANRSSVTSYRGPGME
KDSA_SHESH      --LGSIEIANDKPFVLFGGMNVLESRDLAMKIAETYAEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_PSEMY      IKVRDIEIANDKPFVLFGGINVLESRDLAMQACEEYVRVTEKLGIPYVFKASFDKANRSSITSFRGPGLE
KDSA_HELP2      ---------------LIAGPCVIESLENLRSIAIKLQPLANNERLDFYFKASFDKANRTSLESYRGPGLE
KDSA_BORA1      ------------PFVLFGGINVLESEDLALRSCAEYVRVTDKLGIPYVFKASFDKANRSSIHSYRGPGLD
KDSA_RHOBA      --------GPGEPLLVIAGPCVLQSRELALQIGEELARINQRSDVQVIFKASFDKANRTSLAAQRGPGIE
KDSA_ENTS8      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ENT38      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSINSYRGPGLE
KDSA_YERPY      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_YERPS      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_YERPP      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_YERPN      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_YERPG      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_YERPE      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_YERPB      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_YERPA      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_YERP3      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SHISS      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SHIFL      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SHIF8      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SHIDS      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SHIBS      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SHIB3      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SHESR      INLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_SHESA      INLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_ECOUT      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECOSM      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECOSE      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECOLU      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECOLI      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECOLC      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECOL6      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECOK1      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECOHS      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECODH      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECOBW      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECO8A      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECO81      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECO7I      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECO5E      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECO57      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECO55      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECO45      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECO27      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ECO24      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_SHESW      INLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_SHEPC      INLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_ESCF3      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ACIBY      ------------PFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHSFRGPGLE
KDSA_ACIBT      ------------PFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHSFRGPGLE
KDSA_ACIBC      ------------PFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHSFRGPGLE
KDSA_ACIB3      ------------PFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHSFRGPGLE
KDSA_SHESM      INLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDKANRSSVNSYRGPGME
KDSA_HELPY      ---------------LIAGPCVIESLENLRSIATKLQPLANNERLDFYFKASFDKANRTSLESYRGPGLE
KDSA_ECOL5      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYLTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_AZOVD      ------EIANDRPMALFGGMNVLESRDLALRVCEEYVRVTGKLGIPYVFKASFDKANRSSITSFRGPGLE
KDSA_SYNPW      ----------DAPFVLIGGVNVLESQQFALDAAAVYADVCRRLSIPLVFKASFDKANRSSIHSFRGPGLS
KDSA_SERP5      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_KLEP7      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_KLEP3      ------NVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_ACIBS      ------------PFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHSFRGPGLE
KDSA_SODGM      ----------DLPFVLFGGMNVLESRDLAMRICEHYVTVTEKLGIPYVFKASFDKANRSSIHSYRGPGLD
KDSA_ERWCT      VKIGDIPVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_NEIMF      IKINGITVGNDAPFVLFGGINVLEDLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLE
KDSA_AGRT5      -------------FSLIAGPCQMESRDHAFMIAGVLKELCDSLGIGLVYKSSFDKANRTSLSGKRGIGLD
KDSA_RHIME      ---------------LIAGPCQMESREHAFMIAGELVELCRSLGLGLVYKSSFDKANRTSLSGKRGIGLD
KDSA_HELPH      ---------------LIAGPCVIESLENLRSIAIKLQPLANNERLDFYFKASFDKANRTSLESYRGPGLE
KDSA_HELPJ      ---------------LIAGPCVIESLENLRSIAIKLQPLANNERLDFYFKASFDKANRTSLESYRGPGLE
KDSA_ERWT9      -------VANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_PECCP      VKIGDIPVANDLPFVLFGGMNVLESRDLAMRICEHYVTITQKLSIPYVFKASFDKANRSSIHSYRGPGLE
KDSA_HELAH      ---------------LIAGPCVIESLDNLRGIAIKLQPLANNERLDFYFKASFDKANRTSLESYRGPGLE
KDSA_ACIAD      ------------PFVLFGGMNVLESKDLAFEIAETYVDICKRLEIPYVFKASFDKANRSSLHSFRGPGLE
KDSA_PSEFS      ------EIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVTSYRGPGLE
KDSA_PROMH      ------------PFVLFGGMNVLESRDLAMRICEHYVTVTQKLDIPYVFKASFDKANRSSIHSYRGPGLD
KDSA_PSEPF      ------EIANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVTSYRGPGLE
KDSA_HELPS      ---------------LIAGPCVIESLENLRSIAIKLQPLANNERLDFYFKASFDKANRTSLESYRGPGLG
KDSA_PSEU2      IRVGSIEVANDKPMVLFGGMNVLESRDMAMQVCEEYVKVTEKLGIPYVFKASFDKANRSSVNSYRGPGLE
KDSA_PSEF5      IRVGNIEIANDKPMVLFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKANRSSVTSYRGPGLE
KDSA_NEIM0      IKINDFTLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLE
KDSA_PSEA7      -------IGNDLPFVLFGGMNVLESRDLAMQVCEEYVRVTEKLGIPYVFKASFDKANRSSIHSFRGPGLE
KDSA_PSE14      IRVGSIEIANDKPMVLFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKANRSSVNSYRGPGLE
KDSA_CHLAB      ---------------LIAGPCVXXXXXXXXXXXXKIQEIVAPYAIHWIFKSSYDKANRSSIHSYRGPGLK
KDSA_CAMJJ      -----------KKMILIAGPCVIESKDLIFKVAEQLKNFNENPNIEFYFKSSFDKANRTSINSFRGPGLE
KDSA_PSEAE      -------IGNDLPFVLFGGMNVLESRDLAMQVCEEYVRVTEKLGIPYVFKASFDKANRSSIHSFRGPGLE
KDSA_PSEAB      -------IGNDLPFVLFGGMNVLESRDLAMQVCEEYVRVTEKLGIPYVFKASFDKANRSSIHSFRGPGLE
KDSA_PSESM      ------EIANDKPMVVFGGMNVLESRDMAMQVCEEYVRVTEKLGIPYVFKASFDKANRSSVNSYRGPGLE
KDSA_NEIG2      IKINDITLGNNSPFVLFGGINVLEDLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLE
KDSA_NEIG1      IKINDITLGNNSPFVLFGGINVLEDLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLE
KDSA_CAMJR      -----------KKMILIAGPCVIESKDLIFKVAEQLKNFNENPNIEFYFKSSFDKANRTSINSFRGPGLE
KDSA_CAMJE      -----------KKMILIAGPCVIESKDLIFKVAEQLKNFNENPNIEFYFKSSFDKANRTSINSFRGPGLE
KDSA_NEIMB      IKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLE
KDSA_VIBFM      VKIGNIDVANDKPFTLFAGMNVLESRDLAMQICEKYVEVTDRLGIPYVFKASFDKANRSSVHSYRGPGME
KDSA_VIBF1      VKIGNIDVANDKPFTLFAGMNVLESRDLAMQICEKYVEVTDRLGIPYVFKASFDKANRSSVHSYRGPGME
KDSA_CAMJD      -----------KKMILIAGPCVIESKDLIFKVAKQLKNFNENPNIEFYFKSSFDKANRTSINSFRGPGLE
KDSA_CHLTR      ----------ENKMLLIAGPCVIEDNSV-FETARRLKEIVAPYAVHWIFKSSYDKANRSSVHNYRGPGLK
KDSA_CHLTA      ----------ENKMLLIAGPCVIEDNSV-FETARRLKEIVAPYAVHWIFKSSYDKANRSSVHNYRGPGLK
KDSA_NEIMA      IKINDITLGNNLPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKANRSSIHSYRGVGLE
KDSA_CHLTB      ----------ENKMLLIAGPCVIEDNSV-FETARRLKEIVAPYAVHWIFKSSYDKANRSSVHNYRGPGLR
KDSA_CHLT2      ----------ENKMLLIAGPCVIEDNSV-FETARRLKEIVAPYAVHWIFKSSYDKANRSSVHNYRGPGLR
KDSA_HELHP      ---------------LMSGPCVIESYEALSAVAQALKPLSEKAHIDFYFKASFDKANRTSLESYRGPGLE
KDSA_CHRVO      -------VGNEAPFTLFGGINVLESRDLALRAAEEYVRVTQKLGIPYVFKGSFDKANRSSIHSYRGPGLE
KDSA_CAMJ8      -----------KKMILIAGPCVIESKDLIFKVAEQLKNFNENPNIEFYFKSSFDKANRTSINSFRGPGLE
KDSA_VIBSL      ----------DKPFTLFAGMNVLESRDLAMQICEHYVKVTEKLGIPYVFKASFDKANRSSVHSYRGPGME
KDSA_CHLMU      ---------------LIAGPCVIEDNSV-FETARRLKEIVAPYSVHWIFKSSYDKANRSSLQNYRGPGLK
KDSA_VIBCM      -------VANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHSYRGPGLE
KDSA_VIBCH      -------VANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHSYRGPGLE
KDSA_VIBC3      -------VANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHSYRGPGLE
KDSA_ALISL      VKIGNIDVANDKPFTLFAGMNVLESRDLAMRMCETYVEITDRLGIPYVFKASFDKANRSSVHSYRGPGME
KDSA_VIBVY      -------VANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHSYRGPGLE
KDSA_VIBVU      -------VANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHSYRGPGLE
KDSA_VIBPA      -------VANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHSYRGPGLE
KDSA_VIBHB      -------VANDKPFTLFAGMNVLESRDLAMQICEHYVKVTDKLGIPYVFKASFDKANRSSVHSYRGPGLE
KDSA_METRJ      ------------PLTLIAGPCQLEGRQHALEIAAALKEMAAGLGVGLVFKTSFDKANRTSGSAARGIGLD
KDSA_RHILO      ---------------LIAGPCQFESRQHAFDMAGALKELTARLGIGLVYKTSYDKANRTSLSATRGAGMD
KDSA_HAEDU      ------EIANDRPFTLFGGMNVLESRDMAMRVCEKYVAVTNKLNVPYIFKASFDKANRSSIHSYRGPGME
KDSA_DESVV      --------------FILAGPCALEDFDVAMXXXXXXXXXXXXXXXXXVFKSSWDKANRTSITSFRGPGLV
KDSA_DESVH      --------------FILAGPCALEDFDVAMXXXXXXXXXXXXXXXXXVFKSSWDKANRTSITSFRGPGLV
AROF_THEMA      -------------FTIIAGPCSVEGREMLMETAHFLS----ELGVKVLRGGAYKP--RTSPYSFQGLG-E
AROG_BACSU      ----------------IVGPCAVES----YXXXXXXXXXXXXXGIKILRGGAFKP--RTSPYDFQGLGVE


                         .         .         *         .         .         .         .:140
query           KGLEILATVKRQIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
KDSA_RALEJ      KGLEILATVKREIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
KDSA_RALEH      KGLEILATVKREIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
KDSA_CUPTR      KGLEILAHVKREIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
KDSA_BURMS      EGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
KDSA_BURMA      EGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
KDSA_BURM9      EGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
KDSA_BURM7      EGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
KDSA1_BURPS     EGLRILAEVKRQLNVPVLTDVHEIDEIAPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
KDSA_BURM1      EGLRILSEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPVNIKKGQFLAP
KDSA_RALPJ      EGLRILSEVRRQVGVPVLTDIHEIDEIKPVAEVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
KDSA_RALSO      EGLRILAEVRRQVGVPVLTDIHEIDEIKPVASVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
KDSA_BURCJ      EGLRILSEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPVNIKKGQFLAP
KDSA_VARPS      KGLEILAKVKRELGLPVLTDVHTEDDITEAAKVVDVLQTPAFLCRQTDFIRAVAQSGKPVNIKKGQFLAP
KDSA_BURCC      EGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPVNIKKGQFLAP
KDSA_BURCH      EGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPVNIKKGQFLAP
KDSA_BURCA      EGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPVNIKKGQFLAP
KDSA_BURVG      EGLRILGEVKRQLGLPVLTDVHSIDEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPVNIKKGQFLAP
KDSA_BURP8      EGLRILSEVKRQLGLHVLTDVHSEHEIEPVASVVDVLQTPAFLCRQTDFIHACARSGKPVNIKKGQFLAP
KDSA_METPP      KGLEILAKVRRDLQVPVLTDVHSEAEIPVVAQHVDVLQTPAFLCRQTDFIRAVAQSGKPVNIKKGQFLAP
KDSA_POLNA      KGLQILAKVKRELGLPILTDVHSEAEITAVAAVVDVLQTPAFLCRQTDFIHAVAQSGRPVNIKKGQFLAP
KDSA_DELAS      KGLEILAKVKKDLQVPILTDVHTESEIPAVSQVVDVLQTPAFLCRQTDFIRAVAQSGRPVNIKKGQFLAP
KDSA_AZOSE      KGLEILADVKKQLGVPVLTDVHAIDEIPAVAAAVDVLQTPAFLCRQTDFIHAVAASGRPVNIKKGQFLAP
KDSA_BORPD      EGLKILADVRDQVGVPVLTDVHETEQVEPVAAVVDMLQTPAFLCRQTDFIRACAASLKPVNIKKGQFLAP
KDSA_ACIAC      KGLEILAKIRRELNVPVLTDVHTEDDITEAAKVVDVLQTPAFLCRQTDFIRAVAQSGKPVNIKKGQFLAP
KDSA_BURXL      EGLRILSEVKRQLGLPVLTDVHAEHEIEQVASVVDVLQTPAFLCRQTDFIHACARSGKPVNIKKGQFLAP
KDSA_RHOFD      RGLEILAKVKRELGVPILTDIHSEDQIAQVASVVDVLQTPAFLCRQTDFIRAVAQSGLPVNIKKGQFLAP
KDSA_POLSJ      KGLEILAKVKRELNLPLLTDVHSEADIATVASVVDVLQTPAFLCRQTDFIHAVAQSGKPVNIKKGQFLAP
KDSA_LARHH      AGLTILDKVKKQVGVPVLTDVHTAEEAPLAASVVDVLQTPAFLCRQTDFIRAVAATGKPVNIKKGQFLAP
KDSA_BORPE      EGLKILADVRAQLDVPVLTDVHDIDQVAPVAAVVDMLQTPAFLCRQTDFIRACAATLKPVNIKKGQFLAP
KDSA_BORPA      EGLKILADVRAQLDVPVLTDVHDIDQVAPVAAVVDMLQTPAFLCRQTDFIRACAATLKPVNIKKGQFLAP
KDSA_DECAR      EGLRIFSEVQRQIGVPVLTDVHTIEDIPAVAAVVDVLQTPAFLCRQTDFIHAVATCGKPVNIKKGQFLAP
KDSA_BORBR      EGLKILADVRAQLDVPVLTDVHDIDQVAPVAAVVDMLQTPAFLCRQTDFIRACAATLKPVNIKKGQFLAP
KDSA_AZOSB      KGLDILADVKKQLGVPVLTDVHSIEEIPAVAAVVDVLQTPAFLCRQTDFIHAVASCGRPVNIKKGQFLAP
KDSA_STRM5      EGLKVLAEVKKQIGVPVLTDVHEYTPMDEVASVVDVLQTPAFLVRQTDFIRKVCSAGKPVNIKKGQFLAP
KDSA_STRMK      EGLKVLAEVRKQIGVPVLTDVHEYTPMDEVASVVDVLQTPAFLVRQTDFIRKVCSAGKPVNIKKGQFLAP
KDSA_METCA      EGLRILAEVKRQIGVPVLTDVHEDTPLQEVASVVDVLQTPAFLCRQTNFIQNVANTGKPVNLKKGQFLAP
KDSA_ACISJ      AGLKILDEVRRQLQLPILTDVHDTSHVAEVASVVDVLQTPAFLCRQTDFIRAVAQSGKPVNIKKGQFLAP
KDSA_DIAST      AGLKILDEVRRQLQLPILTDVHDTSHVAEVASVVDVLQTPAFLCRQTDFIRAVAQSGKPVNIKKGQFLAP
KDSA_XYLFT      EGLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVCAVGKPVNIKKGQFLSP
KDSA_XYLFM      EGLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVCAVGKPVNIKKGQFLSP
KDSA_XYLFA      EGLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVCAVGKPVNIKKGQFLSP
KDSA_XYLF2      EGLKVLEAVKTQIGVPVLTDVHEYTPIDEVATVVDVLQTPAFLVRQTDFIRNVCAVGKPVNIKKGQFLSP
KDSA_LEGPH      KGLSILEKVKSQIGVPVLTDVHEDTPLFEVSSVVDVLQTPAFLCRQTNFIQKVAAMNKPVNIKKGQFLAP
KDSA_LEGPC      KGLSILEKVKSQIGVPVLTDVHEDTPLFEVSSVVDVLQTPAFLCRQTNFIQKVAAMNKPVNIKKGQFLAP
KDSA_LEGPA      KGLSILEKVKSQIGVPVLTDVHEDTPLFEVSSVVDVLQTPAFLCRQTNFIQKVAAMNKPVNIKKGQFLAP
KDSA_LEPCP      AGLKILDEVRRQTGLPVLTDVHDESQVAEVASVVDVLQTPAFLCRQTDFIRAVAMSGKPVNIKKGQFLAP
KDSA_LEGPL      KGLSILEKVKSQIGVPVLTDVHEDTPLFEVSSVVDVLQTPAFLCRQTNFIQKVAAMNKPVNIKKGQFLAP
KDSA_METFK      EGLKILDEVRRQVGVPILTDVHTEAQVPHVAAVVDVLQTPAFLCRQTDFITACAQSGKPVNIKKGQFLAP
KDSA_ACIF5      EGLRILEKVRREVGVPVVTDVHEKXXXXXXXXXXXXLQTPAFLCRQTDFIQAVAAAGKPVNIKKGQFLAP
KDSA_ACIF2      EGLRILEKVRREVGVPVVTDVHEKXXXXXXXXXXXXLQTPAFLCRQTDFIQAVAAAGKPVNIKKGQFLAP
KDSA_THISH      XXXXXXXTVKQQIGVPVLTDVHEDTPLEEVAAVVDVLQTPAFLCRQTNFIQNVARQGRPVNIKKGQFLAP
KDSA_XANOP      EGLKVLDAVKRQIGVPVLTDVHEYTPMNEVAAVVDVLQTPAFLVRQTDFIKNVCAAGKPVNIKKGQFLAP
KDSA_XANOM      EGLKVLDAVKRQIGVPVLTDVHEYTPMNEVAAVVDVLQTPAFLVRQTDFIKNVCAAGKPVNIKKGQFLAP
KDSA_XANCP      EGLKVLDAVKKQIGVPVLTDVHEYTPMNEVAAVVDVLQTPAFLVRQTDFIKNVCAAGKPVNIKKGQFLAP
KDSA_XANCB      EGLKVLDAVKKQIGVPVLTDVHEYTPMNEVAAVVDVLQTPAFLVRQTDFIKNVCAAGKPVNIKKGQFLAP
KDSA_XANC8      EGLKVLDAVKKQIGVPVLTDVHEYTPMNEVAAVVDVLQTPAFLVRQTDFIKNVCAAGKPVNIKKGQFLAP
KDSA_ALHEH      AGLRVLEQVRRQIGVPVITDVHEDTPLVEVASVVDVLQTPAFLCRQTNFIQNVARQGRPVNIKKGQFLAP
KDSA_XANC5      EGLKVLDAVKKQIGVPVLTDVHEYTPMNEVAAVVDVLQTPAFLVRQTDFIKNVCAAGKPVNIKKGQFLAP
KDSA_THICR      EGLRILQKVKDEIGVPVLTDVHEDTPLDEVASVVDVMQTPAFLVRQTNFIQNVCRQGLPVNIKKGQFQAP
KDSA_THIDA      XXXXILADVKAKIGVPVLTDVHEDTPLDEVAAVVDVLQTPAFLCRQTNFIQNVARAGRPVNIKKGQFLAP
KDSA_XANAC      EGLKVLDAVKKQIGVPVLTDVHEYTPMNEVAAVVDVLQTPAFLVRQTDFIKNVCAAGKPVNIKKGQFLAP
KDSA_DICNV      EGLRILAKVKETFAVPILTDVHEYTPLDEVASVVDVLQTPAFLCRQTDFIRVCAQ-GKPVNIKKGQFLAP
KDSA_COXB1      KGLTILEKVKKTLEVPIITDVHEDTPLQEVAAVVDVLQTPAFLCRQSNFIRSVAACGKPVNIKKGQFLAP
KDSA_COXBU      KGLTILEKVKKTLEVPIITDVHEDTPLQEVAAVVDVLQTPAFLCRQSNFIRSVAACGKPVNIKKGQFLAP
KDSA_COXB2      KGLTILEKVKKTLEVPIITDVHEDTPLQEVAAVVDVLQTPAFLCRQSNFIRSVAACGKPVNIKKGQFLAP
KDSA_COXBN      KGLTILEKVKKTLEVPIITDVHEDTPLQEVAAVVDVLQTPAFLCRQSNFIRSVAACGKPVNIKKGQFLAP
KDSA_FRATN      KGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVCKQGKPVNIKKGQFLAP
KDSA_FRAP2      KGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVMQTPAFLCRQTNFILDVCKQGKPVNIKKGQFLAP
KDSA_VESOH      EGLRILQKVKDEVGVPVLTDVHEDTPLSEVASVVDMMQTPAFLVRQTNFIQNVCKQGIPVNIKKGQFQAP
KDSA_FRATH      KGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQIPAFLCRQTNFILEVCKQGKPVNIKKGQFLAP
KDSA_FRATM      KGLEILAKVKKTYNVPVVTDVHEDTPFAEVAEVVDVLQTPAFLCRQTNFILEVCKQGKPVNIKKGQFLAP
KDSA_VEREI      KGLEILARVRRELALPVLTDVHTEXXXXXXXXXXXXLQTPAFLCRQTDFISAAARCGKPVNIKKGQFLAP
KDSA_NITOC      AGLGILEKVKATLGVPVLTDVHEDTPLQEVAAVVDVLQTPAFLCRQTNFIQNVARQGRPVNIKKGQFLAP
KDSA_GEOSM      EGLRILAKVKEALGVPVLSDIHSIEQVEPAADVLDVLQIPAFLCRQTDLLVAAANTGKVINVKKGQFLAP
KDSA_GEOBB      EGLRILAKVKEALGVPVLSDIHSIEQVEPAAEVLDVLQIPAFLCRQTDLLVAAGNTGKVINVKKGQFLAP
KDSA_PELCD      SGLRILDKVRQQTGLPIVSDIHDVSQVEAAAEVLDILQIPAFLCRQTDLLLAAGRSGKVVNIKKGQFLAP
KDSA_GRABC      RGLDILAGIRERFDIPVLTDIHDIGQCKPAAEAVDILQIPAFLCRQTDLLLAAGETGRTINVKKGQFLAP
KDSA_DESPS      KGLASLARIREDLQVPVISDIHDISQVGPAAEVLDIIQIPAFLCRQTDLLVAAAKSGKPVNVKKGQFVSP
KDSA_GEOUR      DGLKILKKVKEALGVPVLSDIHSIEQVEPAAEVLDVVQIPAFLCRQTDLVVAAARSGKVVNIKKGQFLAP
KDSA_MAGSM      AGLRILERVRREVGVPVITDVHEADQCVAVAEVVDMLQTPAFLCRQTDFIQAAARPGKPVNIKKGQFLAP
KDSA_CYAP4      DGLQTLQRVKEKIGVPVLTDIHESYQAAIVAEVVDVLQIPAFLCRQTDLLLAAAATGRVINVKKGQFLAP
KDSA_RICCK      KGLEVLSKVKAEFDCPIVTDVHSESQCTETARVVDILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAP
KDSA_DESOH      LGLDILRRVKERLHVPVLSDVHTESQIGPAAQVLDIIQTPAFLCRQTDFITAVAATGKIINIKKGQFLAP
KDSA_SYNP6      EGLRILERVKTELGLPVLTDIHESQQAATVAEVVDILQIPAFLCRQTDLLLAAAATGRTVNVKKAQFLAP
KDSA_SYNE7      EGLRILERVKTELGLPVLTDIHESQQAATVAEVVDILQIPAFLCRQTDLLLAAAATGRTVNVKKAQFLAP
KDSA_GEOLS      EGLRILSKVKESLGIPVLSDIHSIEQVAPAAQVLDVLQIPAFLCRQTDLVVAAAKTGKVVNVKKGQFLAP
KDSA_GEOSF      DGLKILKKVKESLGVPVLSDIHSIEQVEPAAEVLDVIQIPAFLCRQTDLVVAAAMSGRVINIKKGQFLAP
KDSA_BARQU      KAMAIFSDIKKEFGCPVLTDVHTEEQCAAVGSVVDVLQIPAFLCRQTDLLVAAAKTGRVINIKKGQFLAP
KDSA_HAHCH      EGLRIFEEIKRTFNVPVITDIHEPHQAQPVAEVADIIQLPAFLSRQTDLVAAMARTGCPVNIKKAQFLAP
KDSA_BARHE      NAMAIFSDLKKEFGCPILTDVHTEEQCTVVASTVDILQIPAFLCRQTDLLVAAAKTGRVINIKKGQFLAP
KDSA_FUSNN      EGMKMLTKIKEKFNVPVITDVHEAWQCKEVAKVADILQIPAFLCRQTDLLIAAAETGKAVNIKKGQFLAP
KDSA_BARBK      KAIAIFADLKKEFGFPILTDVHTEEQCRAVSSVVDVLQIPAFLCRQTDLLVAAAKTGCVINIKKGQFLAP
KDSA_SYNFM      EGLAILSEVRREIGIPVLTDVHGVSEVAPAKEVVDILQVPAFLARQTDLVVAVGLTGKPVNLKKAQFLAP
KDSA_LEPIN      EGIKNLEYIKNKYNVPVLTDIHETSQISPLKDVIDVYQIPAFLCRQTDLISQSAQTGKWVNVKKGQFLAP
KDSA_LEPIC      EGIKNLEYIKNKYNVPVLTDIHETSQISPLKDVIDVYQIPAFLCRQTDLISQSAQTGKWVNVKKGQFLAP
KDSA2_BURPS     EGLKIFAEVKARFGVPVITDVHEVEQAAPVAEIADVLQVPAFLARQTDLVVAIAKAGKPVNVKKPQFMSP
KDSA_RHOPS      AALAIFAEIRDSVGLPVLTDVHEAEQCARAAEAVDILQIPAFLCRQTDLLLAAAATGRIVNVKKGQFLAP
KDSA_BRAJA      QSLPIFAEIRSSLGLPVLTDVHEATQCAEVAQAVDILQIPAFLCRQTDLLLAAAATGKVVNVKKGQFLAP
KDSA_RHOPA      AALPIFAEIRDHLGLPVLTDVHENEQCARAAEAVDILQIPAFLCRQTDLLLAAAATGRIVNVKKGQFLAP
KDSA_PELPD      EGLRILRKVKESLGLAVLSDVHSIEQVAPAAEVLDVLQIPAFLCRQTDLLIAAAATGRVINVKKGQFLAP
KDSA_OCHA4      KAMEVFADLKKEFGFPVLTDIHTEEQCAAVAPVVDVLQIPAFLCRQTDLLIAAAKTGRVVNVKKGQFLAP
KDSA_RHOPT      AALPIFAEIRDHLGLPVLTDVHENEQCARAAEAVDILQIPAFLCRQTDLLLAAAATGRIVNVKKGQFLAP
KDSA_RHOP2      GALPIFAEIRDSIGLPVLTDVHEAGQCARAAEAVDILQIPAFLCRQTDLLLAAAATGRIVNVKKGQFLAP
KDSA_RICTY      KGLEILSKVKSEFNCPIITDVHSESQCTDTAKVVDILQIPAFLCRQTDLLKAAAKTGKIVKVKKGQFLAP
KDSA_BART1      KAMAIFSDLKKEFDCPILTDVHTEEQCTIVSSTVDILQIPAFLCRQTDLLVAAAKTGCVVNIKKGQFLAP
KDSA_RICFE      KGLEILSKVKSEFDCPIVTDVHSESQCTETAEIADILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAP
KDSA_GEOSL      EGLRILQKVKDSLGIPVISDIHSIEQVKPAAEVLDIIQVPAFLCRQTDLVVEVGRTNRVVNVKKGQFMAP
KDSA_RICPR      KGLEILSKVKSEFDCPIITDVHSESQCIETAKVVDILQIPAFLCRQTDLLKAAAKTGKIVKVKKGQFLAP
KDSA_NITHX      QALPVFAEIGSSLGLPVLTDVHEAAQCTEVAQAVDVLQIPAFLCRQTDLLLAAAATGKVVNVKKGQFLAP
KDSA_GEOMG      EGLRILAKVKESLGLPVISDIHSIEQVQPAAEVLDILQIPAFLCRQTDLLVEAARTGCVVNVKKGQFLAP
KDSA_RICAH      KGLEILSKVKSEFDCPIVTDIHSESQCTETAEVADILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAP
KDSA_RICRS      KGLEILSKVKSEFDCPIVTDVHSESQCTATAEVADILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAP
KDSA_RICRO      KGLEILSKVKSEFDCPIVTDVHSESQCTATAEVADILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAP
KDSA_RICCN      KGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAP
KDSA_RICAE      KGLEILSKVKSEFDCPIVTDVHSESQCTETAEVADILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAP
KDSA_ACIBL      EGLRILAKVADEVNVPVLTDVHDTEQATAAGDIVDVLQIPAFLCRQTDLLVAAAKTGKVVNVKKGQFVAP
KDSA_RICPU      KGLDILSKVKSEFDCPIVTDVHSESQCIETAEVADILQIPAFLCRQTDLLQAAAKTGKIVKVKKGQFLAP
KDSA_BDEBA      EGLKIFAELKKTFGVKVITDVHEIHQAKPVAEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFLSP
KDSA_SHEAM      EGLKIFQEIKDTFNVPLITDVHEPHQCAPVAEVVDIIQLPAFLARQTDLVIAMARTGAIINVKKPQFLAP
KDSA_PSYIN      EGLRIFEEIKNTFNVPIITDVHEPSQAAPVAEVVDVIQLPAFLSRQTDLVKAMAETNAVINVKKAQFLAP
KDSA_DESAA      QGLAILGKVKSRLGLPVISDVHSPDQVGPASEVLDILQIPAFLCRQTDLLTAAGNSGKPVNVKKGQFVGP
KDSA_PSEPW      EGLRIFEKVKAEFGVPIITDVHEIYQCAPVAEVVDVLQLPAFLARQTDLVVALAKTGKPVNIKKPQFLSP
KDSA_AQUAE      YGVKALRKVKEEFGLKITTDIHESWQAEPVAEVADIIQIPAFLCRQTDLLLAAAKTGRAVNVKKGQFLAP
KDSA2_PSEPK     EGLRIFEKVKAEFGVPIITDVHEIYQTAPVAEVVDVLQLPAFLARQTDLVVALAKTGKPVNIKKPQFLSP
KDSA_HAEPS      EGLKIFQELKDTFGVKIITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVEAMARTGAVINVKKPQFLSP
KDSA_BRUSU      KALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAP
KDSA_BRUSI      KALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAP
KDSA_BRUO2      KALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAP
KDSA_BRUME      KALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAP
KDSA_BRUMB      KALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAP
KDSA_BRUC2      KALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAP
KDSA_ACTSZ      EGLKIFQELKKTFGVKVIADVHEIYQCNPVAEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFLSP
KDSA_MANSM      EGLKIFQELKQTFGVKIITDVHEIYQCKPVAEVADVIQLPAFLARQTDLVEAMARTGAVINVKKPQFLSP
KDSA_BRUAB      KALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAP
KDSA_BRUA2      KALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAP
KDSA_BRUA1      KALEVFSDLKKEYGFPVLTDIHTEEQCAAVAPVVDVLQIPAFLCRQTDLLIAAARTGRVVNVKKGQFLAP
KDSA_ACTPL      EGLKIFQELKDTFGVSIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMARTGVVINVKKPQFLSP
KDSA_ACTPJ      EGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMARTGAVINVKKPQFLSP
KDSA_ACTP7      EGLKIFQELKDTFGVNIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMARTGAVINVKKPQFLSP
KDSA_PASHA      EGLKIFQELKDTFGVKIITDVHEIYQCKPVAEVVDIIQLPAFLARQTDLVEAMARTGAVINVKKPQFLSP
KDSA_SYNPX      AGLQILQAVKDTLGIPVITDVHSPEEAKAAAKVADIIQLPAFLARQTDLVRAMAETGAVINIKKPQFLSP
KDSA_ACAM1      EGLRILQRVKDEVGVPVVTDIHESHQAAPVAEVADILQIPAFLCRQTDLLMAAAATGRTINVKKGQFLAP
KDSA_JANMA      EGLRIFEDVKKTFGVPLITDVHEPYQAKIAAEVIDVLQLPAFLARQTDLVVALAQTGRVINIKKPQFLSP
KDSA_SHEPA      EGLKIFEEIKSTFNLPLITDVHEVHQCAPVAEVVDVIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_SHEHH      EGLKIFEEIKSTFNLPLITDVHEVQQCAPVAEVVDVIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_HAEIN      EGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAMAKTGAVINVKKPQFLSP
KDSA_COLP3      EGLKIFEEIKSTFNVPIITDVHESYQAQPVSEVVDVIQLPAFLARQTDLVVAMAKTGAVINVKKPQFLAA
KDSA_HAES1      EGLKIFQELKETFGVKVITDVHEIYQCRPVAEVVDIIQLPAFLARQTDLVEAMARTGAVINVKKPQFLSP
KDSA_HAEI8      EGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAMAKTGAVINVKKPQFLSP
KDSA_PROMM      EGLEILQVVKDTHGIPVITDVHSPEEATPAAEVCDIIQLPAFLARQTDLIEAMAKTGAVINIKKPQFLSP
KDSA_HAES2      EGLKIFQELKETFGVKVITDVHEIYQCRPVAEVVDIIQLPAFLARQTDLVEAMARTGAVINVKKPQFLSP
KDSA_HAEIE      EGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAMAKTGAVINVKKPQFLSP
KDSA_SHEPW      EGLKIFEEIKSTFNLPLITDVHEVHQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_SHEFN      EGLRIFEEIKSTFNVPMITDVHEIHQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAVINVKKPQFLAP
KDSA_HAEIG      EGLKIFQELKDTFGVKIITDVHEIYQCQPVADVVDIIQLPAFLARQTDLVEAMAKTGAVINVKKPQFLSP
KDSA_SHEDO      EGLKIFEEIKRTFNVPLITDVHEVHQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_RICBR      KGLEVLAEVKRAFNCPIVTDVHSENQCAEVAKIVDMLQIPAFLCRQTDLLQAAAATGKIVNVKKGQFLAP
KDSA_RICB8      KGLEVLAEVKRAFNCPIVTDVHSENQCAEVAKIVDMLQIPAFLCRQTDLLQAAAATGKIVNVKKGQFLAP
KDSA_CHLPS      EGLRILSKVKQTFGVEILTDVHSPEEARAAAEVCDILQIPAFLCRQTDLLVAAAETHAVINIKKGQFLSP
KDSA_CHLFF      EGLRILSKVKETLGVEILTDVHSPEEARAAAEVCDILQIPAFLCRQTDLLVAAAETNAIINIKKGQFLSP
KDSA_SALPK      EGMKIFQELKQTFGVKVITDVHEASQVQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALPA      EGMKIFQELKQTFGVKVITDVHEASQVQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_PEA        EGLKILEKVKIAYDIPIVTDVHEASQCEPVGRVADIIQIPAFLCRQTDLLVAAAKTGKIINIKKGQFCAP
KDSA_MARAV      KGLQILADIKSKFGVPIISDVHEPGQAAPAAEVCDIIQLPAFLSRQTDLVVAMAKTGAVINIKKAQFLAP
KDSA_PSEE4      EGLKIFEEIKRTFNVPVITDVHEPYQCEPVAQVCDIIQLPAFLSRQTDLVVAMAKTGAVINIKKAQFLAP
KDSA_PHOLL      EGMKIFQELKQTFGVKIITDVHESAQAQPVAEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFISP
KDSA_NITWN      QALPVFADIRSSLGLPVLTDXXXXXXXXXXXXXXDVLQIPAFLCRQTDLLLAAAATGKVVNVKKGQFLAP
KDSA_SHEWM      EGLKIFEEIKSTFNLPLITDVHEIHQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_SALTY      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALTI      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALSV      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALPC      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALPB      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALNS      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALHS      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALG2      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALEP      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALDC      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALCH      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SALA4      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_PASMU      QGLKIFQELKDTFGVKLITDVHEIYQCQPVAEVVDIIQLPAFLARQTDLVAAMAKTGAIINVKKPQFLSP
KDSA_SHEB9      EGLKIFEEIKKTFNLPLITDVHEVHQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_SHEB8      EGLKIFEEIKKTFNLPLITDVHEVHQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGTIINVKKPQFLAP
KDSA_SHEB5      EGLKIFEEIKKTFNLPLITDVHEVHQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_SHEB2      EGLKIFEEIKKTFNLPLITDVHEVHQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_PSEU5      EGMKIFEKVKKTFGVPVITDVHEPWQAQPVADVCDIIQLPAFLSRQTDLVVAMAKTGAVINIKKAQFLAP
KDSA_PHOPR      EGLKIFQELKDTFGVKIITDIHEIYQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQYMSP
KDSA_EDWI9      EGMKIFQELKRTFGVKIITDVHTPEQAQPVADVVDIIQLPAFLARQTDLVEAMAKTGAVINVKKPQFLSP
KDSA_ARATH      EGLKILEKVKVAYDLPIVTDVHESSQCEAVGKVADIIQIPAFLCRQTDLLVAAAQTGKIINIKKGQFCAP
KDSA_SALAR      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_CAUCR      DSLAIFQEIREVTGLPTLTDVHETSHCSIVAEAVDVIQIPAFLCRQTDLLVAAASTGRAINIKKGQFLAP
KDSA_CAUCN      DSLAIFQEIREVTGLPTLTDVHETSHCSIVAEAVDVIQIPAFLCRQTDLLVAAASTGRAINIKKGQFLAP
KDSA_BRASB      QSLPIFAEIRSSLGLPVLTDIHDASQCAEVAQAVDVLQIPAFLCRQTDLLLAAAATGKVVNVKKGQFLAP
KDSA_SHELP      EGLKIFQEIKDTFNLPLITDVHEPYQCQPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_YERE8      EGMKIFQELKQQFGVKVITDVHEISQCQPVAEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFVSP
KDSA_CITK8      EGMKIFQELKQTFGVKVITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SHEON      EGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_PSEHT      EGLKIFEEIKKTFNIPLITDVHEPHQAAPVAEVVDVIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_PARUW      EGLRILERIQKEFGLAVVTDVHSPQEATTAGSVCEIIQIPAFLCRQTDLILAAAQTGAIVSIKKGQFLAP
KDSA_MESSB      AALPIFADLRRELGVPVLTDVHTEGQCEILADAVDVLQIPAFLCRQTDLLVAAAKTGKVVNVKKGQFLAP
KDSA_WOLSU      KGLEMLGRIKEEFGYKLLTDIHETQQVAKAAQVVDILQIPAFLCRQTDLIVEAAKSQSIVNIKKGQFMNP
KDSA_PSEPG      EGLKIFEEIKRTFNVPVITDVHEPYQAEPVAKVCDIIQLPAFLSRQTDLVVAMAKTGAVINIKKAQFLAP
KDSA_BRASO      QSLPIFAEIRSSLGLPVLTDVHDASQCAEVAQAVDILQIPAFLCRQTDLLLAAAATGKVVNVKKGQFLAP
KDSA_CHLPN      EGLRILAKVKETFGVGILTDVHTPQDAYAAAEVCNILQVPAFLCRQTDLLVATAETGAIVNLKKGQFLSP
KDSA_CHLCV      EGLRILSKVKDTLGVEILTDVHSPEEARAAAKVCDILQIPAFLCRQTDLLVAAAETNAVINIKKGQFLSP
KDSA1_PSEPK     EGLKIFEEIKRTFNVPVITDVHEPYQAEPVAKVCDIIQLPAFLSRQTDLVVAMAKTGVVINIKKAQFLAP
KDSA_SHESH      EGLKIFEEIKSTFNLPLITDVHEVHQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTDAIINVKKPQFLAP
KDSA_PSEMY      EGMKIFEEVKKTFGVPVITDVHEPHQAAAVAEVCDIIQLPAFLSRQTDLVVAMAKTGAVINIKKAQFLAP
KDSA_HELP2      KGLEMLQTIKDEFGYKILTDVHESYQASVAAKVADILQIPAFLCRQTDLIVAVSQTDAIVNIKKGQFMNP
KDSA_BORA1      EGMRIFEKVKQEFGVPIITDVHEPWQAAIVAQTADILQLPAFLARQTDLVIALAKTGKVINIKKPQFLSP
KDSA_RHOBA      QGLGLLEAVRANTGLPVTTDIHLPEQAAAVGEVCDLLQIPAFLARQTDLLVAAASTGRPVNVKKGQFMSP
KDSA_ENTS8      EGMKIFQELKQTFGVKIITDVHTAEQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFISP
KDSA_ENT38      EGMKIFQELKQTFGVKVITDVHEASQAQPVAEVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_YERPY      EGMKIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFVSP
KDSA_YERPS      EGMKIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFVSP
KDSA_YERPP      EGMKIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFVSP
KDSA_YERPN      EGMKIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFVSP
KDSA_YERPG      EGMKIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFVSP
KDSA_YERPE      EGMKIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFVSP
KDSA_YERPB      EGMKIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFVSP
KDSA_YERPA      EGMKIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFVSP
KDSA_YERP3      EGMKIFQELKQQFGVKVITDVHEASQAQPVSEVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFVSP
KDSA_SHISS      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SHIFL      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SHIF8      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SHIDS      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SHIBS      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SHIB3      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SHESR      EGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_SHESA      EGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_ECOUT      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECOSM      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECOSE      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECOLU      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECOLI      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECOLC      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECOL6      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECOK1      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECOHS      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECODH      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECOBW      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECO8A      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECO81      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECO7I      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECO5E      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECO57      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECO55      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECO45      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECO27      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ECO24      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_SHESW      EGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_SHEPC      EGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_ESCF3      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ACIBY      KGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAKTQAIINIKKAQFLAP
KDSA_ACIBT      KGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAKTQAIINIKKAQFLAP
KDSA_ACIBC      KGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAKTQAIINIKKAQFLAP
KDSA_ACIB3      KGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAKTQAIINIKKAQFLAP
KDSA_SHESM      EGLKIFEEIKKTFNLPLITDVHEPYQCAPVAEVVDIIQLPAFLARQTDLVVAMAKTGAIINVKKPQFLAP
KDSA_HELPY      KGLEMLQTIKEEFGYKILTDVHESYQASVAAKVADILQIPAFLCRQTDLIVEVSQTNAIVNIKKGQFMNP
KDSA_ECOL5      EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_AZOVD      EGMRIFEEVKKAFGVPVLTDVHEPWQAAPVAEVCDILQLPAFLSRQTDLVVAMAKTSAVINIKKAQFLAP
KDSA_SYNPW      DGLAMLQAVKDTHGIPVITDVHTPEQAAPAAEVCDIIQLPAFLARQTDLVQAMAGTGAVINIKKPQFLSP
KDSA_SERP5      EGMKIFEEIKKTFGVKTITDVHEASQAQPVSEVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_KLEP7      EGMKIFQELKQTFGVKIITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_KLEP3      EGMKIFQELKQTFGVKIITDVHEASQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_ACIBS      KGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAKTQAIINIKKAQFLAP
KDSA_SODGM      EGMKIFSELKAQFGVKVITDVHEAGQAQSVADVVDVIQLPAFLARQTDLVEAMARTGAVINVKKPQFISP
KDSA_ERWCT      EGMKIFQELKQTFGVKIITDVHDSHQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_NEIMF      EGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVAAMAETGNVINIKKPQFLSP
KDSA_AGRT5      SAMEIFADLKKEFGFPVLSDIHTEEQCAIVSEVVDVLQIPAFLSRQTDLLVAAAKTGRVINVKKGQFLAP
KDSA_RHIME      KAMEVFADLKREFGFPVLTDIHTEEQCAAVAETVDILQIPAFLSRQTDLLVAAAKTGRTINVKKGQFLAP
KDSA_HELPH      KGLEMLQIIKEEFGYKILTDVHESYQASVAAKVADILQIPAFLCRQTDLIVEVSQTNAIINIKKGQFMNP
KDSA_HELPJ      KGLEMLQTIKDEFGYKILTDVHESYQASVAAKVADILQIPAFLCRQTDLIVEVSQTNAIVNIKKGQFMNP
KDSA_ERWT9      EGMKIFQEIKQAFGVKIITDVHEASQAQTVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_PECCP      EGMKIFQELKQTFGVKIITDVHEAHQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_HELAH      KGLEMLQAIKDEFGYKILTDVHESYQVSIAVKVADILQIPAFLCRQTDLIVEVSQTNAIINIKKGQFMSP
KDSA_ACIAD      KGIEWLGEIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAKTQAIINIKKAQFLSP
KDSA_PSEFS      EGMRIFQDIKQAFGVPIITDVHEPEQAAVVAEVCDIIQLPAFLSRQTDLVVAMAKTGAVINIKKAQFLAP
KDSA_PROMH      EGMKIFQELKETFGVKIITDVHEPSQAQPVSEVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
KDSA_PSEPF      EGMRIFQDIKQAFGVPIITDVHEPDQAAVVAEVCDIIQLPAFLSRQTDLVVAMAKTNAVINIKKAQFLAP
KDSA_HELPS      KGLEMLQTIKDEFGYKILTDVHESYQASAAAKVADILQIPAFLCRQTDLIVEVSQTNAIINIKKGQFMNP
KDSA_PSEU2      EGMRIFEEIKRTFNVPLITDVHEPHQAAVVAEVCDIIQLPAFLSRQTDLVVAMAKTGAIINIKKAQFLAP
KDSA_PSEF5      EGMRIFEDVKQAFGVPIITDVHEPAQAAVVAEVCDIIQLPAFLSRQTDLVVAMAKTGAVINIKKAQF<