[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF07996.1

[Show Plain Result]


## Summary of Sequence Search
    1::397
   58::393     4e-31  33%  417 aa  DCDA_VIBCH RecName: Full=Diaminopimelate decarboxylase;       
   57::393     4e-31  31%  415 aa  DCDA_HAEIN RecName: Full=Diaminopimelate decarboxylase;       
   57::375     5e-30  33%  415 aa  DCDA_PSEAE RecName: Full=Diaminopimelate decarboxylase;       
   49::363     2e-29  31%  406 aa  DCDA_NEIMA RecName: Full=Diaminopimelate decarboxylase;       
   62::384     3e-29  30%  420 aa  DCDA_AQUAE RecName: Full=Diaminopimelate decarboxylase;       
   49::363     5e-29  29%  414 aa  DCDA_NEIMB RecName: Full=Diaminopimelate decarboxylase;       
   59::398     1e-27  30%  428 aa  DCDA_METTH RecName: Full=Diaminopimelate decarboxylase;       
   63::359     1e-27  30%  405 aa  DCDA_HELPJ RecName: Full=Diaminopimelate decarboxylase;       
   57::376     2e-27  32%  416 aa  DCDA_PSEFL RecName: Full=Diaminopimelate decarboxylase;       
   60::376     1e-26  28%  421 aa  DCDA_ZYMMO RecName: Full=Diaminopimelate decarboxylase;       
   63::359     5e-26  29%  405 aa  DCDA_HELPY RecName: Full=Diaminopimelate decarboxylase;       
   40::361     9e-25  28%  402 aa  DCDA_CAMJE RecName: Full=Diaminopimelate decarboxylase;       
   70::392     3e-22  27%  438 aa  DCDA_METJA RecName: Full=Diaminopimelate decarboxylase;       
   51::393     5e-22  28%  419 aa  DCDA_ARCFU RecName: Full=Diaminopimelate decarboxylase;       
   43::359     1e-20  32%  379 aa  DCDA_DEIRA RecName: Full=Diaminopimelate decarboxylase;       
  127::444     5e-20  29%  490 aa  DCDA_ORYSJ RecName: Full=Probable diaminopimelate decarboxylase,
  127::445     1e-17  28%  489 aa  DCDA2_ARATH RecName: Full=Diaminopimelate decarboxylase 2,
  122::440     1e-17  28%  484 aa  DCDA1_ARATH RecName: Full=Diaminopimelate decarboxylase 1,
   83::435     5e-17  28%  469 aa  DCDA_SYNY3 RecName: Full=Diaminopimelate decarboxylase;       
   73::403     5e-17  30%  437 aa  DCDA_ACTPA RecName: Full=Diaminopimelate decarboxylase;       
   67::410     2e-16  31%  447 aa  DCDA_MYCTU RecName: Full=Diaminopimelate decarboxylase;       
   67::410     2e-16  31%  447 aa  DCDA_MYCBO RecName: Full=Diaminopimelate decarboxylase;       
   43::352     3e-16  29%  393 aa  DCLO_SELRU RecName: Full=Lysine/ornithine decarboxylase;       
   92::444     6e-16  29%  472 aa  DCDA_MYCLE RecName: Full=Diaminopimelate decarboxylase;       
   63::409     1e-15  25%  439 aa  DCDA_BACSU RecName: Full=Diaminopimelate decarboxylase;       
   73::397     2e-15  30%  435 aa  DCOR_PANRE RecName: Full=Ornithine decarboxylase;       
  112::431     2e-15  29%  461 aa  DCOR_DICDI RecName: Full=Probable ornithine decarboxylase;       
   67::388     2e-15  27%  422 aa  DCOR_CAEEL RecName: Full=Ornithine decarboxylase;       
   58::409     4e-15  26%  439 aa  DCDA_BACHD RecName: Full=Diaminopimelate decarboxylase;       
   58::405     2e-14  29%  440 aa  DCDA_STRCO RecName: Full=Diaminopimelate decarboxylase;       
   84::423     5e-14  26%  459 aa  DCDA_COREF RecName: Full=Diaminopimelate decarboxylase;       
   63::409     5e-14  25%  432 aa  DCDA_BACMT RecName: Full=Diaminopimelate decarboxylase;       
   51::401     7e-14  29%  420 aa  DCDA_ECOLI RecName: Full=Diaminopimelate decarboxylase;       
   92::444     2e-13  29%  474 aa  DCDA_MYCS2 RecName: Full=Diaminopimelate decarboxylase;       
   43::362     5e-13  25%  386 aa  DCDA_THEMA RecName: Full=Diaminopimelate decarboxylase;       
   53::285     6e-13  30%  420 aa  TABA_PSESZ RecName: Full=Protein tabA;
   64::386     1e-12  26%  456 aa  DCOR2_XENLA RecName: Full=Ornithine decarboxylase 2;       
   63::387     2e-12  29%  423 aa  DCOR_TRYBB RecName: Full=Ornithine decarboxylase;       
   65::389     7e-12  24%  461 aa  DCOR_MOUSE RecName: Full=Ornithine decarboxylase;       
   65::389     2e-10  25%  461 aa  DCOR_RAT RecName: Full=Ornithine decarboxylase;         Short=ODC; 
   65::389     2e-10  25%  461 aa  DCOR_MUSPA RecName: Full=Ornithine decarboxylase;       
   65::389     5e-10  27%  461 aa  DCOR_HUMAN RecName: Full=Ornithine decarboxylase;       
  136::379     5e-10  29%  418 aa  DCDA_BUCBP RecName: Full=Diaminopimelate decarboxylase;       
  110::332     1e-09  29%  484 aa  DCOR_NEUCR RecName: Full=Ornithine decarboxylase;       
   65::389     1e-09  25%  461 aa  DCOR_BOVIN RecName: Full=Ornithine decarboxylase;       
   90::292     2e-09  29%  635 aa  SPEA_GEOBB RecName: Full=Biosynthetic arginine decarboxylase;      
   90::292     5e-09  28%  635 aa  SPEA_GEOSM RecName: Full=Biosynthetic arginine decarboxylase;      
  284::505     7e-09  28%  707 aa  DCOR_LEIDO RecName: Full=Ornithine decarboxylase;       
   65::390     9e-09  25%  460 aa  DCOR1_XENLA RecName: Full=Ornithine decarboxylase 1;       
   51::379     9e-09  26%  415 aa  DCDA_BUCAP RecName: Full=Diaminopimelate decarboxylase;       
   96::356     1e-08  26%  637 aa  SPEA_SHEON RecName: Full=Biosynthetic arginine decarboxylase;      
   90::292     1e-08  27%  635 aa  SPEA_PELPD RecName: Full=Biosynthetic arginine decarboxylase;      
   55::379     1e-08  24%  450 aa  DCOR_CHICK RecName: Full=Ornithine decarboxylase;       
   70::409     2e-08  26%  445 aa  DCDA_CORGL RecName: Full=Diaminopimelate decarboxylase;       
   96::356     2e-08  26%  637 aa  SPEA_SHESW RecName: Full=Biosynthetic arginine decarboxylase;      
   96::356     2e-08  26%  637 aa  SPEA_SHEPC RecName: Full=Biosynthetic arginine decarboxylase;      
   94::407     3e-08  26%  432 aa  DCOR_SCHPO RecName: Full=Ornithine decarboxylase;       
   58::372     3e-08  27%  394 aa  DCOR1_DROME RecName: Full=Ornithine decarboxylase 1;       
   96::356     3e-08  26%  637 aa  SPEA_SHESA RecName: Full=Biosynthetic arginine decarboxylase;      
   90::270     3e-08  27%  431 aa  DCOR_SOLLC RecName: Full=Ornithine decarboxylase;       
   63::383     3e-08  24%  455 aa  DCOR_CRIGR RecName: Full=Ornithine decarboxylase;       
   94::409     3e-08  25%  435 aa  DCOR_CAPAN RecName: Full=Ornithine decarboxylase;       
   96::356     4e-08  27%  637 aa  SPEA_SHEB9 RecName: Full=Biosynthetic arginine decarboxylase;      
   96::356     4e-08  27%  637 aa  SPEA_SHEB8 RecName: Full=Biosynthetic arginine decarboxylase;      
   96::356     4e-08  27%  637 aa  SPEA_SHEB5 RecName: Full=Biosynthetic arginine decarboxylase;      
   96::356     4e-08  27%  637 aa  SPEA_SHEB2 RecName: Full=Biosynthetic arginine decarboxylase;      
   96::356     6e-08  26%  637 aa  SPEA_SHESR RecName: Full=Biosynthetic arginine decarboxylase;      
   96::356     6e-08  26%  637 aa  SPEA_SHESM RecName: Full=Biosynthetic arginine decarboxylase;      
  102::277     6e-08  30%  473 aa  DCOR_CANAL RecName: Full=Ornithine decarboxylase;       
   65::390     1e-07  25%  448 aa  AZIN1_MOUSE RecName: Full=Antizyme inhibitor 1;       
   90::270     1e-07  26%  431 aa  DCOR_DATST RecName: Full=Ornithine decarboxylase;       
   65::390     1e-07  24%  448 aa  AZIN1_PONAB RecName: Full=Antizyme inhibitor 1;       
   65::390     1e-07  24%  448 aa  AZIN1_HUMAN RecName: Full=Antizyme inhibitor 1;       
   66::389     2e-07  23%  459 aa  ADC_MOUSE RecName: Full=Antizyme inhibitor 2;       
  123::383     2e-07  26%  659 aa  SPEA_YERPE RecName: Full=Biosynthetic arginine decarboxylase;      
   96::356     2e-07  24%  636 aa  SPEA_SHEFN RecName: Full=Biosynthetic arginine decarboxylase;      
  137::375     5e-07  27%  415 aa  DCDA_BUCAI RecName: Full=Diaminopimelate decarboxylase;       
   96::356     8e-07  25%  636 aa  SPEA_SHEDO RecName: Full=Biosynthetic arginine decarboxylase;      
   90::292     1e-06  27%  635 aa  SPEA_GEOMG RecName: Full=Biosynthetic arginine decarboxylase;      
   96::356     1e-06  24%  636 aa  SPEA_SHEAM RecName: Full=Biosynthetic arginine decarboxylase;      
   98::358     1e-06  24%  635 aa  SPEA_PROMH RecName: Full=Biosynthetic arginine decarboxylase;      
   90::292     2e-06  26%  635 aa  SPEA_GEOSL RecName: Full=Biosynthetic arginine decarboxylase;      
   66::390     2e-06  24%  460 aa  ADC_HUMAN RecName: Full=Arginine decarboxylase;       
   65::390     4e-06  25%  448 aa  AZIN1_RAT RecName: Full=Antizyme inhibitor 1;       
   98::358     5e-06  25%  634 aa  SPEA_PHOLL RecName: Full=Biosynthetic arginine decarboxylase;      
   94::353     5e-06  27%  630 aa  SPEA_BACV8 RecName: Full=Biosynthetic arginine decarboxylase;      
   69::251     7e-06  28%  457 aa  Y4YA_RHISN RecName: Full=Uncharacterized protein y4yA;
   96::356     7e-06  26%  637 aa  SPEA_SHEPA RecName: Full=Biosynthetic arginine decarboxylase;      
   58::269     9e-06  28%  393 aa  DCOR2_DROME RecName: Full=Ornithine decarboxylase 2;       
  209::353     1e-05  32%  628 aa  SPEA_XANCP RecName: Full=Biosynthetic arginine decarboxylase;      
   94::353     1e-05  27%  630 aa  SPEA_NEIMB RecName: Full=Biosynthetic arginine decarboxylase;      
  125::357     1e-05  28%  637 aa  SPEA_MARAV RecName: Full=Biosynthetic arginine decarboxylase;      
   96::356     2e-05  25%  637 aa  SPEA_SHEHH RecName: Full=Biosynthetic arginine decarboxylase;      
   94::353     2e-05  27%  630 aa  SPEA_NEIMA RecName: Full=Biosynthetic arginine decarboxylase;      
  166::357     2e-05  27%  644 aa  SPEA_SYNPX RecName: Full=Biosynthetic arginine decarboxylase;      
  201::356     2e-05  27%  637 aa  SPEA_SHESH RecName: Full=Biosynthetic arginine decarboxylase;      
   90::292     3e-05  24%  635 aa  SPEA_GEOSF RecName: Full=Biosynthetic arginine decarboxylase;      
   95::360     3e-05  26%  640 aa  SPEA_VIBPA RecName: Full=Biosynthetic arginine decarboxylase;      
   96::356     3e-05  25%  637 aa  SPEA_SHEPW RecName: Full=Biosynthetic arginine decarboxylase;      
   96::352     5e-05  28%  628 aa  SPEA_XYLFM RecName: Full=Biosynthetic arginine decarboxylase;      
   95::386     5e-05  25%  641 aa  SPEA_VIBVU RecName: Full=Biosynthetic arginine decarboxylase;      
   96::352     1e-04  28%  628 aa  SPEA_XYLFA RecName: Full=Biosynthetic arginine decarboxylase;      
  209::353     1e-04  33%  628 aa  SPEA_XANAC RecName: Full=Biosynthetic arginine decarboxylase;      
  222::361     1e-04  22%  648 aa  SPEA_PROMP RecName: Full=Biosynthetic arginine decarboxylase;      
  209::352     2e-04  31%  628 aa  SPEA_XYLFT RecName: Full=Biosynthetic arginine decarboxylase;      
  209::352     2e-04  31%  628 aa  SPEA_XYLF2 RecName: Full=Biosynthetic arginine decarboxylase;      
  172::357     2e-04  23%  633 aa  SPEA_HAMD5 RecName: Full=Biosynthetic arginine decarboxylase;      
  195::380     2e-04  26%  662 aa  SPEA_DEIRA RecName: Full=Biosynthetic arginine decarboxylase;      
   94::353     2e-04  24%  630 aa  SPEA_BACFR RecName: Full=Biosynthetic arginine decarboxylase;      
   94::353     2e-04  24%  630 aa  SPEA_BACFN RecName: Full=Biosynthetic arginine decarboxylase;      
  200::356     3e-04  24%  637 aa  SPEA_SHELP RecName: Full=Biosynthetic arginine decarboxylase;      
  255::367     3e-04  33%  644 aa  SPEA_PASMU RecName: Full=Biosynthetic arginine decarboxylase;      
   94::353     4e-04  24%  630 aa  SPEA_BACTN RecName: Full=Biosynthetic arginine decarboxylase;      
  212::299     9e-04  25%  635 aa  SPEA_GEOLS RecName: Full=Biosynthetic arginine decarboxylase;      
    1::397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPEQCALYYAVKANSDAPVLRALLGVADGFE
DCDA_VIBCH      -----------------------------------------------YAVKANSNLGVLNTLARLGSGFD
DCDA_HAEIN      -----------------------------------------------FAVKSCSNIGVLNIMAKLGSGFD
DCDA_PSEAE      -----------------------------------------------FAVKANSNLGVLNVLARLGAGFD
DCDA_NEIMA      -----------------------------------------------YAVKANGNLSIIKHFASLGSGFD
DCDA_AQUAE      -----------------------------------------------YAVKANFNPHLVKLLGELGAGAD
DCDA_NEIMB      -----------------------------------------------YAVKANGNLSIIKHFASLGSGFD
DCDA_METTH      ---------------------------------------------VFYACKANTNLAVMRILEEEGSGID
DCDA_HELPJ      -------------------------------------------------------------------GAD
DCDA_PSEFL      -----------------------------------------------FAVKANSNLGVLNVLARLGAGFD
DCDA_ZYMMO      -----------------------------------------------FAVKANPSQAILASFAKEGLGAD
DCDA_HELPY      -------------------------------------------------------------------GAD
DCDA_CAMJE      ---------------------------------------------IFYAVKANSNLSLLQMLANLDSGFD
DCDA_METJA      -----------------------------------------------YAYKANANLAITRLLAKLGCGAD
DCDA_ARCFU      ---------------------------------------------LLYAVKANNNLALMRIIASHGFGAD
DCDA_DEIRA      ---------------------------------------------IFYAMKANPNLNLLRRYAAAGVGFE
DCDA_ORYSJ      -----------------------------------------------YAVKANNNLRVLQLLRELGCGAV
DCDA2_ARATH     -----------------------------------------------YAIKANNNLKILEHLRSLGCGAV
DCDA1_ARATH     -----------------------------------------------YAIKANNNLKILEHLRSLGCGAV
DCDA_SYNY3      ----------------------------------------PGSSQVIYASKAWSCLAVVAIAAQEGLGFD
DCDA_ACTPA      ------------------------------------------EAEVVFAGKALPCREVYRWVADEGLSLD
DCDA_MYCTU      ---------------------------------------------VHYAAKAFLCSEVARWISEEGLCLD
DCDA_MYCBO      ---------------------------------------------VHYAAKAFLCSEVARWISEEGLCLD
DCLO_SELRU      ------------------------------------------RAGVFYAMKANPTPEILSLLAGLGSHFD
DCDA_MYCLE      ---------------------------------------------VHYAAKAFLCTEIARWIDEEGLSLD
DCDA_BACSU      -----------------------------------------------YASKAFSSVAMIQLAEEEGLSLD
DCOR_PANRE      -----------------------------------------------YAVKCNDDKVLLRTLADLGMGFD
DCOR_DICDI      ----------------------------------------------YYAVKCNPTVGVLRVLDALGTNYD
DCOR_CAEEL      ----------------------------------------------FYAVKCNTDLVLIRILASLGCGFD
DCDA_BACHD      ------------------------------------------QAQVAYASKAFSCIAMFQLAEELGLSLD
DCDA_STRCO      -----------------------------------------------YAQKACSNLHILRLMREEGVHVD
DCDA_COREF      ---------------------------------------------VHYASKAFLSKTVARWVDEEGLSLD
DCDA_BACMT      -----------------------------------------------YASKAFSTVAMIQLAEEEGLSLD
DCDA_ECOLI      -----------------------------------------------FAQKACSNIHILRLMREQGVKVD
DCDA_MYCS2      ---------------------------------------------VHYAAKAFLCSEIARWVDEEGLSLD
DCDA_THEMA      -----------------------------------------------FAVKANNNPVLLKILREEGFGMD
TABA_PSESZ      ----------------------------------------------YFAVKALPTPAILSLLLKEGSGLD
DCOR2_XENLA     ----------------------------------------------FYAVKCNSSKGVVKILAELGAGFD
DCOR_TRYBB      ----------------------------------------------FYAVKCNDDWRVLGTLAALGTGFD
DCOR_MOUSE      ----------------------------------------------FYAVKCNDSRAIVSTLAAIGTGFD
DCOR_RAT        ----------------------------------------------FYAVKCNDSRAIVSTLAAIGTGFD
DCOR_MUSPA      ----------------------------------------------FYAVKCNDSRAIVSTLAATGTGFD
DCOR_HUMAN      ----------------------------------------------FYAVKCNDSKAIVKTLAATGTGFD
DCDA_BUCBP      ----------------------------------------------------------------------
DCOR_NEUCR      ----------------------------------------------FYAVKCHPDERLLQLLAALGTGFD
DCOR_BOVIN      ----------------------------------------------FYAVKCNDSRTIVKTLAAIGTGFD
SPEA_GEOBB      ----------------------------------------PAKYQTFYPIKVNQQRQVVEAIANFGKGLE
SPEA_GEOSM      ----------------------------------------PAKYQTFYPIKVNQQRQVVEAIANFGKGLE
DCOR_LEIDO      ----------------------------------------------YFAVKSNPQPAVLEVLSALGAGFD
DCOR1_XENLA     ----------------------------------------------FYAVKCNDGKAIVKTLSILGAGFD
DCDA_BUCAP      -----------------------------------------------FAQKACSNIHILRLMKQKNIKVD
SPEA_SHEON      ---------------------------------------------LVYPIKVNQQKTVVEEILASQASKE
SPEA_PELPD      ----------------------------------------PAQYQTFYPIKVNQQRQVVEAIANFGKGLE
DCOR_CHICK      ----------------------------------------------FYAVKCNDSEAVVKTLAVLGAGFD
DCDA_CORGL      ---------------------------------------------VHYASKAFLTKTIARWVDEEGLALD
SPEA_SHESW      ---------------------------------------------LVYPIKVNQQQTVVEEILASQASKE
SPEA_SHEPC      ---------------------------------------------LVYPIKVNQQQTVVEEILASQASKE
DCOR_SCHPO      ----------------------------------------------FYAVKCNPDPKVLALLNKFGTGFD
DCOR1_DROME     ----------------------------------------------FYAVKCNDDPMVVRLLAQLGAGFD
SPEA_SHESA      ---------------------------------------------LVYPIKVNQQKTVVEEILASQASKE
DCOR_SOLLC      ----------------------------------------------FYAVKCNPEPSFLSMLSAMGSNFD
DCOR_CRIGR      ----------------------------------------------FYAVKCNDSRALVNTLAAIT--VD
DCOR_CAPAN      ----------------------------------------------FYAVKCNPEPSFLSMLAAMGSNFV
SPEA_SHEB9      ---------------------------------------------LVYPIKVNQQQTVVEEILASQASKE
SPEA_SHEB8      ---------------------------------------------LVYPIKVNQQQTVVEEILASQASKE
SPEA_SHEB5      ---------------------------------------------LVYPIKVNQQQTVVEEILASQASKE
SPEA_SHEB2      ---------------------------------------------LVYPIKVNQQQTVVEEILASQASKE
SPEA_SHESR      ---------------------------------------------LVYPIKVNQQKTVVEEILASQASKE
SPEA_SHESM      ---------------------------------------------LVYPIKVNQQKTVVEEILASQASKE
DCOR_CANAL      ----------------------------------------------YYAVKCNSNPQILTTLSELGVNFD
AZIN1_MOUSE     ----------------------------------------------FYTVKCNSTPAVLEILAALGTGFA
DCOR_DATST      ----------------------------------------------FYAVKCNPEPSFLSMLSAMGSNFD
AZIN1_PONAB     ----------------------------------------------FYTVKCNSAPAVLEILAALGTGFA
AZIN1_HUMAN     ----------------------------------------------FYTVKCNSAPAVLEILAALGTGFA
ADC_MOUSE       ----------------------------------------------FYAVGCNSSLGVLKVLAELGLGFS
SPEA_YERPE      ---------------------------------------------LVYPIKVNQHRRVIESLVNSGEGLE
SPEA_SHEFN      ---------------------------------------------LVYPIKVNQQKTVVEEILASQKSKE
DCDA_BUCAI      ----------------------------------------------------------------------
SPEA_SHEDO      ---------------------------------------------LVYPIKVNQQKTVVEEILASQVSKE
SPEA_GEOMG      ----------------------------------------PSTYQTFYPIKVNQQRQVVEAIAKFGKGIE
SPEA_SHEAM      ---------------------------------------------LVYPIKVNQQQTVVEEILASQVGLE
SPEA_PROMH      ---------------------------------------------LVYPIKVNQQRRVIESLINAGEGLE
SPEA_GEOSL      ----------------------------------------PATYQTFYPIKVNQQRQVVEAIAKFGKGLE
ADC_HUMAN       ----------------------------------------------FYAVKCNSSPGVLKVLAQLGLGFS
AZIN1_RAT       ----------------------------------------------FYMVKCNSTPAVLEILAALGTGFA
SPEA_PHOLL      ---------------------------------------------LVYPIKVNQQRRVIESLASSGEGLE
SPEA_BACV8      ---------------------------------------------IIYPIKVNQMRPVVEEIISHGKGLE
Y4YA_RHISN      --------------------------------------------AIYYGAKANKSPGLMQAALSAGAGLD
SPEA_SHEPA      ---------------------------------------------LVYPIKVNQQQTVVEEILAVAKGLE
DCOR2_DROME     ----------------------------------------------HYAVKCNDDPVVVKFLADLGTGFD
SPEA_XANCP      ----------------------------------------------------------------------
SPEA_NEIMB      ---------------------------------------------LVYPIKVNQHRRVIESLMGQPHGLE
SPEA_MARAV      -------------------------------------------------------------------GLE
SPEA_SHEHH      ---------------------------------------------LVYPIKVNQQQTVVEEILASQVGLE
SPEA_NEIMA      ---------------------------------------------LVYPIKVNQHRRVIESLMGQPHGLE
SPEA_SYNPX      ----------------------------------------------------------------------
SPEA_SHESH      ----------------------------------------------------------------------
SPEA_GEOSF      ----------------------------------------PAKYQTFFPIKVNQQRQVVEAIASYGKGLE
SPEA_VIBPA      ----------------------------------------PNKYLLVYPIKVNQQREVVDEILASQAGLE
SPEA_SHEPW      ---------------------------------------------LVYPIKVNQQQTVVEEILASQVGLE
SPEA_XYLFM      -----------------------------------------------YPIKVNQHAGVLASHQGDGFGLE
SPEA_VIBVU      ----------------------------------------PNKYLLVYPIKVNQQREVVDEILAASQGLE
SPEA_XYLFA      -----------------------------------------------YPIKVNQHAGVLASHQGDGFGLE
SPEA_XANAC      ----------------------------------------------------------------------
SPEA_PROMP      ----------------------------------------------------------------------
SPEA_XYLFT      ----------------------------------------------------------------------
SPEA_XYLF2      ----------------------------------------------------------------------
SPEA_HAMD5      ----------------------------------------------------------------------
SPEA_DEIRA      ----------------------------------------------------------------------
SPEA_BACFR      ---------------------------------------------IIYPIKVNQMRPVVEEIISHGKGLE
SPEA_BACFN      ---------------------------------------------IIYPIKVNQMRPVVEEIISHGKGLE
SPEA_SHELP      ----------------------------------------------------------------------
SPEA_PASMU      ----------------------------------------------------------------------
SPEA_BACTN      ---------------------------------------------IIYPIKVNQMRPVVEEIISHGKGLE
SPEA_GEOLS      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VASFGEIERVRGVDAEVPIAFGGPGKTDAELEGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRA
DCDA_VIBCH      IVSVGELERVLAAGGDPSVVFSGVGKTEAEMKRALQLKIKCFNVESEPELQRLNKVAGELGVKAPISLRI
DCDA_HAEIN      IVSQGELERVLAAGGDASVVFSGVAKSREEIMRALEVRIRCFNVESVSELKHINQIAGEMGKIAPISLRV
DCDA_PSEAE      IVSRGELERVLAAGGDAKVVFSGVGKTRDDMRRALEVGVHCFNVESGEELERLQRVAAELGVKAPVSLRV
DCDA_NEIMA      IVSGGELARVAGGDAAKTI-FSGVGKSEAEIEFALNAGVKCFNMESIPEIDRIQKVAARLGKTASVSLRV
DCDA_AQUAE      IVSGGELYLAKGIPPE-RIVYAGVGKTEKELTDAVDSEILMFNVESRQELDVLNEIAGKLGKKARIAIRV
DCDA_NEIMB      IVSGGELARVAGGDAAKTI-FSGVGKSEAEIEFALNAGVKCFNMESIPEIDRIQKVAARLGKTAPVSLRI
DCDA_METTH      AVSPGEIYTMAGFDPD-RILYTGNNVRDDELQFALDSGVR-INVDSRSQLLRLSEIAPEGLR---ISFRV
DCDA_HELPJ      CVSIGEIQRALKAGIKYKIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETIAQSLGIKARISIRI
DCDA_PSEFL      IVSGGELERVLAAGGSAKIVFSGVGKTREDMRRALEVGVHCFNIESTDELSRLQIVAAELGVRAPISLRV
DCDA_ZYMMO      VVSAGEIRRA--VHAGIPIVFSGVGKTAEEMRYALEIGIGQFNIESVSEIEMLAEVATSLGKKAAVALRI
DCDA_HELPY      CVSIGEIYRALKAGIKYRIVFSGVGKSGFEIEQALKLNILFLNVESFMELTTIETIAQSLGIKARISIRI
DCDA_CAMJE      CVSIGEVKRALKAGAKAKIIFSGVGKTKEELRQALEYDILYINXXXXXXXXXXXXVAKELNLKARISIRV
DCDA_METJA      VVSGGEIAKLSNVPSK-KIVFNGNCKTKEEIIMGIEANIRAFNVDSISELILINETAKELGETANVAFRI
DCDA_ARCFU      VFSDGELASLAGFRKDM-VLFNGNSKSRKEIEMGVTAGVKF-SVDSLDELRTISKIAKEVGKEVEIAFRV
DCDA_DEIRA      VSXXXXXXXXXXXXXXXXMILNGPAKSDAEYAAAARLGATIV-VDREEEVVLLPPGSR-------VLVRV
DCDA_ORYSJ      LVSGNELRALRAGFDPTRCIFNGNGKTLEDLVLAAESGV-FVNIDSEFDLENIVTAARVAGKKVPVLLRI
DCDA2_ARATH     LVSGNELRLLAGFDPTKCI-FNGNGKSLEDLVLAAQEGV-FVNVDSEFDLNNIVEASRISGKQVNVLLRI
DCDA1_ARATH     LVSGNELRALRAGFDPTKCIFNGNGKSLEDLVLAAQEGV-FVNVDSEFDLNNIVEASRISGKQVNVLLRI
DCDA_SYNY3      VVSGGELKQLGWDEAEIAIYFHGNNKSVQELQEAIAINCTII-VDNWLELETLTKLAADSGAPVKIMLRL
DCDA_ACTPA      VCSAGELAIARSVGFPAEVLLHGNVKTPEDLKAALGYGVGRVVVDSFDEIEQLGALAEGP---QDVLVRV
DCDA_MYCTU      VCTGGEL--AVALHASFPITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRL
DCDA_MYCBO      VCTGGEL--AVALHASFPITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRL
DCLO_SELRU      VASAGEMEILHGVDGSQMI-YANPVKDARGLKAAADYNVRRFTFDDPSEIDKMDVLVRIAVRNNKALVDL
DCDA_MYCLE      VCSGGEL--AVALHASFPISLHGNNKSVAELKDAVKAGVGYIVLDSTTEIERLDAIAGEAGIVQDVLVRL
DCDA_BACSU      VVSGGELYTAAGFPAE-RIHFHGNNKSREELRMALEHRIGCIVVDNFYEIALLEDLCKETGHSIDVLLRI
DCOR_PANRE      CASKAEIEKVIGLVGPEKIVYANPCKTRGFIAHAEAAGVKRMTFDSVEELTKI------KQNHADPSLIL
DCOR_DICDI      CASRTEIESVLGVDPS-RIIYANPCKQISALKFARAHNVKLMTFDNLSELEKIEKFFPE----AELVLRI
DCOR_CAEEL      CASKDEIDIVTGVSAE-RIIYANPCKTRSFIAHAMDRDVKMMTFDNPEELLKIAKLHPN----AEMILRI
DCDA_BACHD      VVSGGELYTAQGVSME-RIHFHGNNKSRAEIEMAVEAGIGCFVVDNFYELDLLADICEQKRATANILLRI
DCDA_STRCO      AVSEGEIERALAAGYRVPIVFTADLLNRSTLRRVVELGIP-VNAGSPQMLDQVGRAAPGH----PVWIRI
DCDA_COREF      IASENELGIALAADFPGEITAHGNNKDASFLRACVRNNLGHVVLDSAQELELLDYIAAGEGKVQPVLIRV
DCDA_BACMT      VVSGGELYTALVAGFPVKIHFHGNNKSRAELEMALEHQIGCIVVDNFHELDLIDSICSEKNVKTNILLRV
DCDA_ECOLI      SVSLGEIERAAGYNPQTDIVFTADVIDQATLESELQIPVNAGSVDMLDQLGQVSPGHR-------VWLRV
DCDA_MYCS2      VATGGEL--AVALHAGFPITVHGNNKSVAELTAAVQAGVGHVVLDSEIEIERLDQIAGAAGVVQDVLVRV
DCDA_THEMA      VVTKGELAKLAGVPSHT-VVWNGNGKSRDQMEHFLREDVRIVNVDS---FEEMEIWRELNPEGVEYFIRV
TABA_PSESZ      CSSPVELERLRGDD----IVFTSNNTSLSEYQMALQAGA-LVTFDDRSMLEQVIALPDI------VAFRV
DCOR2_XENLA     CASKTEIELVQDVGAPERIIYANPCKQISQIKYAAKNGVQMMTFDNEVELSKVS----RSHPNARMVLRI
DCOR_TRYBB      CASNTEIQRVRGIGVPEKIIYANPCKQISHIRYARDSGVDVMTFDC---VDELEKVAKTHPK-AKMVLRI
DCOR_MOUSE      CASKTEIQLVQGLGVPAEVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMK---VARAHPK-AKLVLRI
DCOR_RAT        CASKTEIQLVQGLG--VPIIYANPCKQVSQIKYAASNGVQMMTFDSEIELMK---VARAHPK-AKLVLRI
DCOR_MUSPA      CASKTEIQLVQGLG--VPIIYANPCKQVSQIKYAASSGVQMMTFDSEIELMK---VARAHPK-AKLVLRI
DCOR_HUMAN      CASKTEIQLVQGVPPE-RIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMK---VARAHPK-AKLVLRI
DCDA_BUCBP      ----------------------------------------------------------------NIWLRI
DCOR_NEUCR      CASKAEIEQVMGVDPS-RIIYAQPCKTNSYLRYVAQQGVRQMTFDNADELRKI----ARLYPDAELFLRI
DCOR_BOVIN      CASKTEIQLVQGVPPE-RIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMK---VARAHPK-AKLVLRI
SPEA_GEOBB      VGSKPELVAAISMSTNLPILCNGYKDTEETVLFATRVGYDIIVVEKLFELEKIVEVSKRTGIVPKLGIRV
SPEA_GEOSM      VGSKPELVAAISMSTNLPILCNGYKDTEETVLFATRVGYDIIVVEKLFELEKIVEVSKRTGIVPKLGIRV
DCOR_LEIDO      CASKEEIHMVLGVASPDDIIFANPCKQLGDLREAQACGVTYVTVDNPLEMEKISRL--MPSAHAIIRIKT
DCOR1_XENLA     CASKTEIQLVQGVSPE-RIIYANPCKQVSQIKYAASCGVEKMTFDSEVELMK---VARNHPN-AKLVLRI
DCDA_BUCAP      AVSLGEIERVAGFKPNSEIIFTADLFDEETLSKVIKIPVNAGSIDMLEQLGKLSPGHH-------VWLRI
SPEA_SHEON      VPQLGELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHLEKLSELKMVLAESKRLGVKPRLGLRA
SPEA_PELPD      VGSKPELVAAISISTNLPIICNGYKDTEETVLYATKIGYNIIVIEKLFELEKVIELSRKTGITPKLGIRV
DCOR_CHICK      CASKTEIQLVQGVPPE-RIIYANPCKQLSQIKHAANSGVRMMTFDSEVELMK---IARPHPK-AKLLLRI
DCDA_CORGL      IASINEIALAAGFPASRITAHGN-NKGVEFLRALVQNGVGHVVLDSAQELELLDYVAAGEGKIQDVLIRV
SPEA_SHESW      VPQLGELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHLEKLSELKMVLAESKRLGVTPRLGLRA
SPEA_SHEPC      VPQLGELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHLEKLSELKMVLAESKRLGVTPRLGLRA
DCOR_SCHPO      CASKGELEQILGLGVSPDIVYANPCKAITYVRYAASKGINLMTFDNADELYKV----KQHHPNSRLLLRI
DCOR1_DROME     CASKNEVKLVLGFDVSPEIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKSEA
SPEA_SHESA      VPQLGELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHLEKLSELKMVLAESKRLGVKPRLGLRA
DCOR_SOLLC      CASRAEIEYVHGISPD-RIVFANPCKPESDIIFAEKIGVNLTTYDSEDEVYKI----RKHHPKCELLLRI
DCOR_CRIGR      CASKTEIQLVQGLGVPPEVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMK---VARAHPKVTKLVLRI
DCOR_CAPAN      CASRAEIEYVLGISPE-RIVFANPCKPESDIIFAEKVGVNLTTYDSEDEVYK---IKKHHPKC-ELLLRI
SPEA_SHEB9      VPQLGELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHLEKLSELKMVLAESKRLGVTPRLGLRA
SPEA_SHEB8      VPQLGELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHLEKLSELKMVLAESKRLGVTPRLGLRA
SPEA_SHEB5      VPQLGELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHLEKLSELKMVLAESKRLGVTPRLGLRA
SPEA_SHEB2      VPQLGELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHLEKLSELKMVLAESKRLGVTPRLGLRA
SPEA_SHESR      VPQLGELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHLEKLSELKMVLAESKRLGVKPRLGLRA
SPEA_SHESM      VPQLGELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHLEKLSELKMVLAESKRLGVKPRLGLRA
DCOR_CANAL      CASKNEIDLVLSLQAHERIIYANPCKTNSFIRHAADENVNLTTVDNVHELYKL---AKFHPHC-KILIRL
AZIN1_MOUSE     CSSKNEMALVQGVSPE-NIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKI----ARNHPNAKVLLHI
DCOR_DATST      CASRAEIEYVLSLGISPDIVFANPCKPESDIIFAAKVGVNLTTFDSEDEVYKI----RKHHPKCELLLRI
AZIN1_PONAB     CSSKNEMALVQGVPPE-NIIYISPCKQVSQIKYAAKVGVNIMTCDNEIELKKI----ARNHPNAKVLLHI
AZIN1_HUMAN     CSSKNEMALVQGVPPE-NIIYISPCKQVSQIKYAAKVGVNILTCDNEIELKKI----ARNHPNAKVLLHI
ADC_MOUSE       CANKAEMELVQGVPAS-KIICANPCKQVAQIKYAAKHGVRLLSFDNEVELAKV--VKSHPSAKMVLCIAT
SPEA_YERPE      AGSKAEMMAVLAHAGMTRSVIVCNGYKDREYIRLALIGEKLGHIEKMSEIKMVLEEAERLNVVPRLGVRA
SPEA_SHEFN      VPQLGELMAVLAMAQKASSVIVCNGYKDKEYIRLALIGEKLGHLEKMSELKMVLIEAEKLGITPRLGLRV
DCDA_BUCAI      -----------------------------------------------------------------VWLRI
SPEA_SHEDO      VPQLGELMAVLAMAQKASSVIVCNGYKDKEYVRLALIGEKLGHLEKMSELKMVLEEARELGVTPRLGLRT
SPEA_GEOMG      VGSKPEL--VIGISFAIPIICNGY-KDKEYIETVLKIGYDIIVVEKMFELEKIIALSKKTGIKPKLGIRV
SPEA_SHEAM      AGSKPELMAVLAMAQKASSVIVCNGYKDKEYIRLALIGEKLGHLEKMSELQMVLEESKKLGVTPRLGLRA
SPEA_PROMH      AGSKAELMAVLAHANMTSSVIVCNGYKDREYIRLALTGEKLGHIEKMSEIKMVLEEAERLEVIPRLGVRA
SPEA_GEOSL      VGSKPEL--VIGISFAIPIICNGYKDTEETVLYATKIGYDIIVVEKMFELEKIIALSKKTGIKPKLGIRV
ADC_HUMAN       CANKAEMELVQGIPAS-KIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKV--VKSHPSAKMVLCIAT
AZIN1_RAT       CSTKNEMALVQGVSPE-NIIYTSPCKQASQIKYAAKVGVNIMTCDNEVELKKI----ARNHPNAKVLLHI
SPEA_PHOLL      AGSKAELMAVLAHAGMTRTVIVCNGYKDREYIRLALIGEKLGHIEKMSEIAQVLEEAERLNVIPRLGVRA
SPEA_BACV8      AGSKPELHAVIAVDSDSLIICNGY-KDESYIELALKMGKRILVVEKMNELRLIAKMAKQLNVRPNIGIRI
Y4YA_RHISN      VSSLYEXXXXXXXXXXXXXXVAGPAKTSAFHQELINCN-ALISVDSPEELEDLIHGLPADAGQQSILLRL
SPEA_SHEPA      AGSKPELMAVLAMAQKASSVIICNGYKDKEYIRLALIGEKLGHLEKMSELKVVLEQAKELGVTPRLGLRV
DCOR2_DROME     CASKNELKLVLGLGVSPEIIFAHPCRPASHLRYAKEQQVVNGTVDNEYEIYKL----RKHYPDSNLIVRF
SPEA_XANCP      ----------------------------------------------------------------------
SPEA_NEIMB      AGSKAELMAVLAHAGNRQTLIVCNGYKDREYIRFALMGEKLGHIEKLSEIQMVLEEAEKLGIKPRLGVRA
SPEA_MARAV      AGSKPELMAVLALAKQAGSVIVCNGYKDREYIRLALIGQKLGHVEKQSELPLILEEAKKLGISPLIGVRA
SPEA_SHEHH      AGSKPELMAVLAMAQKASSVIICNGYKDKEYIRLALIGEKLGHLEKISELKVVLEQAKELGVTPRLGLRV
SPEA_NEIMA      AGSKAELMAVLAHAGTRQTLIVCNGYKDREYIRFALMGEKLGHIEKLSEIQMVLEEAEKLGIKPRLGVRA
SPEA_SYNPX      ---------------------------------ARRLGQPVVVIEQPDEVDRIIEASKSLGAAPYIGVRA
SPEA_SHESH      --------------------------------------------------------------------RV
SPEA_GEOSF      VGSKPEL--VAGISISLPIICNGY-KDSEYIETVLAIGYDILVIEKLFELEKVIELVKKTGIQPRLGIRV
SPEA_VIBPA      AGSKPELLAVLALAQQGSSVIVCNGYKDREYVRLALIGEKLGHKVFIVKLSELDLVAKSLGVKPRLGLRI
SPEA_SHEPW      AGSKPELLAVLAMAQKASSVIICNGYKDKEYIRLALIGEKLGHLEKMSELKVVLEQAKELGVTPRLGLRV
SPEA_XYLFM      AGSKPELMAVLALSRQGGLIVCNGYKDREYIRLALKLGLKFIVIEKPSELRMVLEEAKTLGVLPGLGVRV
SPEA_VIBVU      AGSKPELLAVLAMAQHASSVIVCNGYKDREYIRLALIGEKLGHKVFIVKMSELDLVLREAGVTPRLGIRI
SPEA_XYLFA      AGSKPELMAVLALSRPGGLIVCNGYKDREYIRLALKLGLKFIVIEKPSELRMVLEEAKTLGVLPGLGVRV
SPEA_XANAC      ----------------------------------------------------------------------
SPEA_PROMP      ----------------------------------------------------------------------
SPEA_XYLFT      ----------------------------------------------------------------------
SPEA_XYLF2      ----------------------------------------------------------------------
SPEA_HAMD5      -------------------------------------------IEKMSEIKMVLEEAKRLNVVPRLGVRA
SPEA_DEIRA      ----------------------------------------VITIEKFTELDRILKQAKALGVKPAVGVRF
SPEA_BACFR      AGSKPELHAVIAVDSDSLIICNGY-KDESYIELALKMGKRILVVEKMNELKLIARMAKQLNVQPNIGIRI
SPEA_BACFN      AGSKPELHAVIAVDSDSLIICNGY-KDESYIELALKMGKRILVVEKMNELKLIARMAKQLNVQPNIGIRI
SPEA_SHELP      -------------------------------------------------------------------LRV
SPEA_PASMU      ----------------------------------------------------------------------
SPEA_BACTN      AGSKPELHAVIAVDSDSLIVCNGY-KDESYIELALKMGKRILVVEKMNELKLIAKMAKQLNVQPNIGIRI
SPEA_GEOLS      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NPAYGLPGATLQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA
DCDA_VIBCH      NPVDAKTHPYISTGLRDNKFGITFDRAAQVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALI
DCDA_HAEIN      NPAHTHP--YISTGLKENKFGVSVNEAREVYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLM
DCDA_PSEAE      NPAQTHPYISTGLKENKFGIAIDEA--EAVYARAAELDHLEVIGVDCHIGSQLTQLEPFLDALERLLGLV
DCDA_NEIMA      NPVDAKTHPYISTGLKANKFGIAYADALEAYRHAAQQPNLKIIGIDCHIGSQLTDLSPLVEACERILILV
DCDA_AQUAE      NPDVDKTHPYIATGMQKSKFGVDIREAQKEYEYASKLENLEIVGIHCHIGSQILDISPYREAVEKVVSLY
DCDA_NEIMB      NPVDAKTHPYISTGLKANKFGIAYADALEAYHYAAQQPNLKIIGIDCHIGSQLTDLSPLVEACERILILV
DCDA_METTH      NPLVGAGHHEHCITGGESKFGVMEREAPEVYRMAMDL-GFEPVGIHAHIGSGILDPEPFMLAVETLMDIA
DCDA_HELPJ      NP--NIDAKTISTGLKENKFGVEEKEALEMFLWAKKSAFLEPVSVHFHIGSQLLDLDPITEASQKVAKIA
DCDA_PSEFL      NPDVDATHPYISTGLKENKFGIAIADAEDVYVRAAQLPNLEVLGVDCHIGSQLTTLEPFIXXXXXXXXXX
DCDA_ZYMMO      NPDVDHTHAKIATGKADTKFGIAAEDALSAYEKLASYPSLKIQGIASHIGSQITDLAPFEAAAERIYEII
DCDA_HELPY      NP--NIDAKTISTGLKENKFGVGEKEALEMFLWAKKSAFLEPVSVHFHIGSQLSDLEPIIEASQKVAKIA
DCDA_CAMJE      NPVDAKTHPYISTGLNENKFGVEIDIARKMYLYAKNSSFLEPVGVHFHIGSQLLDIS---PIHEAAAIVA
DCDA_METJA      NPNVNKTHPKISTGLKKNKFGLDSGIAMKAIKMALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFV
DCDA_ARCFU      NPDVD-PKTHPKIATGLSKFGIPHEMVREAYEMALKLDGVVPVGIHCHIGSQILDLSPFVHALNKVMDIA
DCDA_DEIRA      NPAMTVSTHELATGTARSKFGLTPEQVPGTLAELRDAGH-EVLGLHMHIGSAIEQAEDFTAAFARVTELR
DCDA_ORYSJ      NPDVDPQHPYVATGNKTSKFGIRNEKLQWFLDSIKSYSNITLVGVHCHLGSTITKVDIFRDAAGLMVNYV
DCDA2_ARATH     NPDVDPQHPYVATGNKNSKFGIRNEKLQWFLDEVKAHPKLKLVGAHCHLGSTITKVDIFRDAAVLMIEYI
DCDA1_ARATH     NPDVDPQHPYVATGNKNSKFGIRNEKLQWFLDQVKAHPKLKLVGAHCHLGSTITKVDIFRDAAVLMIEYI
DCDA_SYNY3      TP--GIECHTIKTGHLDSKFGFDPNQLEAVFTYIAQQPSLHCLGLHAHIGSQIFERQPHKDLGEVLVQFT
DCDA_ACTPA      TP--GVDPRTVATGVEDQKFGFSLAGGDALEAVLRVVPSLRLVGLHCHVGSQXXXXXXXXXXXXXXXGLI
DCDA_MYCTU      --TVGVEAHTHEFISTAQKFGLSVASGAAMAAVRRVFDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGL-
DCDA_MYCBO      --TVGVEAHTHEFISTAQKFGLSVASGAAMAAVRRVFDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGL-
DCLO_SELRU      NTKFGAP--------------VEEAL--DLLKAAQD-AGLHAMGICFHVGSQSLST----AAYEEALLVA
DCDA_MYCLE      --TVGVEAHTHEFIATAQKFGLSVASGAAMAAVRRVFDNLRLVGLHSHIGSQIFDVAGFELAAHRVIGL-
DCDA_BACSU      TP--GVEAHTITTGQEDSKFGFDNGQTERAIEQVLQSEHIQLLGVHCHIGSQIFDTAGFVLAAEKIFKKL
DCOR_PANRE      RISVSDPTAQCQLG---IKFGCDETVAPKLLRKAADM-GMNVIGISFHVGSGCNEPATFRTALE----YA
DCOR_DICDI      APDDSK--SVMRFG---SKFGVHIDDCNDLLEMAKEM-NLKVVGVSFHVGSGCQSGDSYLIMVKSVFDMA
DCOR_CAEEL      --AVSDPTATCPLN---LKFGADPIIAAPQLLKTASEEGINVVGISFHVGSGCNDASAYRNAL-QHAKNL
DCDA_BACHD      TP--GVEAHTISTGQEDSKFGFDLVSGQATLAVKKALASIHLLGVHSHIGSQIFETTGFVMAVEKIFEHL
DCDA_STRCO      NPGFGHGHSRTNTGGEHSKHGIWHEHLEESLALV-DRHGLDLVGLHMHIGSG-VDYG-HLESVCE--TMV
DCDA_COREF      KP--GIEAHTHEFIATSHEFSLXXXXXXXXXXXXXXXENLELVGLHCHVGSQVFDAQGFSLAAERVLELY
DCDA_BACMT      TP--GIEAHTILTGQEDSKFGFDNGQAEKALQIALNSNFVEVLGVHCHIGSQIFDTTGFVLAARKIFEKL
DCDA_ECOLI      NPGFGHGHSQTNTGGENSKHGIWYTDLPAALDVIQRH-HLQLVGIHMHIGSGVDYA--HLEQVCG--AMV
DCDA_MYCS2      --TVGVEAHTHEFISTAQKFGLSLATGAAMNAIRRVFDNLRLVGLHSHIGSQIFDVAGFEIAAHRVIGLL
DCDA_THEMA      NPEVDAKTHPISTGLKKHKFGIPLEDLDSFMERFRSM-NIR--GLHVHIGSQITRVEPFVEAFSKVVRAS
TABA_PSESZ      SP-HGVIARSSQMGNAQSKFGIPEAELVQSYREAWDR-GARRFGIHGMMCANELSLEAAVQAGVQVIEVG
DCOR2_XENLA     ATDDSKSSARL-----SVKFGAPLKSCRRLLEMAKNL-SVDVIGVSFHVGSGCTDSKAYTQAIS-DARLV
DCOR_TRYBB      STDDSLARCRL-----SVKFGAKVEDCRFILEQAKKL-NIDVTGVSFHVGSGSTDASTFAQAISDSRFVF
DCOR_MOUSE      ATDDSKAVCRLSVKFGAT------LKTSRLLLERAKELNIDVIGVSFHVGSGCTDPDTFVQAVSDARCVF
DCOR_RAT        ATDDSKAVCRLSVKFGAT------LKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVF
DCOR_MUSPA      ATDDSKAVCRLSVKFGAT------LKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVF
DCOR_HUMAN      ATDDSKAVCRLSVKFGAT------LRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVF
DCDA_BUCBP      NPKFGHGHSKTNTGGENSKHGIWDINLAFPYI---TKYNFKLIGLHMHIGSG-VDY-CHLAMIDQVLQCK
DCOR_NEUCR      -----LTDDSSSLCRFSMKFGASLDSTDGLLGLARQL-GLNVVGVSFHVGSGASDPTAFLAVQDAHVVFQ
DCOR_BOVIN      ATDDSKAVCRLSVKFGAT------LKTSRLLLERAKELDIDVIGVSFHVGSGCTDPETFVQAISDARCVF
SPEA_GEOBB      KLSSKGIGKWSTSGGDDAKFGISELIAADMLKQNDMLDSVKL--LHFHVGSQITKIDKIKNALIEGTRIY
SPEA_GEOSM      KLSSKGIGKWSTSGGDDAKFGISELIAAEMLKQNDMLDSVKL--LHFHVGSQITKIDKIKNALIEGTRIY
DCOR_LEIDO      NDSKA-------QCSFSTKFG---APLEDVLLEAARQFNVTVCGVSFHVGSGNDDQSAYVSAVDAYQVFQ
DCOR1_XENLA     ATDDSKAVCRLSVKFGAT------LKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVF
DCDA_BUCAP      NPGFGHGHSKTNTGGENSKHGIWN---PRXXXXXXXXXXXXXXXXHMHIGSGV--NYKHLKKVGQ--AMI
SPEA_SHEON      RLAFQGKGKWQASGGEKSKFGLSAATVVDQLKQSDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAARFY
SPEA_PELPD      KLSSKGTGKWATSGGEDAKFGISEIITADLLKQYNLIDSVKL--LHSHIGSQVTKIDKIKNALIEGARIY
DCOR_CHICK      TTDDSKAVCRLSVKFGAT------LKTSRLLLERAKELDLAIVGVSFHVGSGCTDPETFVQAISDARCVF
DCDA_CORGL      KP--GIEAHTHEFIATSHEFSXXXXXXXXXXXXXXXXXXXXXXXXHCHVGSQVFDAEGFKLAAERVLGLY
SPEA_SHESW      RLAFQGKGKWQASGGEKSKFGLSAATVVDQLKQNDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAGRFY
SPEA_SHEPC      RLAFQGKGKWQASGGEKSKFGLSAATVVDQLKQNDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAGRFY
DCOR_SCHPO      STDDSNSLCRLSLKFGASL--DDTGKLLDIAKSL----ELNXXXXXXXXXXXXYDPSAFLDAIQRSRQVF
DCOR1_DROME     KEAQCPLG---------DKFGCXXXXXXXXXXXXXKSLELKVTGTSFHVGSGC----SELQAYDRAIKKA
SPEA_SHESA      RLAFQGKGKWQASGGEKSKFGLSAATVVDQLKQEDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAARFY
DCOR_SOLLC      KP--------MTDGNARCPMGPKYGALPEPLLRTAQAARLTVSGVSFHIGSGDADSNAYLGAIAAAKQVF
DCOR_CRIGR      ATDDSKAVCRLSVKFGAT------LRTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVALSD-----A
DCOR_CAPAN      KP--------MNDGNARCPMGPKYGALPEPLLRIAQASRLTVSGVSFHIGSGDADSNAYLGAIAAAKQVF
SPEA_SHEB9      RLAFQGKGKWQASGGEKSKFGLSAALVVEQLKQNDMLDSLQL--LHFHLGSNIRDIRQGVSEAGRFYCEL
SPEA_SHEB8      RLAFQGKGKWQASGGEKSKFGLSAALVVEQLKQNDMLDSLQL--LHFHLGSNIRDIRQGVSEAGRFYCEL
SPEA_SHEB5      RLAFQGKGKWQASGGEKSKFGLSAALVVEQLKQNDMLDSLQL--LHFHLGSNIRDIRQGVSEAGRFYCEL
SPEA_SHEB2      RLAFQGKGKWQASGGEKSKFGLSAALVVEQLKQNDMLDSLQL--LHFHLGSNIRDIRQGVSEAGRFYCEL
SPEA_SHESR      RLAFQGKGKWQASGGEKSKFGLSAATVVDQLKENDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAARFY
SPEA_SHESM      RLAFQGKGKWQASGGEKSKFGLSAATVVDQLKENDMLDSLQL--LHFHLGSQIANIRDIRQGVSEAARFY
DCOR_CANAL      ITDDSTAQCQL-----STKFGCDNTAIGEILPKAKEL-GLQVHGVAFHVGSGAKDSSIYQAIKDSRILFD
AZIN1_MOUSE     ATEDNIGGE-----DGNMKFGTTLKNCRHLLECAKEL-DVQIIGVKFHVSSACKEYQVYVALSDARCVF-
DCOR_DATST      KP--------MDDGNARCPMGPKYGALPEPLLRTAQAARLTVSGVSFHIGSGDADSKAYLGAIAAAKGVF
AZIN1_PONAB     ATEDNIGGEE-----GNMKFGTTLKNCRHLLECAKEL-DVQIIGVKFHVSSACKESQVYVHALSDARCVF
AZIN1_HUMAN     ATEDNIGGEE-----GNMKFGTTLKNCRHLLECAKEL-DVQIIGVKFHVSSACKESQVYVHALSDARCVF
ADC_MOUSE       QDSHSLNHLSLRFGASLKSC--------RHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSI-ADARLV
SPEA_YERPE      RLASQGSGKWQASGGEKSKFGLSATQLVDMLREANSLESLQL--LHFHLGSNIRDISTGVRESARFYVEL
SPEA_SHEFN      RLAFQGKGKWQASGGEKSKFGLSAAQVLKVIAELKSANMLDSLQLHFHLGSQIANIRDIRQGVSEAGRFY
DCDA_BUCAI      NPRFGYGHSKTNTGGENSKHGIWH---PEQAXXXXXXXXXXXXXXHMHIGSGV----NYLHLKKVSQAMI
SPEA_SHEDO      RLAFQGKGKWQASGGEKSKFGLSAAQVVDELKEANMLESLQL--LHFHLGSQIANIRDIRQGVSEAGRFY
SPEA_GEOMG      KLSSKGTGKWATSGGEDAKFGLRMSEIIGLLEQNELLDSVKLI--HFHIGSQITKIDKIKSALIEGTRVY
SPEA_SHEAM      RLAFQGKGKWQASGGEKSKFGLSAAQILKVVERLKDEDMLESLQLHFHLGSQIANIRDIRHGVGEAARFY
SPEA_PROMH      RLASQGSGKWQASGGEKSKFGLAATQLIDTLRQAGRLDSLQL--LHFHLGSQMANIRDIATGVRESARFY
SPEA_GEOSL      KLSSKGTGKWATSGGEDAKFGLRMSEIIGLLEQNDLLDRVKL--LHFHIGSQITKIDKIKSALIEGTRIY
ADC_HUMAN       DDSHSLSCLSL-------KFGVSLKSCRHLLENAK-KHHVEVVGVSFHIGSGCPDPQAYAQSI-ADARLV
AZIN1_RAT       ATEDNIGGE-----DGNMKFGTTLKNCRHLLECAKEL-DVQIIGVKFHISSACKEYQVYVALSDARCVF-
SPEA_PHOLL      RLASQGSGKWQASGGEKSKFGLAATQVLQLVETLRAVDRLDSLQLHFHLGSNIRDIATGVRESARFYVEL
SPEA_BACV8      KLASSGSGKWEDSGGDASKFGLTSSELLEALLEKKDMKDCLKL-IHFHIGSQV----TKIRRIKTALREA
Y4YA_RHISN      RP----------RDQSKSRFGMPPDAVVHCLARLAGEGRVRFDGLHFHL--SGYRRETRVAALREAIAEA
SPEA_SHEPA      RLAFQGKGKWQASGGEKSKFGLSAAQVLQVLKQENMLESLEL--LHFHLGSNIRDIRQGVSEAGRFYCEL
DCOR2_DROME     KSE--AKKALCPLG---DKYGCDXXXXXXXXXXXXXXXXXKVTGTSFHVGSGCSEVEAY----DRAIEKA
SPEA_XANCP      -------------GGDKAKFGLSPRQVLDLWKSLRDTEYADSLNLHFHMGSNVRDIANGMREATRYFVEL
SPEA_NEIMB      RLAXXXXXXXXXXXXXXXXFGLSASQLVDILKQKNRLDCLQL--LHFHLGSNIRDVATGVHESARFYVEL
SPEA_MARAV      RLATIGKGNWQNTGGEKSKFGLSASQVLDVLKQAGALGTLQL--LHFHLGSNIRDIQTGLR------ECA
SPEA_SHEHH      RLAFQGKGKWQASGGEKSKFGLSAAQVLQVLKQENMLDSLEL--LHFHLGSNIRDIRQGVSEAGRFYCEL
SPEA_NEIMA      RLAXXXXXXXXXXXXXXXXFGLSASQLVDILKQKNRLDCLQL--LHFHLGSNIRDVATGVHESARFYVEL
SPEA_SYNPX      KLSSRSTGRWGSSVGDKAKFGLS---IPELLAESNLLPDLRL--LHFHIGSQINDIAVLKDALQEAGQIY
SPEA_SHESH      RLAFQGKGKWQASGGEKSKFGLSASTVIDSLKQSQMLDSLQL--LHFHLGSNIRDIRQGVSEAGRFYCEL
SPEA_GEOSF      KLSSKGTGKWATSGGEDAKFGLRMSEIIDLLEENGLLDRVKLI--HFHIGSQITKIDKIKTALIEGARVY
SPEA_VIBPA      RLASQGAGKWQASGGEKSKFGLSASQVLSVIERLKREGSLDAMQLHFHLGSQMANIRDVRNGVNESARFY
SPEA_SHEPW      RLAFQGKGKWQASGGEKSKFGLSAAQVLKVLQHEEMLDSLEL--LHFHLGSNIRDIRQGVSEAGRFYCEL
SPEA_XYLFM      RLASLGAGKWQNSGGDKAKFGLSPRQVLDVWKVLRGTEYADCLNMHFHMGSNVRDIAKGMREATRYFVEL
SPEA_VIBVU      RLASQGAGKWQASGGEKSKFGLSASQVLNVISRLKKENQLDTLQLHFHLGSQMANIRDVRNGVNESARFY
SPEA_XYLFA      RLASLGAGKWQNSGGDKAKFGLSPRQVLDVWKVLRGTEYADCLNMHFHMGSNVRDIAKGMREATRYFVEL
SPEA_XANAC      -------------GGDKAKFGLSPRQVLDLWKTLRDTEYADSLNLHFHMGSNVRDIANGMREATRYFVEL
SPEA_PROMP      --------------GDNSKFGLS---IPEIMLTIKELKEANLINLHFHVGSQISDISVIKDALQEASQIF
SPEA_XYLFT      -------------GGDKAKFGLSPRQVLDVWKVLRGTEYADCLNMHFHMGSNVRDIAKGMREATRYFVEL
SPEA_XYLF2      -------------GGDKAKFGLSPRQVLDVWKVLRGTEYADCLNMHFHMGSNVRDIAKGMREATRYFVEL
SPEA_HAMD5      RLASEGSGKWQASGGEKSKFGLSATQLVEILKSADCLSGLQL--LHFHLGSQLSNIHDIATGVRESARFY
SPEA_DEIRA      KLHARGSGQWEESGGDQAKFGLN-AYXXXXXXXXXXXXNMSLVMLHTHIGSQITDI-RRVKVAVREAAQT
SPEA_BACFR      KLAXXXXXXXXXXXXDASKFGLTSSELLEALLESKGMKDCLKL-IHFHIGSQV----TKIRRIKTALREA
SPEA_BACFN      KLAXXXXXXXXXXXXDASKFGLTSSELLEALLESKGMKDCLKL-IHFHIGSQV----TKIRRIKTALREA
SPEA_SHELP      RLAFQGKGKWQASGGEKSKFGLSAAQVLNVINSLKDEDMLDSLQLHFHLGSNIRDIRSGVSEAGRFYCEL
SPEA_PASMU      --------------------------------------------LHFHLGSNIRDVATGVRESARFYVEL
SPEA_BACTN      KLAXXXXXXXXXXXXDASKFGLTSSELLEALMESKGLKDCLKL-IHFHIGSQV----TKIRRIKTALREA
SPEA_GEOLS      -------------GGEDAKFGLR---MSEIMAAIKMLQEADLLDLHSHIGSQVTKIDKIKTALIEAARIY


                         .         .         .         +         .         .         .:280
query           KRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVA
DCDA_VIBCH      DSLK-AEGIHIRHLDVGGGLGVVYRDPPQPSEYAK----AXXXXXXXXXXXXXIFEPGRAIAANAGVLVT
DCDA_HAEIN      EQLKE-DGITLKHLDLGGGLGVTYETPPHPSD---YANALLEKLK-NYPELEIILEPGRAISANAGILVA
DCDA_PSEAE      DRLAG-KGIGIRHLDLGGGLGVRYRDEQPPLAGD---YIRAIRERLHGRDLTLVFEPGRSIVANAGVLLT
DCDA_NEIMA      DALA-AEGIVLEHLDLGGGVGIVYQD-EDVPDLGAYAQAVQKLI--GTRRLKLILEPGRSLVGNAGALLT
DCDA_AQUAE      ESLTQ-KGFDIKYLDIGGGLGIKYK-PE---DKEPAPQDLADLLKDLLENAKIILEPGRSIMGNAGILIT
DCDA_NEIMB      DALA-AEGIVLEHLDLGGGVGIVYQD-ENVPDLGAYAQAVQKLI--GTRRLKLILEPGRSLVGNAGSLLT
DCDA_METTH      GRVHEATGVEFEFIDFGGGLGIPYTPEEEPLDIDEFASKITGLFKDKLSEPMMCLEPGRYIVGDASYLLT
DCDA_HELPJ      KSLIAL-GIDLRFFDVGGGIGVSYENEETIKLYD-YAQGILNSLQ--GLDLTIICEPGRSIVAESGELIT
DCDA_PSEFL      XXXXXC-GIYLRHIDLGGGVGVRYRDEEPPLVAD---YIKAVRERLDGRDLALMFEPGRYIVANAGVLLT
DCDA_ZYMMO      TAL-EKAGHAIETADLGGGLGVRYKDDQPE---PPSVEAYGEMIKRVTKNCRLIFEPGRSLIANAGVLLS
DCDA_HELPY      KSLIAL-GIDLRFFDVGGGIGVSYENEETIKLYD-YAQGILNSLQ--GLDLTIICEPGRSIVAESGELIT
DCDA_CAMJE      KLVRELKALDLKFFDIGGGLGVAYEKNECEPDLYDYAQGILAQLH--GLDLTIGMEPGRYLVAKSGEFVC
DCDA_METJA      VELKE-EGIEIEDVNLGGGLGIPYQIPTQKDLADAIINTMLKY-KDKVEMPNLILEPGRSLVATAGYLLG
DCDA_ARCFU      VDIEKL-GVELSFVDMGGGLGIDYEGKGAPTPKDLASAILPEFEGRKADLTQLWLEPGRSIVGNTTVLIT
DCDA_DEIRA      AHIG---GLSV--LNVGGGWSLNAD-----------LEGIAYEAHEAARGAELWVEPGRYLVASAGWLLT
DCDA_ORYSJ      DEIR-AQGFELEYLNIGGGLGIDYHHTDAVLPTPM---DLINTVRELVLSLTLIIEPGRSLIANTCCFVN
DCDA2_ARATH     DEIRR-QGFEVSYLNIGGGLGIDYYHAGAVLPTPM---DLINTVRELVLSLNLIIEPGRSLIANTCCFVN
DCDA1_ARATH     DEIRR-QGFEVSYLNIGGGLGIDYYHAGAVLPTPM---DLINTVRELVLSLNLIIEPGRSLIANTCCFVN
DCDA_SYNY3      KGL--TYGLPLTELNIGGGLGICYDDPPSIEEWAQVASVAKACDRQNIPYPKLIAEPGRSL-VGSACVTA
DCDA_ACTPA      ASC----GVRIEQLDLGGGFAVPYLPGEGEFDLGGFAHRVVALSHECAPVPRLSIEPGRAVVARAGVTLY
DCDA_MYCTU      --LRDVVGAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESPTPKLVVEPGRAIAGPGTITLY
DCDA_MYCBO      --LRDVVGAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESPTPKLVVEPGRAIAGPGTITLY
DCLO_SELRU      RRLFDEMGMHLTDLDIGGGFPVP-DAKGLNVDLAAMMEAINKQIDRLFPDTAVWTEPGRYMCGTAVNLVT
DCDA_MYCLE      --LCDIVGAQLSIVDLGGGLGISYLPDDDPPPIFELAAKLGAIVSNESPVPKLMVEPGRAIAGPGTITLY
DCDA_BACSU      DEWRDSYSFVSKVLNLGGGFGIRYTEDDEPLHATEYVEKIIEAVKENASRPEIWIEPGRSLVGDAGTTLY
DCOR_PANRE      RGLFDLGGLSMTLLDIGGGFGVD----TAHISLDACAAVINPALEESCPDVEVIAEPGRYFACAAVSVTT
DCOR_DICDI      KKLN----MELTLVDVGGGFGSD----------DEKFNAFTKVIREKSPNVKIIAEPGRYFAAQSHTLAV
DCOR_CAEEL      CEIGEGLGFKMDIIDMGGG----FPGAEHHNPFEKIAETIRDALDEFFPDTRLIAEPGRFFAAGPFSLVA
DCDA_BACHD      VTWREDHGFEPSVLNLGGGFGIRYDTPRPVGDYVK--EMIRAVKQQIASMPEIWIEPGRSLVGDAGTTLY
DCDA_STRCO      KQVR-MAGRDIRAISAGGGLSVPYTPGDPEIDTDRYFEARRELVSELGHPVRLEIEPGRFXXXXXXXXXX
DCDA_COREF      SRIHDELGVTLAELDLGGGYGIAYTAAEEPLNVVEVAHDLLTAVGKTAEAPTVLVEPGRAIAGPSTVTVY
DCDA_BACMT      KEWKDRLSYEPKVLNLGGGFGIRYTEEDDPIPASQYVKEIINEVKKQVSAPEIWIEPGRSLVGDAGTTLY
DCDA_ECOLI      RQVIEF-GQDLQAISAGGGLSVPYQQGEEAVDTEHY-YGLEQIARHLGHPVKLEIEPGRFLVAQSGVLIT
DCDA_MYCS2      RDVVAEFGVQMSIVDLGGGLGISYLPHDDPPPMKELADKLLEIVRTESPTPKLVVEPGRAI-AGPGTIVK
DCDA_THEMA      ERYXXXXXXXXXXXXXXXXXXX--------LDLSSYREKVVPDLKRFK---RVIVEIGRYIVAPSGYXXX
TABA_PSESZ      ARVAREAGIELEYINIGGGLGIPYRIDDQALDLTAYADALKRALKQAFPTPKLLMELGRYISGPHGVLVS
DCOR2_XENLA     FEMASEFGYKMWLLDIGGGFPGTEDSKIRFEEIAGVINPALDMYFPESSDVQIIAEPGRYYVASAFSLAV
DCOR_TRYBB      DMGTEL-GFNMHILDIGGGFPGTRDAPLKFEEIAGVINN--ALEKHFPPDLKIVAEPGRYYVASAFTLAV
DCOR_MOUSE      DMATEV-GFSMHLLDIGGGFP---GSEDTKLKFEEITSVINPALDKYFPSVRIIAEPGRYYVASAFTLAV
DCOR_RAT        DMGTEV-GFSMYLLDIGGGFP---GSEDTKLKFEEITSVINPALDKYFPSVRIIAEPGRYYVASAFTLAV
DCOR_MUSPA      DMGTEV-GFSMYLLDIGGGFP---GSEDTKLKFEEITSVINPALDKYFPSVRIIAEPGRYYVASAFTLAV
DCOR_HUMAN      DMGAEV-GFSMYLLDIGGGFP---GSEDVKLKFEEITGVINPALDKYFPSVRIIAEPGRY-------YVA
DCDA_BUCBP      FKIHVI--------SAGGGLTVPYHNVKNYFFWNKARKIISNYLNRPI---RLEIEPGRFLVAESGILVS
DCOR_NEUCR      QAA--AYGYSLKTLDVGGGFCSD-------DSFEQMANVLRAALDEYFPAVNLIAEPGRYYASSAFTLAC
DCOR_BOVIN      DMGAEV-GFNMYLLDIGGGFP---GSEDVKLKFEEITSVINPALDKYFPSVRIIAEPGRYYVASAFTLAV
SPEA_GEOBB      AEMRKL-GVNLEFLDIGGGLGVDY----------------------------------------------
SPEA_GEOSM      AEMRKL-GVNLEFLDIGGGLGVDY----------------------------------------------
DCOR_LEIDO      QAVQ--YGFKCTILDIGGGFGTEVVEGSGNTSFEAIARTIRPVLAELGGDVTIISEPGRYFTA-------
DCOR1_XENLA     DMGAEL-GFNMHLLDIGGGFP---GSEDVKLKFEEITSVINPALDKYFPAVKIIAEPGRYYVASSFTLAV
DCDA_BUCAP      EKAMEINEKIL-FISAGGGLPIPYTFNEKPIDWDEARKKISRFLNTPI---QLEIEPGRFLVAESGILIS
SPEA_SHEON      CELREL-GASINCFDVGGGLAVDYSNNSMNYGLSEYANNIVNVLTDICPMPRIISESGRHLTAHHAVLIT
SPEA_PELPD      VEMKKL-GVNLEYIDIGGGLGVDY----------------------------------------------
DCOR_CHICK      DMGAEL-GFNMYLLDIGGGFP---GSEDVKLKFEEITSVINPALDKYFPEVTIIAEPGRYYVASAFTLAV
DCDA_CORGL      SQIHSELGVALPELDLGGGYGIAYTAAEEPLNVAEVASDLAAELGIDAPT--VLVEPGRAIAGPSTVTIY
SPEA_SHESW      CELREL-GASVNCFDVGGGLAVDYSNNSMNYGLTEYANNIVNVLTDAQPMPRIISESGRYLTAHHAVLIT
SPEA_SHEPC      CELREL-GASVNCFDVGGGLAVDYSNNSMNYGLTEYANNIVNVLTDAQPMPRIISESGRYLTAHHAVLIT
DCOR_SCHPO      DQGLE-RGFNFDLLDIGGGFMND------SFD------GVADLIRSALPSIRVISEPGRFFVSSSFTLAV
DCOR1_DROME     KNLGALLGYDMDFLDIGGGFGSD------DVKFEKIAESVNTSVQRHFPDERIIAEPGRFVAAACTCKIH
SPEA_SHESA      CELREL-GASINCFDVGGGLAVDYSNNSMNYGLSEYANNIVNVLTDICPMPRIISESGRHLTAHHAVLIT
DCOR_SOLLC      ETAAQLGMPKMTVLDIGGGFTSGHQ---------------------------------------------
DCOR_CRIGR      RCVFDMGGFSMYLLDIGGGFP---GSEDTKLKFEEITSVINPALDKYFPGVRVIAEPGRYYVASAFTLAV
DCOR_CAPAN      ETAAKFGMSKMNVLDIGGGFTSGHQ-------FTTAATAVKSALQQNEPELTIIAEPGRXXXXXXXXXXX
SPEA_SHEB9      RAL----GASVNCFDVGGGLAVDYSNNSMNYGLTEYANNIVNVLTDICPMPRIISESGRYLTAHHAVLIT
SPEA_SHEB8      RAL----GASVNCFDVGGGLAVDYSNNSMNYGLTEYANNIVNVLTDICPMPRIISESGRYLTAHHAVLIT
SPEA_SHEB5      RAL----GASVNCFDVGGGLAVDYSNNSMNYGLTEYANNIVNVLTDICPMPRIISESGRYLTAHHAVLIT
SPEA_SHEB2      RAL----GASVNCFDVGGGLAVDYSNNSMNYGLTEYANNIVNVLTDICPMPRIISESGRYLTAHHAVLIT
SPEA_SHESR      CELREL-GASINCFDVGGGLAVDYSNNSMNYGLSEYANNIVNVLTDICPMPRIISESGRHLTAHHAVLIT
SPEA_SHESM      CELREL-GASINCFDVGGGLAVDYSNNSMNYGLSEYANNIVNVLTDICPMPRIISESGRHLTAHHAVLIT
DCOR_CANAL      EMLS--MGFTPKLLDIGGG---------------------------------------------------
AZIN1_MOUSE     -DMAGEFGFTMNMLDIGGGFGTEIQLEEVN-------HVISPLLDIYFPGIQIISEPGSYYVSSAFTLAV
DCOR_DATST      ETAARFGMSKMTVLDIGGGFTSGHQ---------------------------------------------
AZIN1_PONAB     DMAGEI-GFTMNMLDIGGGFGTEFQLEEVN-------HVISPLLDVYFPGVKIISEPGSYYVSSAFTLAV
AZIN1_HUMAN     DMAGEI-GFTMNMLDIGGGFGTEFQLEEVN-------HVISPLLDIYFPGVKIISEPGSYYVSSAFTLAV
ADC_MOUSE       FQMGEELGHTMNILDLGGGFPGLEGAKVRFEEMASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAV
SPEA_YERPE      HKL----GVNIQCFDVGGGLGVDYEGTRSQSDCNNVIWGIGDACNEHGPHPTVITESGRAVTAHHTVLVS
SPEA_SHEFN      CELRQL-GASIDCFDVGGGLAVDYSNNSMNYGLNEYANNIVNVLTDLCPMPRIISESGRHLTAHHAVLIT
DCDA_BUCAI      KYAFQLNQ-KISSISVGGGLPIPYKFNDQPIDWDIARKKISKFLGE---KIELEIEPGRFLVAESGILIS
SPEA_SHEDO      CELRQL-GASINCFDVGGGLAVDYSNNSMNYGLTEYANNIVNVLTDLCPMPRIISESGRHLTAHHAVLIT
SPEA_GEOMG      AEMRKL-GVGIEYVDIGGGLGVDY----------------------------------------------
SPEA_SHEAM      CELRKL-GAKVNCFDVGGGLAVDYDNNSMNYALAEYANNIVSVLTDVCPMPRIISESGRYLTAHHAVLIT
SPEA_PROMH      VELHKL-GVNIQYFDVGGGLGVDYEGTRSQSDLNEYANNVIWAIGDACPHPTVITESGRALTAHHTVLIS
SPEA_GEOSL      AEMRKL-GVGIRYVDIGGGLGVDY----------------------------------------------
ADC_HUMAN       FEMGTELGHKMHVLDLGGGFPGTEGAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAV
AZIN1_RAT       -DMAGEFGFTMNMLDIGGGFGTEIQLEEVN-------HVISPLLDIYFPGIQIISEPGSYYVSSAFTLAV
SPEA_PHOLL      HKL----GVNIQCFDVGGGLGVDYEGTRSQSDCNNVIWGIGDACDEHGPHPTVITESGRALTAHHTVLVS
SPEA_BACV8      SQFYQLHGFNVEFVDIGGGLGVDYDNSESSVNYDSISTLVDASDKNGIPHPNIITESGRSLTAHHSVLIF
Y4YA_RHISN      RRMGFFPGM----IDIGGGLPIQYVDRARY----------------------------------------
SPEA_SHEPA      MKL----GASVKCFDVGGGLAVDYSSHSMNYGLTEYANNIVSVLTDMCPMPRIISESGRYLTAHHAVLLT
DCOR2_DROME     EKVGEMIGHKMELLDVGGGFGID----DEMFEEIAQSVNTSVELRFPDKRIRIISEPGRF----------
SPEA_XANCP      SRL----GAKISHVDVGGGLGIDYENYGLHSYASNIVQPLASACEEHGPPPRIVTECGRAMTAHHAVLIA
SPEA_NEIMB      HKL----GVNIRCFDVGGGLGVDYEGNRTQSDCSTVVWGISACLEHGLPHPTIITESGRGITAHHAVLVA
SPEA_MARAV      RFYTELHGAPIGTVDIGGGLGVDYEGTSMNYSVFEYAYNVVHVLRQGIPHPDLISESGRALTAHHSVLVT
SPEA_SHEHH      MKL----GANVKCFDVGGGLAVDYSSHSMNYGLTEYANNIVSVLTDMCPMPRIISESGRYLTAHHAVLLT
SPEA_NEIMA      HKL----GVNIRCFDVGGGLGVDYEGNRTQSDCSTVVWGISACLEHGLPHPTIITESGRGITAHHAVLVA
SPEA_SYNPX      VELTRL-GAPMGFLDVGGGLGIDYDGASTNYSLQNYANDVVATVRECCEPNAVVSESGRAIASHFSLLVF
SPEA_SHESH      QKL----GANVKCFDVGGGLAVDYDSSSMNYGLTEYANNIVSVLTDLCPMPRIISESGRFLTAHHAVLIT
SPEA_GEOSF      TELRKM-GMGIEFVDIGGGLGVDY----------------------------------------------
SPEA_VIBPA      CELRAL-GANIEYFDVGGGLAVDYDG-TRSQSSNSMNYGLAEYARNIVPMPVIISESGRSLTAHHAVLIS
SPEA_SHEPW      MKL----GAQVKCFDVGGGLAVDYSNNSMNYGLTEYANNIVSVLTDMCPMPRIISESGRYLTAHHAVLLT
SPEA_XYLFM      SRL----GAKITHVDVGGGLGIDYEGTRSRSDCS-INYGLQAIVQPLASAPRIVTECGRAMTAHHAVLIA
SPEA_VIBVU      CELRTL-GANITYFDVGGGLAIDYDG-TRSQSSNSMNYGLVEYARNIVPMPVIISESGRSLTAHHAVLIS
SPEA_XYLFA      SRL----GAKITHVDVGGGLGIDYEGTRSRSDCS-INYGLQAIVQPLASAPRIVTECGRAMTAHHAVLIA
SPEA_XANAC      SRL----GAKISHVDVGGGLGIDYENYGLHSYASNIVQPLASACEETPP--RIVTECGRAMTAHHAVLIA
SPEA_PROMP      VELSKL-GAPMKYIDVGGGLGIDFSNTSTNYSLQNYANDVIATVKDSCEVNNIISESGRAIISHCSVLIF
SPEA_XYLFT      SRL----GAKITHVDVGGGLGIDYEGTRSRSDCS-INYGLQAIVQPLASAPRIVTECGRAMTAHHAVLIA
SPEA_XYLF2      SRL----GAKITHVDVGGGLGIDYEGTRSRSDCS-INYGLQAIVQPLASAPRIVTECGRAMTAHHAVLIA
SPEA_HAMD5      VELHKL-GVKISCFDVGGGLGVDYEGTRSQSDCNNVIWGIGEICNENLPHPTVISESGRALTAHHTVLIS
SPEA_DEIRA      YAGLIAAGADLKYLNVGGGLGVDYDGSKMNYTVKEYAADIVYTVQEVVPEPVIVSESGRALTAHHAVLIL
SPEA_BACFR      SQFYQLHGFNVEFVDIGGGLGVDYDGTRXXXXXXXVNYSIQEYVNDSIPHPNIITESGRALTAHHSVLIF
SPEA_BACFN      SQFYQLHGFNVEFVDIGGGLGVDYDGTRXXXXXXXVNYSIQEYVNDSIPHPNIITESGRALTAHHSVLIF
SPEA_SHELP      QKM----GANVKCFDVGGGLAVDYSSNSMNYGLTEYANNIVSVLNDMCPMPRLISESGRYLTAHHAVLIT
SPEA_PASMU      HKL----GVNIQCFDVGGGLGVDYEGNRTQSDCDTVVWGIGQACREHGPHPTIITESGRGVTAHHAVLVS
SPEA_BACTN      SQFYQLHGFNVEFVDIGGGLGVDYDGTRSNYSIQEYVNDSISTLVDVSPHPNIITESGRALTAHHSVLIF
SPEA_GEOLS      SEMRKL-GVNIQYLDIGGGLGVDYDGSKSSY---------------------------------------


                         .         *         .         .         .         .         +:350
query           EVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELCTPKDVL
DCDA_VIBCH      KVEFLKHTEHKNFAIIDAAMNDLIRPAAWQDIIPLR-----------PRQ-GEAQTYDLVGPVCETSDFL
DCDA_HAEIN      KVQYLKSNESRNFAITDTGMNDMIRPALYEAYMNIVEI-----DRTLER---EKAIYDVVGPVCETSDFL
DCDA_PSEAE      RVEYLKHTEHKDFAIVDAAMNDLIRPALYQAWMDVQAVR--------PRDAAPRR-YDLVGPICETGDFL
DCDA_NEIMA      RVEFVKYGEEKNFVMVDAAMNDLMRPALYDAYH--------HIEAVEPKNIA---PLTIVGPICETGDFL
DCDA_AQUAE      QVQFLKDKGSKHFIIVDAGMNDLIRPSIYNAYH-----------HIIPVETKERKKVVIVGPICETGDFL
DCDA_NEIMB      RVEFVKYGEEKNFVMVDAAMNDLMRPALYDAYHHIEAVETKD---------IATLTANIVGPICETGDFL
DCDA_METTH      RVNTIKESYRK-FAGVDAGFNTLLRPAMYGSYHHILVA-----ERPLDEP---SEKMDVAGNVCESGDLF
DCDA_HELPJ      QVLYEKKAQNKRFVIVDAGMNDFLRPSLYHAKHAIRVIT--------PCGGREISPCDVVGPVCESSDTF
DCDA_PSEFL      QVEYLKHTEHKDFAIVDAAMNDLIRPALYQAWMDVTAVR--------PRDTAARS-YDIVGPICETGDFL
DCDA_ZYMMO      KVIRIKESKTARFVILDAAMNDLVRPTLYDAYHEIKAV----------TPSAQTYQADIVGPVCETGDIF
DCDA_HELPY      QVLYEKKAQNKRFVVVDAGMNDFLRPSLYHAKHAIRVIT--------PSKGREISPCDVVGPVCESSDTF
DCDA_CAMJE      SVLYEKQNKTKRFVVVDGAMNDLIRPSLYEAYHEI-ILPYNQG---------EESLCDVVGGICESGDFF
DCDA_METJA      KVHHIKETPVTKWVMIDAGMNDMMRPAMYEAYHHIINCKVKN----------EKEVVSIAGGLCESSDVF
DCDA_ARCFU      RVNAVKKGYKNFVAVDAGFNVLIR-PAMYGSYHRVAVANK--------MDAEPEEVYTVVGPICESGDVL
DCDA_DEIRA      RVVGTKRT-GRNFCLVDAGMTEFLRPMLYGASHPWDALATEVWD--------------VAGPACESGDLI
DCDA_ORYSJ      RVTGVKSNGTKNFIVVDGSMAELIRPSLYG--------AYQHIELVSPSPDAEVATFDIVGPVCESADFL
DCDA2_ARATH     HVTGVKTNGTKNFIVIDGSMAELIRPSLYDAYQHIELVS------PTP-PEAEVTKFDVVGPVCESADFL
DCDA1_ARATH     HVTGVKTNGTKNFIVIDGSMAELIRPSLYDYQHIELVSP--------PPAEAEVTKFDVVGPVCESADFL
DCDA_SYNY3      YRVGGRKPNIRTYISVDGGMSDNPRPITYQSVYRVALANRMNDEI--------TETVTVAGKHCESGDIL
DCDA_ACTPA      XXXXXXXXXXXXXXXXDGG----------MSDNPRPALYGSXXXXXXXXXXXXXXPVTVVGRHCEAGDVL
DCDA_MYCTU      EVGTVKTAHRRYVSVDGGMSDNIR-----------TALYGAQYDVRLVSRVSDAPPVRLVGKHCESGDII
DCDA_MYCBO      EVGTVKTAHRRYVSVDGGMSDNIR-----------TALYGAQYDVRLVSRVSDAPPVRLVGKHCESGDII
DCLO_SELRU      SVIGTKTRGEQPWYILDEGIYGC-----------FSGIMYDHWTYPFGKG--NKKPSTFGGPSCDGIDVL
DCDA_MYCLE      EVVDVSATAHRRYVSIDGGMSDNIRTALYDAQYDVRLVSRTS-DAP-------AAPASIVGKHCESGDIV
DCDA_BACSU      TVGSQKEVPGRQYVAVDGGMN--------DNIRPXXXXXXXXXXXXNRIGEAHDKTVSIAGKCCESGDML
DCOR_PANRE      NVIASVKNRDGYMYYMNDGVYGSFNCKLFDHYQP-RGMPLAEHDADEP-----RFPVCVWGPTCDGLDQV
DCOR_DICDI      TVISIKQEDNRQHP--RRTSNNMRQYNYYLADGVYGSFNNTKFDYAKVEPLLQPTPCTLFGPTCDSIDVV
DCOR_CAEEL      NIIHATEDHGYMYYINDGVYGSFNC-ILFDHAHPI-------GSPLFDTDRNEKFMSTIWGPTCDSLDLV
DCDA_BACHD      TIGSRKEPNVRHYLSVDGGMSDNLRPALYQAEYEGALANR-----------VNEQPVSVAGKCCESGDML
DCDA_STRCO      EVRAQKPVGSNYFVLVDAGFNDLMRPAMYGSNHRVSVLDAD----GAPRASDARDTV-LAGPLCESGDVF
DCDA_COREF      EVVDVDDETTRRYISVDGGMSDNIRPALYGAEYDARVVSR------FTEG--ETTNTRVVGSHCESGDIL
DCDA_BACMT      QIGSRKDPNVRHYVAVDGGMSDNIRPALYNAKYE-AVLAN--------KPLAKAETVSIAGKCCESGDML
DCDA_ECOLI      QVRSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEH-APTVE---TVVAGPLCESGDVF
DCDA_MYCS2      DVAVSQTAHRRYVSVDGGMSDNIRTS-----------LYAAQYDARLVSRVSDAPPARIVGKHCESGDIV
DCDA_THEMA      XXXXXXXXHNKAFVVVDGGMNVLIRPALYSAYHRIFVLGKQG----------KEMRADVVGPLCESGDVI
TABA_PSESZ      RVIN------------------------------------------------------------------
DCOR2_XENLA     NVIAKKEEHSVSDDEENESSKSIMYYVNDGVYGSFNCLVFDH---AHPKPILHKKPSSLWGPTCDGLDQI
DCOR_TRYBB      NVIAKKVTPGVQTDV---GAH------AESNAQSFMYYVNDGYDHAVVRPLPQREPISVWGPTCDGLDQI
DCOR_MOUSE      NIIAKKSNEQTFMYYVNDGVYGSFNCILYDHAHVKALLQKR------PKPDEKYYSSSIWGPTCDGLDRI
DCOR_RAT        NIIAKKSNEQTLMYYVNDGVYGSFNCILYDHAHVKALLQKR------PKPDEKYYSSSIWGPTCDGLDRI
DCOR_MUSPA      NIIAKKSNEQTFMYYVNDGVYGSFNCILYDHAHVKALLQKR------PKPDEKYYSSSIWGPTCDGLDRI
DCOR_HUMAN      SAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYV--NDGYDHAHVKPLLQKRPSSIWGPTCDGLDRI
DCDA_BUCBP      EIRVIKKTNNRTFILVDSGFNDLIRPAMYGSYHHISVIPRDGRCVNYDDTI----EAVVCGPLCESGDVF
DCOR_NEUCR      NII-------------------------------------------------------------------
DCOR_BOVIN      NIIDEEESTDRTFMYVNDGVYGSFNCILYDHAHVKPLLQKR------PKPDEKYYSSSIWGPTCDGLDRI
SPEA_GEOBB      ----------------------------------------------------------------------
SPEA_GEOSM      ----------------------------------------------------------------------
DCOR_LEIDO      ----------------------------------------------------------------------
DCOR1_XENLA     NIIAKKANDKTLMYYVNDGVYGSFNCILFDHAHVKPVLTKK------PKPDEKFYSSSIWGPTCDGLDRI
DCDA_BUCAP      QVRAIKKMGDKNFVLIDAGFNDLMRPTMYGSYHHVSVVTKDDRNIHETETIIIGGPLCESGDIFTQKEIT
SPEA_SHEON      DVI-------------------------------------------------------------------
SPEA_PELPD      ----------------------------------------------------------------------
DCOR_CHICK      NIIAKKIVSKEQTGSDDEDDVNDKTLMYYVNDGVYGSFNCILYDHAHVKPVLQKRPCSIWGPTCDGLDRI
DCDA_CORGL      EVXXXXXXXRRYIAVDGGMSDNIR-----------PALYGSEYDARVVSRFAEGDPVSIVGSHCESGDIL
SPEA_SHESW      DVI-------------------------------------------------------------------
SPEA_SHEPC      DVI-------------------------------------------------------------------
DCOR_SCHPO      NVIAKRKDEEKVMYYVNDGVYGSLNCILFDHQHPVARVLKCGSRFVYNDLVTGQHRCFIWGPTCDSLDVI
DCOR1_DROME     AKREIRNEAGKLDTVLNDGVYGSFNCILYDH----QVVIAEHYDNAESLPHLKS---LIWGPSCDALDKI
SPEA_SHESA      DVI-------------------------------------------------------------------
DCOR_SOLLC      ----------------------------------------------------------------------
DCOR_CRIGR      NIIAKKXXXQTFMYYVNDGVYGSFNCILYDHAHVKPLLPKR------PKPDEKYYSSSIWGPTCDGLDRI
DCOR_CAPAN      XIIGKRVRGDLREYWINDGLYGSMNCVLYDHATPLACMSN---RVNLNCSGSKMFPSTIFGPTCDALDTV
SPEA_SHEB9      DVI-------------------------------------------------------------------
SPEA_SHEB8      DVI-------------------------------------------------------------------
SPEA_SHEB5      DVI-------------------------------------------------------------------
SPEA_SHEB2      DVI-------------------------------------------------------------------
SPEA_SHESR      DVI-------------------------------------------------------------------
SPEA_SHESM      DVI-------------------------------------------------------------------
DCOR_CANAL      ----------------------------------------------------------------------
AZIN1_MOUSE     NIIAKKVVENDKFSVEKNGSDEPAFSFASKLSEDLNTIPEVHKKYKEDEPLFTS---SLWGPSCDELDQI
DCOR_DATST      ----------------------------------------------------------------------
AZIN1_PONAB     NIIAKKVENDKFSGVEKTGSDEPAFSFASKLSEDLNTIPEVHKKYKEDEPLFTS---SLWGPSCDELDQI
AZIN1_HUMAN     NIIAKKVENDKFSGVEKTGSDEPAFSFASKLSEDLNTIPEVHKKYKEDEPLFTS---SLWGPSCDELDQI
ADC_MOUSE       SIVAKREVLDQASREEQTGAAPKSI-VYYLDEGVYGVFNSVLFDNTCPTPALQKKPSSLWGPAVEGCDCV
SPEA_YERPE      NVIGVERN--------------------------------------------------------------
SPEA_SHEFN      DVI-------------------------------------------------------------------
DCDA_BUCAI      KVWATKKMGNKNFVLVDVGFNDLMRPTMYGSYHHISVIYGDDRKMNEKETIVVAGPLCESGDIFTQKEVQ
SPEA_SHEDO      DVI-------------------------------------------------------------------
SPEA_GEOMG      ----------------------------------------------------------------------
SPEA_SHEAM      DVI-------------------------------------------------------------------
SPEA_PROMH      NVIGVERN--------------------------------------------------------------
SPEA_GEOSL      ----------------------------------------------------------------------
ADC_HUMAN       SIIDQPGREEENGSTSKTIVYHLDEGV-------YGIFNSVLFDNICPTPILQKKPSTLWGPAVDGCDCV
AZIN1_RAT       NIIAKKENDKLSSGVEKNGSDEPAFSFASKLSEDLNTVPEVHKKYKEDEPLFTS---SLWGPSCDELDQI
SPEA_PHOLL      NVIGVERN--------------------------------------------------------------
SPEA_BACV8      EVLE------------------------------------------------------------------
Y4YA_RHISN      ----------------------------------------------------------------------
SPEA_SHEPA      DVI-------------------------------------------------------------------
DCOR2_DROME     ----------------------------------------------------------------------
SPEA_XANCP      NVSEVEQ---------------------------------------------------------------
SPEA_NEIMB      NVIGVER---------------------------------------------------------------
SPEA_MARAV      NVID------------------------------------------------------------------
SPEA_SHEHH      DVI-------------------------------------------------------------------
SPEA_NEIMA      NVIGVER---------------------------------------------------------------
SPEA_SYNPX      DVL-------------------------------------------------------------------
SPEA_SHESH      DVI-------------------------------------------------------------------
SPEA_GEOSF      ----------------------------------------------------------------------
SPEA_VIBPA      NVI-------------------------------------------------------------------
SPEA_SHEPW      DVI-------------------------------------------------------------------
SPEA_XYLFM      NVTEVE----------------------------------------------------------------
SPEA_VIBVU      NVI---------------GTETYKPETVTEPEEDFPLLLNNMW---------------------------
SPEA_XYLFA      NVTEVE----------------------------------------------------------------
SPEA_XANAC      NVSEVEQ---------------------------------------------------------------
SPEA_PROMP      NIL-------------------------------------------------------------------
SPEA_XYLFT      NVTEVE----------------------------------------------------------------
SPEA_XYLF2      NVTEVE----------------------------------------------------------------
SPEA_HAMD5      NVIGVERN--------------------------------------------------------------
SPEA_DEIRA      PVVDV-----------------------------------------------------------------
SPEA_BACFR      EVLE------------------------------------------------------------------
SPEA_BACFN      EVLE------------------------------------------------------------------
SPEA_SHELP      DVI-------------------------------------------------------------------
SPEA_PASMU      NVIGVER---------------------------------------------------------------
SPEA_BACTN      EVLE------------------------------------------------------------------
SPEA_GEOLS      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFIGGQx
DCDA_VIBCH      GKDRDL-VLQEGDLLAVRSSGAYGFTMS-SNYNTRPRVAEVMVDG--
DCDA_HAEIN      GKQRELS-IAEGDYIAQCSAGAYGASMS-SNYNSRARTAEVLVDG--
DCDA_PSEAE      AKDRDL-ALAEGDLLAVRSAGAYGFVMS-------------------
DCDA_NEIMA      GKDRTI-ACEEGDLLLIRSAGAYG-----------------------
DCDA_AQUAE      ALDREIEEVQRGEYLAVLSAGAYGFAMSSH-----------------
DCDA_NEIMB      GKDRTI-ACEEGDLLLIRSAGAYG-----------------------
DCDA_METTH      ARDRQLPEINEGDVLAIMNAGAYSFSMS-SQYNSRPRPAEVLV----
DCDA_HELPJ      LKDANLPELEPGDKLAIEKVGAYG-----------------------
DCDA_PSEFL      AKGREL-ALEEGDLLAVHSAGAYGFVMS-------------------
DCDA_ZYMMO      ARNRSISAVKADDLMAIMSAGAYG-----------------------
DCDA_HELPY      LKDAHLPELEPGDKLVIEKVGAYG-----------------------
DCDA_CAMJE      AKARSLPSTQSDDIMVIKNTGAYGFSMS-------------------
DCDA_METJA      GRDRELDKVEVGDVLAIFDVGAYG-----------------------
DCDA_ARCFU      ARDRKLPKVEVGDLIAVFDAGAYGFVMS-SQYNGRPRCAEVLVSG--
DCDA_DEIRA      ARGVPLPTPQRGHLLLIGEAGAYGASMS-STYLSRPRPAEVLWTG--
DCDA_ORYSJ      GKDRELPTPDKGAGLVVHDAGAY------------------------
DCDA2_ARATH     GKDRELPTPPQGAGLVVHDAGAY------------------------
DCDA1_ARATH     GKDRELPTPPQGAGLVVHDAGAY------------------------
DCDA_SYNY3      VKDVALPAAEPGDIMVVAATGAYNHSMSNYNRLGRP-----------
DCDA_ACTPA      AEDVPLEDVRAGDLLAVPVTGAY-----HHALASN------------
DCDA_MYCTU      VRDTWVDDIRPGDLVAVAATGAYCYSLS-------------------
DCDA_MYCBO      VRDTWVDDIRPGDLVAVAATGAYCYSLS-------------------
DCLO_SELRU      YRDFMAPELKIGDKVLVTEMGSY------------------------
DCDA_MYCLE      VRDTWVDDLKPGDLVGVAATGAYCYSLSRYNMLGRP-----------
DCDA_BACSU      IWDIDLPEVKEGDLLAVFCTGAYGYSMA-NNYNRIPRPAVVFV----
DCOR_PANRE      EESSVMPRLYEGDWLYYPDMGAY------------------------
DCOR_DICDI      LKDTQIPELKIGDWLYFQDMGAY------------------------
DCOR_CAEEL      EDKKLMPKMNVGEWLYYPDMGAY------------------------
DCDA_BACHD      IWDLPLPEANHEDILAVFCTGAYGYSMA-NNYNRIPRPPVVFV----
DCDA_STRCO      TQXXXXXRTDVGDLVVFHDTGAYGASMS-STYNSRPLIPEVLVDG--
DCDA_COREF      INEAPSD-IHTGDXXXXXXTGAYCYAMS-------------------
DCDA_BACMT      IWDLPLPKADSDDILAVFCTGAYGYSMA-NNYNRIPRPAVVFV----
DCDA_ECOLI      TQQEALPEVKAGDYLVLHDTGAYGASMS-SNYNSRPLPEVLFDNGQ-
DCDA_MYCS2      VRDTWVDDIAPGDLIGVAATGAYCYSMSRYNLLCRP-----------
DCDA_THEMA      AYDRELPEVEPGDIIAVENAGAYGYTMS-NNYNSTTRPAEVLV----
TABA_PSESZ      -----------------------------------------------
DCOR2_XENLA     AERVQLPELHVGDWLLFENMGAY------------------------
DCOR_TRYBB      VERYYLPEMQVGEWLLFEDMGAY------------------------
DCOR_MOUSE      VERCNLPEMHVGDWMLFENMGAY------------------------
DCOR_RAT        VERCSLPEMHVGDWMLFENMGAY------------------------
DCOR_MUSPA      VERCNLPEMHVGDWMLFENMGAY------------------------
DCOR_HUMAN      VERCDLPEMHVGDWMLFENMGAY------------------------
DCDA_BUCBP      TQNEYGDNVQIGDFLVFHDTGAYGASMS-------------------
DCOR_NEUCR      -----------------------------------------------
DCOR_BOVIN      VERCNLPEMHVGDWMLFENMGAY------------------------
SPEA_GEOBB      -----------------------------------------------
SPEA_GEOSM      -----------------------------------------------
DCOR_LEIDO      -----------------------------------------------
DCOR1_XENLA     VERFELPELQVGDWMLFENMGAY------------------------
DCDA_BUCAP      TRKLPI--LKIGDYLIFHDVGAYGASMS-------------------
SPEA_SHEON      -----------------------------------------------
SPEA_PELPD      -----------------------------------------------
DCOR_CHICK      VERCNMPELQVGDWILFENMGAY------------------------
DCDA_CORGL      INEIYPSDITSGDFLALAATGAYCYAMS-------------------
SPEA_SHESW      -----------------------------------------------
SPEA_SHEPC      -----------------------------------------------
DCOR_SCHPO      ANDAHLPELNVGDWIYFEDAGAY------------------------
DCOR1_DROME     SEDLHLPNLNRGDLLGFRNMGAY------------------------
SPEA_SHESA      -----------------------------------------------
DCOR_SOLLC      -----------------------------------------------
DCOR_CRIGR      VERCNLPEMHVGDWMLFENMGAY------------------------
DCOR_CAPAN      LRDYHVPELQVNDWVIFPNMGAY------------------------
SPEA_SHEB9      -----------------------------------------------
SPEA_SHEB8      -----------------------------------------------
SPEA_SHEB5      -----------------------------------------------
SPEA_SHEB2      -----------------------------------------------
SPEA_SHESR      -----------------------------------------------
SPEA_SHESM      -----------------------------------------------
DCOR_CANAL      -----------------------------------------------
AZIN1_MOUSE     VESCLLPELNVGDWLIFDNMGADSFH---------------------
DCOR_DATST      -----------------------------------------------
AZIN1_PONAB     VESCLLPELNVGDWLIFDNMGADSFH---------------------
AZIN1_HUMAN     VESCLLPELNVGDWLIFDNMGADSFH---------------------
ADC_MOUSE       AEGLWLPQLQVGDWLVFDNMGAY------------------------
SPEA_YERPE      -----------------------------------------------
SPEA_SHEFN      -----------------------------------------------
DCDA_BUCAI      TRKLPT--IKVGDYLIFHDTGAYG-----------------------
SPEA_SHEDO      -----------------------------------------------
SPEA_GEOMG      -----------------------------------------------
SPEA_SHEAM      -----------------------------------------------
SPEA_PROMH      -----------------------------------------------
SPEA_GEOSL      -----------------------------------------------
ADC_HUMAN       AEGLWLPQLHVGDWLVFDNMGAY------------------------
AZIN1_RAT       VESCLLPELSVGDWLIFDNMGADSLH---------------------
SPEA_PHOLL      -----------------------------------------------
SPEA_BACV8      -----------------------------------------------
Y4YA_RHISN      -----------------------------------------------
SPEA_SHEPA      -----------------------------------------------
DCOR2_DROME     -----------------------------------------------
SPEA_XANCP      -----------------------------------------------
SPEA_NEIMB      -----------------------------------------------
SPEA_MARAV      -----------------------------------------------
SPEA_SHEHH      -----------------------------------------------
SPEA_NEIMA      -----------------------------------------------
SPEA_SYNPX      -----------------------------------------------
SPEA_SHESH      -----------------------------------------------
SPEA_GEOSF      -----------------------------------------------
SPEA_VIBPA      -----------------------------------------------
SPEA_SHEPW      -----------------------------------------------
SPEA_XYLFM      -----------------------------------------------
SPEA_VIBVU      -----------------------------------------------
SPEA_XYLFA      -----------------------------------------------
SPEA_XANAC      -----------------------------------------------
SPEA_PROMP      -----------------------------------------------
SPEA_XYLFT      -----------------------------------------------
SPEA_XYLF2      -----------------------------------------------
SPEA_HAMD5      -----------------------------------------------
SPEA_DEIRA      -----------------------------------------------
SPEA_BACFR      -----------------------------------------------
SPEA_BACFN      -----------------------------------------------
SPEA_SHELP      -----------------------------------------------
SPEA_PASMU      -----------------------------------------------
SPEA_BACTN      -----------------------------------------------
SPEA_GEOLS      -----------------------------------------------