[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08007.1

[Show Plain Result]


## Summary of Sequence Search
    1::1044
    1::1028      0.0  43% 1037 aa  ACRD_ECOLI RecName: Full=Probable aminoglycoside efflux pump;AltName:
    1::1040      0.0  41% 1046 aa  MEXB_PSEAE RecName: Full=Multidrug resistance protein mexB;AltName:
    1::1000      0.0  42% 1049 aa  ACRB_ECOLI RecName: Full=Acriflavine resistance protein B;
    1::1016      0.0  41% 1034 aa  ACRF_ECOLI RecName: Full=Acriflavine resistance protein F;AltName:
    1::1037      0.0  40% 1037 aa  MDTF_ECOL6 RecName: Full=Multidrug resistance protein mdtF;
    1::1037      0.0  40% 1037 aa  MDTF_ECO57 RecName: Full=Multidrug resistance protein mdtF;
    1::1037      0.0  39% 1037 aa  MDTF_ECOLI RecName: Full=Multidrug resistance protein mdtF;
    1::1037      0.0  38% 1050 aa  TTGB_PSEPU RecName: Full=Toluene efflux pump membrane transporter
    1::1037      0.0  38% 1050 aa  TTGB_PSEPK RecName: Full=Probable efflux pump membrane transporter
    1::1037      0.0  38% 1050 aa  MEPB_PSEPU RecName: Full=Multidrug/solvent efflux pump membrane
    1::1037      0.0  38% 1050 aa  ARPB_PSEPU RecName: Full=Antibiotic efflux pump membrane transporter
    1::1013      0.0  37% 1049 aa  SRPB_PSEPU RecName: Full=Solvent-resistant pump membrane transporter
    1::1013      0.0  37% 1049 aa  TTGH_PSEPU RecName: Full=Toluene efflux pump membrane transporter
    1::1013      0.0  36% 1046 aa  SEPB_PSEP1 RecName: Full=Probable efflux pump membrane transporter
    1::1015      0.0  36% 1048 aa  TTGE_PSEPU RecName: Full=Toluene efflux pump membrane transporter
    7::1010    1e-87  27% 1024 aa  MDTC_YERPY RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::1010    1e-87  27% 1024 aa  MDTC_YERPS RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::1010    1e-87  27% 1024 aa  MDTC_YERPB RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::1010    1e-87  27% 1024 aa  MDTC_YERP3 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::1010    3e-87  27% 1024 aa  MDTC_YERPN RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::1010    3e-87  27% 1024 aa  MDTC_YERPG RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::1010    3e-87  27% 1024 aa  MDTC_YERPE RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::1010    3e-87  27% 1024 aa  MDTC_YERPA RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1019    5e-86  26% 1052 aa  MDTB_YERPS RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1019    8e-86  26% 1052 aa  MDTB_YERPE RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    9e-85  26% 1040 aa  MDTB_SHIBS RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    2e-84  26% 1040 aa  MDTB_ECOSE RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    2e-84  26% 1040 aa  MDTB_ECO55 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    3e-84  26% 1040 aa  MDTB_ECOL5 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    3e-84  26% 1040 aa  MDTB_ECOUT RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    3e-84  26% 1040 aa  MDTB_ECOSM RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    3e-84  26% 1040 aa  MDTB_ECOL6 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    3e-84  26% 1040 aa  MDTB_ECOK1 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    3e-84  26% 1040 aa  MDTB_ECO5E RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    3e-84  26% 1040 aa  MDTB_ECO57 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    3e-84  26% 1040 aa  MDTB_ECO45 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    3e-84  26% 1040 aa  MDTB_ECO24 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    4e-84  26% 1040 aa  MDTB_SHISS RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    6e-84  26% 1040 aa  MDTB_SHIB3 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    6e-84  26% 1040 aa  MDTB_ECO8A RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    6e-84  26% 1040 aa  MDTB_ECO81 RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::991     1e-83  27% 1024 aa  MDTC_YERE8 RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1031    2e-83  26% 1039 aa  MDTB_SHIFL RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    3e-83  26% 1040 aa  MDTB_ECO7I RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1026    8e-83  25% 1040 aa  MDTB_KLEP7 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1026    1e-82  25% 1040 aa  MDTB_KLEP3 RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::1015    2e-82  26% 1026 aa  MDTC_PECCP RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1019    4e-82  26% 1040 aa  MDTB_ENT38 RecName: Full=Multidrug resistance protein mdtB;AltName:
    3::990     5e-82  27% 1065 aa  NOLG_RHIME RecName: Full=Nodulation protein nolG;Flags: Precursor;
   13::1016    1e-81  25% 1032 aa  Y895_HAEIN RecName: Full=Uncharacterized transporter HI0895;
   13::1032    1e-80  25% 1040 aa  MDTB_ECOLI RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    1e-80  25% 1040 aa  MDTB_ECOLC RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    1e-80  25% 1040 aa  MDTB_ECODH RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    1e-80  25% 1040 aa  MDTB_ECOBW RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    1e-80  25% 1040 aa  MDTB_ECO27 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    2e-80  25% 1040 aa  MDTB_ESCF3 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    2e-80  25% 1040 aa  MDTB_ECOLU RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1026    2e-80  25% 1040 aa  MDTB_CITK8 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1032    7e-80  25% 1040 aa  MDTB_ECOHS RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::990     1e-78  26% 1025 aa  MDTC_ENT38 RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1026    2e-78  25% 1040 aa  MDTB_SALAR RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1019    2e-78  25% 1039 aa  MDTB_SERP5 RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::1005    8e-78  27% 1026 aa  MDTC_ERWCT RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     4e-77  28% 1029 aa  MDTC_ENTS8 RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1036    4e-77  25% 1040 aa  MDTB_ENTS8 RecName: Full=Multidrug resistance protein mdtB;AltName:
   32::991     1e-76  27% 1026 aa  MDTC_SALCH RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     3e-76  27% 1026 aa  MDTC_SALPC RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     4e-76  26% 1026 aa  MDTC_SERP5 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     1e-75  27% 1025 aa  MDTC_KLEP7 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     3e-75  27% 1025 aa  MDTC_ECO81 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     4e-75  27% 1025 aa  MDTC_ECOL5 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     5e-75  27% 1025 aa  MDTC_ECOL6 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     6e-75  27% 1028 aa  MDTC_CITK8 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     8e-75  27% 1025 aa  MDTC_KLEP3 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     8e-75  27% 1025 aa  MDTC_ECOUT RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     1e-74  27% 1025 aa  MDTC_ECO27 RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1026    1e-74  25% 1040 aa  MDTB_SALPC RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::991     2e-74  27% 1025 aa  MDTC_ECO55 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     2e-74  27% 1025 aa  MDTC_ECOK1 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     2e-74  27% 1025 aa  MDTC_ECO45 RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1026    2e-74  25% 1040 aa  MDTB_SALTI RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1026    2e-74  25% 1040 aa  MDTB_SALPB RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::991     3e-74  27% 1025 aa  MDTC_ECOSM RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1026    3e-74  25% 1040 aa  MDTB_SALHS RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1026    3e-74  25% 1040 aa  MDTB_SALA4 RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::991     4e-74  27% 1025 aa  MDTC_ECOSE RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     4e-74  27% 1025 aa  MDTC_ECO8A RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1026    4e-74  25% 1040 aa  MDTB_SALSV RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1026    4e-74  25% 1040 aa  MDTB_SALEP RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1026    4e-74  25% 1040 aa  MDTB_SALDC RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::991     9e-74  27% 1025 aa  MDTC_ECO5E RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     9e-74  27% 1025 aa  MDTC_ECO57 RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1026    9e-74  25% 1040 aa  MDTB_SALPK RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1026    9e-74  25% 1040 aa  MDTB_SALPA RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1026    9e-74  25% 1040 aa  MDTB_SALNS RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::991     1e-73  27% 1025 aa  MDTC_ESCF3 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     1e-73  27% 1025 aa  MDTC_ECOLI RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     1e-73  27% 1025 aa  MDTC_ECODH RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     1e-73  27% 1025 aa  MDTC_ECOBW RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     1e-73  27% 1025 aa  MDTC_ECO24 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     2e-73  27% 1025 aa  MDTC_SHIBS RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     2e-73  26% 1025 aa  MDTC_ECOLU RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1026    2e-73  25% 1040 aa  MDTB_SALCH RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1026    2e-73  25% 1040 aa  MDTB_SALTY RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::991     3e-73  27% 1025 aa  MDTC_SHISS RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     3e-73  27% 1025 aa  MDTC_ECOLC RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::991     4e-73  27% 1025 aa  MDTC_ECO7I RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1026    4e-73  25% 1040 aa  MDTB_SALG2 RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::991     5e-73  27% 1036 aa  MDTC_PHOLL RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1019    5e-73  25% 1040 aa  MDTB_ERWCT RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::991     8e-73  27% 1025 aa  MDTC_SHIB3 RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::1029    8e-73  24% 1048 aa  MDTB_PHOLL RecName: Full=Multidrug resistance protein mdtB;AltName:
    7::991     1e-72  27% 1025 aa  MDTC_ECOHS RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     2e-72  27% 1026 aa  MDTC_SALPA RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     3e-72  27% 1026 aa  MDTC_SALPK RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::1008    7e-72  25% 1024 aa  MDTC_ERWT9 RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::987     3e-71  26% 1021 aa  MDTC_SHIFL RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::987     3e-71  27% 1021 aa  MDTC_SHIF8 RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     6e-71  27% 1026 aa  MDTC_SALTI RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     7e-71  27% 1026 aa  MDTC_SALNS RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     7e-71  27% 1026 aa  MDTC_SALA4 RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     1e-70  27% 1026 aa  MDTC_SALPB RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     1e-70  27% 1026 aa  MDTC_SALTY RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     1e-70  27% 1026 aa  MDTC_SALEP RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     2e-70  27% 1026 aa  MDTC_SALSV RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     2e-70  27% 1026 aa  MDTC_SALHS RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     3e-70  27% 1026 aa  MDTC_SALG2 RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     6e-70  27% 1026 aa  MDTC_SALDC RecName: Full=Multidrug resistance protein mdtC;AltName:
   32::991     7e-69  26% 1026 aa  MDTC_SALAR RecName: Full=Multidrug resistance protein mdtC;AltName:
    7::1047    9e-66  25% 1052 aa  HELA_LEGPN RecName: Full=Protein helA;
   17::1018    3e-65  25% 1063 aa  CZCA_ALCSC RecName: Full=Cation efflux system protein czcA;
   17::1018    1e-64  25% 1063 aa  CZCA_RALME RecName: Full=Cobalt-zinc-cadmium resistance protein
   12::1031    7e-39  25% 1076 aa  CNRA_RALME RecName: Full=Nickel and cobalt resistance protein cnrA;
   20::1042    2e-38  25% 1047 aa  CUSA_ECOLI RecName: Full=Cation efflux system protein cusA;
   20::1042    2e-38  25% 1047 aa  CUSA_ECOL6 RecName: Full=Cation efflux system protein cusA;
   20::1046    5e-38  25% 1048 aa  SILA_SALTY RecName: Full=Putative cation efflux system protein
   20::1040    5e-38  25% 1045 aa  CUSA_ECO57 RecName: Full=Cation efflux system protein cusA;
    7::151     2e-31  20% 1052 aa  SWRC_BACSU RecName: Full=Swarming motility protein swrC;
   12::1064    9e-29  25% 1076 aa  NCCA_ALCXX RecName: Full=Nickel-cobalt-cadmium resistance protein
   34::98      6e-12  42%  163 aa  YCBL_BACUN RecName: Full=Uncharacterized 17.3 kDa protein in cblS
  327::417     1e-07  34%  503 aa  SECD_HELPY RecName: Full=Protein-export membrane protein secD;
  349::439     3e-07  36%  526 aa  SECD_HELPJ RecName: Full=Protein-export membrane protein;
 1057::1165    1e-05  28% 1277 aa  NPC1_PIG RecName: Full=Niemann-Pick C1 protein;Flags: Precursor;
 1075::1181    2e-05  29% 1333 aa  NPCL1_MOUSE RecName: Full=Niemann-Pick C1-like protein 1;Flags:
 1049::1166    5e-05  25% 1278 aa  NPC1_MOUSE RecName: Full=Niemann-Pick C1 protein;Flags: Precursor;
 1075::1181    2e-04  28% 1331 aa  NPCL1_RAT RecName: Full=Niemann-Pick C1-like protein 1;Flags:
 1058::1166    2e-04  25% 1278 aa  NPC1_HUMAN RecName: Full=Niemann-Pick C1 protein;Flags: Precursor;
 1087::1281    3e-04  23% 1383 aa  NPC1_CAEEL RecName: Full=Niemann-Pick C1 protein homolog 1;Flags:
  206::357     5e-04  34% 1146 aa  MMPLC_MYCTU RecName: Full=Putative membrane protein mmpL12;
  423::561     6e-04  29%  583 aa  SECD_TREPA RecName: Full=Protein-export membrane protein secD;
  318::438     8e-04  26%  472 aa  SECD_SYNY3 RecName: Full=Protein-export membrane protein secD;
  955::1030    8e-04  36% 1218 aa  DISP_DROME RecName: Full=Protein dispatched;
    1::1044

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAQFFLRRPAFAWVLAILTMVAGLVALNSIPVAQYPAVAPPTVILYADYPGATARTVEDRVTAVLEQQMH
ACRD_ECOLI      MANFFIDRPIFAWVLAILLCLTGTLAIFSLPVEQYPDLAPPNVRVTANYPGASAQTLENTVTQVIEQNMT
MEXB_PSEAE      MSKFFIDRPIFAWVIALVIMLAGGLSILSLPVNQYXXXXXXXXXVQVSYPGASAETVQDTVVQVIEQQMN
ACRB_ECOLI      MPNFFIDRPIFAWVXXXXXXXXXXXXXXKLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
ACRF_ECOLI      MANFFIRRPIFAWVXXXXXXXXXXXXXXQLPVAQYPTIAPPAVSVSANYPGADAQTVQDTVTQVIEQNMN
MDTF_ECOL6      MANYFIDRPVFAWVLAIIMMLAGGLAIMNLPVAQYPQIAPPTITVSATYPGADAQTVEDSVTQVIEQNMN
MDTF_ECO57      MANYFIDRPVFAWVLAIIMMLAGGLAIMNLPVAQYPQIAPPTITVSATYPGADAQTVEDSVTQVIEQNMN
MDTF_ECOLI      MANYFIDRPVFAWVLAIIMMLAGGLAIMNLPVAQYPQIAPPTITVSATYPGADAQTVEDSVTQVIEQNMN
TTGB_PSEPU      MSKFFIDRPIFAWVIALVIMLVGALSILKLPINQYXXXXXXXXXXXVTYPGASAQTVQDTVVQVIEQQLN
TTGB_PSEPK      MSKFFIDRPIFAWVIALVIMLVGALSILKLPINQYXXXXXXXXXXXVTYPGASAQTVQDTVVQVIEQQLN
MEPB_PSEPU      MSKFFIDRPIFAWVIALVIMLVGALSILKLPINQYXXXXXXXXXXXVTYPGASAQTVQDTVVQVIEQQLN
ARPB_PSEPU      MSKFFIDRPIFAWVIALVIMLVGALSILKLPINQYXXXXXXXXXXXVTYPGASAQTVQDTVVQVIEQQLN
SRPB_PSEPU      MSRFFIDRPIFAWVLAIVAMLAGALSLAKMPISQYPNIAAPAVSIQVSYPGASAQTVQDTVVQVIEQQLS
TTGH_PSEPU      MSRFFIDRPIFAWVLAIVAMLAGALSLAKMPISQYPNIAAPAVSIQVSYPGASAQTVQDTVVQVIEQQLS
SEPB_PSEP1      MSRFFIDRPIFAWVLAIIAMLAGALSLTKMPISQYPNIAAPAVSIQVVYPGASAKTVQDTVVQVIEQQLN
TTGE_PSEPU      MSRFFIDRPIFAWVLAIIAMLAGALSLTKMPISQYPNIAAPAVSIQVVYPGASAKTVQDTVVQVIEQQLN
MDTC_YERPY      ----FIQRPVXXXXXXXXXXXSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLERALG
MDTC_YERPS      ----FIQRPVXXXXXXXXXXXSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLERALG
MDTC_YERPB      ----FIQRPVXXXXXXXXXXXSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLERALG
MDTC_YERP3      ----FIQRPVXXXXXXXXXXXSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLERALG
MDTC_YERPN      ----FIQRPVXXXXXXXXXXXSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLERALG
MDTC_YERPG      ----FIQRPVXXXXXXXXXXXSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLERALG
MDTC_YERPE      ----FIQRPVXXXXXXXXXXXSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLERALG
MDTC_YERPA      ----FIQRPVXXXXXXXXXXXSGIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLERALG
MDTB_YERPS      -SRLFILRPVATTLFMIAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVVTSSITAPLERQFG
MDTB_YERPE      -SRLFILRPVATTLFMIAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVVTSSITAPLERQFG
MDTB_SHIBS      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECOSE      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECO55      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECOL5      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECOUT      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECOSM      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECOL6      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECOK1      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECO5E      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECO57      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECO45      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECO24      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_SHISS      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_SHIB3      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECO8A      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECO81      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTC_YERE8      ----FIQRPVXXXXXXXXXXXSGVIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSIATPLERALG
MDTB_SHIFL      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECO7I      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_KLEP7      -SRLFIMRPVATTLLMVAILLAGIIGYRFLPVSALPEVDYPTIQVVTLYPGASPDVVTSAITAPLERQFG
MDTB_KLEP3      -SRLFIMRPVATTLLMVAILLAGIIGYRFLPVSALPEVDYPTIQVVTLYPGASPDVVTSAITAPLERQFG
MDTC_PECCP      ----FIHRPVXXXXXXXXXXXCGVLGFRLLPVSPLPQVDFPVISVSASLPGASPETMASAVATPLERALG
MDTB_ENT38      -SRLFIMRPVATTLLMVAILIAGIIGYRFLPVSALPEVDYPTIQVITLYPGASPDVVTSAITAPLERQFG
NOLG_RHIME      LTRISINHPVFATMMMVMILVLGLFSYGRLGVDHYPETDLPVVVVATTYTGASPESVESEISRPIEAALN
Y895_HAEIN      ----FIRRPVLAVSISLLMIILGLQAISKLAVREYPKMTTTVITVSTAYPGADANLIQAFVTSKLEESIA
MDTB_ECOLI      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECOLC      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECODH      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECOBW      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECO27      -SRLFIMRPVATTLLMVAILLAGIIGYQALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ESCF3      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECOLU      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_CITK8      -SRLFIMRPVATTLLMVAILLAGIIGYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_ECOHS      -SRLFIMRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTC_ENT38      ----FIYRPVATILIAVAITLCGVLGFRLLPVAPLPQVDFPVIMISASLPGASPETMASSVATPLERSLG
MDTB_SALAR      -SRLFILRPVXXXXXXXXXXXXGIIGYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_SERP5      -SRLFILRPVATTLLMVAILLAGIIGYRALPVSALPEVDYPTIQVVTLYPGASPDVVTSAITAPLERQFG
MDTC_ERWCT      ----FIHRPVXXXXXXXXXXXCGVLGFRLLPVSPLPQVDFPVISVSASLAGASPETMASAVATPLERALG
MDTC_ENTS8      ----FIYRPVATILLSIAVTLCGVLGFRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTB_ENTS8      -SRLFILRPVATTLLMVAILLAGIIGYRFLPVSALPEVDYPTIQVVTLYPGASPDVVTSAITAPLERQFG
MDTC_SALCH      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALPC      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SERP5      ----FIYRPVATTLLTLAIAISGVISFSLLPVSPLPQVDYPVISISASLPGADPETMASSVATPLERALG
MDTC_KLEP7      ----FIYRPVATILISLAITLCGILGFRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECO81      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECOL5      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECOL6      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_CITK8      ----FIYRPVATILISIAITLCGVLGFRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_KLEP3      ----FIYRPVATILISLAITLCGILGFRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECOUT      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECO27      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTB_SALPC      -SRLFILRPVXXXXXXXXXXXXXXXXYRLLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTC_ECO55      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECOK1      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECO45      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTB_SALTI      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSSVTAPLERQFG
MDTB_SALPB      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTC_ECOSM      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTB_SALHS      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_SALA4      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTC_ECOSE      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECO8A      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTB_SALSV      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_SALEP      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_SALDC      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTC_ECO5E      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECO57      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTB_SALPK      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSSVTAPLERQFG
MDTB_SALPA      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSSVTAPLERQFG
MDTB_SALNS      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTC_ESCF3      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECOLI      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIIVSASLPGASPETMASSVATPLERSLG
MDTC_ECODH      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIIVSASLPGASPETMASSVATPLERSLG
MDTC_ECOBW      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIIVSASLPGASPETMASSVATPLERSLG
MDTC_ECO24      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SHIBS      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECOLU      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTB_SALCH      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTB_SALTY      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTC_SHISS      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECOLC      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ECO7I      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPSASPETMASSVATPLERSLG
MDTB_SALG2      -SRLFILRPVXXXXXXXXXXXXXXXXYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQFG
MDTC_PHOLL      ----FIQRPVATTLLSLAITLCGVLGFTLLPVSPLPQVDFPVISVYASLPGASPETMASSVATPLEHALG
MDTB_ERWCT      -SRLFILRPVATTXXXXXXXXXXXXXYRALPVSALPEVDYPTIQVITLYPGASPDVVTSAITAPLERQFG
MDTC_SHIB3      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTB_PHOLL      -SRLFILRPVATTLFMAAILLAGIIGYRMLPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLERQLG
MDTC_ECOHS      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALPA      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALPK      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_ERWT9      ----FIHRPVATWLLTLTIVLAGFLGFRLLPVAPLPQVDFPVIVVTASLPGASPEIMASSVATPLERALG
MDTC_SHIFL      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SHIF8      ----FIYRPVATILLSVAITLCGILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALTI      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALNS      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALA4      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALPB      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALTY      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALEP      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALSV      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALHS      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALG2      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALDC      -----------------------------LPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLERSLG
MDTC_SALAR      -----------------------------LPVAPLPQVDFPVIMVRASLPGASPETMASSVATPLERSLG
HELA_LEGPN      --RFSLKHRWFVLLFTLVIAILGVYNFQRLPIDAVPDITNVQVQINTQASGYSPFEVEQRITFPIELAMS
CZCA_ALCSC      -------------LLAVFGMAGGIFSYNRLPIDAVPDITNVQVQVNTSAPGYSPLETEQRVTYPIEVVMA
CZCA_RALME      -------------LLAVFGMAGGIFSYNRLPIDAVPDITNVQVQVNTSAPGYSPLETEQRATYPIEVVMA
CNRA_RALME      ----------YRWLVLFLTAVVAVIGLNLLPIDVTPDITNKQVQINSVVPTMSPVEVEKRVTYPIETAIA
CUSA_ECOLI      ---------------ALFLSIWGTWTIINTPVDALPDLSDVQVIIKTSYPGQAPQIVENQVTYPLTTTML
CUSA_ECOL6      ---------------ALFLSIWGTWTIINTPVDALPDLSDVQVIIKTSYPGQAPQIVENQVTYPLTTTML
SILA_SALTY      ---------------ALFLSIWGTWTIINTPVDALPDLSDVQVIIKTSYPGQAPQIVENQVTYPLTTTML
CUSA_ECO57      ---------------ALFLSIWGTWTIINTPVDALPDLSDVQVIIKTSYPGQAPQIVENQVTYPLTTTML
SWRC_BACSU      ---FVLKNKFAVWLMTIIVTAAGLYAGMNMKQESIPDVNMPYLTISTTYPGATPSQVADEVTKPVEQAVQ
NCCA_ALCXX      ----------FRWLVLFLTAVVGAIGLNLLPIDVTPDITNKQVQINTVVPTLSPVEVEKRVTYPIETAIA
YCBL_BACUN      ----------------------------------------------------------------------
SECD_HELPY      ----------------------------------------------------------------------
SECD_HELPJ      ----------------------------------------------------------------------
NPC1_PIG        ----------------------------------------------------------------------
NPCL1_MOUSE     ----------------------------------------------------------------------
NPC1_MOUSE      ----------------------------------------------------------------------
NPCL1_RAT       ----------------------------------------------------------------------
NPC1_HUMAN      ----------------------------------------------------------------------
NPC1_CAEEL      ----------------------------------------------------------------------
MMPLC_MYCTU     ----------------------------------------------------------------------
SECD_TREPA      ----------------------------------------------------------------------
SECD_SYNY3      ----------------------------------------------------------------------
DISP_DROME      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GIPGLLYIDSSSEAGTATVTIGFRQGTDPQLAQVNVRNRVSQAEPLLPEVVRRGGVYVDQASASPFMYVS
ACRD_ECOLI      GLDNLMYMSSSSGTGQASVTLSFKAGTDPDEAVQQVQNQLQSAMRKLPQAVQNQGVTVRKTGDTNILTIA
MEXB_PSEAE      GIDNLRYISSESNSGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFLMVVG
ACRB_ECOLI      GIDNLMYMSSNSDSGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVG
ACRF_ECOLI      GIDNLMYMSSTSDAGSVTITLTFQSGTDPDIAQVQVQNKLQLATPLLPQEVQQQGISVEKSSSSYLMVAG
MDTF_ECOL6      GLDGLMYMSSTSDAGNASITLTFETGTSPDIAQVQVQNKLQLAMPSLPEAVQQQGISVDKSSSNILMVAA
MDTF_ECO57      GLDGLMYMSSTSDAGNASITLTFETGTSPDIAQVQVQNKLQLAMPSLPEAVQQQGISVDKSSSNILMVAA
MDTF_ECOLI      GLDGLMYMSSTSDAGNASITLTFETGTSPDIAQVQVQNKLQLAMPSLPEAVQQQGISVDKSSSNILMVAA
TTGB_PSEPU      GIDNLRYVSSESNSGSMTITATFEQGTNPDTAQVQVQNKLNLATPLLPQEVQQQGIRVTKAVKNFLLVIG
TTGB_PSEPK      GIDNLRYVSSESNSGSMTITATFEQGTNPDTAQVQVQNKLNLATPLLPQEVQQQGIRVTKAVKNFLLVIG
MEPB_PSEPU      GIDNLRYVSSESNSGSMTITATFEQGTNPDTAQVQVQNKLNLATPLLPQEVQQQGIRVTKAVKNFLLVIG
ARPB_PSEPU      GIDNLRYVSSESNSGSMTITATFEQGTNPDTAQVQVQNKLNLATPLLPQEVQQQGIRVTKAVKNFLLVIG
SRPB_PSEPU      GLDGFRYMSAESASGSMTIIVTFEQGTDPDIAQVQVQNKLQLATPRLPEEVQRQGLRVVKYQMNFFLVMS
TTGH_PSEPU      GLDGFRYMSAESASGSMTIIVTFEQGTDPDIAQVQVQNKLQLATPRLPEEVQRQGLRVVKYQMNFFLVMS
SEPB_PSEP1      GLDGFRYMAAESASGSMNIIVTFEQGTNPDIAQVQVQNKLQLATPRLPEEVQRQGLRVVKYQMNFFMVVG
TTGE_PSEPU      GLDGFRYMAAESASGSMNIIVTFEQGTNPDIAQVQVQNKLQLATPRLPEEVQRQGLRVVKYQMNFFMVVG
MDTC_YERPY      RIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSRPTYRKMPSDAPIMIMT
MDTC_YERPS      RIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSRPTYRKMPSDAPIMIMT
MDTC_YERPB      RIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSRPTYRKMPSDAPIMIMT
MDTC_YERP3      RIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSRPTYRKMPSDAPIMIMT
MDTC_YERPN      RIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSRPTYRKMPSDAPIMIMT
MDTC_YERPG      RIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSRPTYRKMPSDAPIMIMT
MDTC_YERPE      RIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSRPTYRKMPSDAPIMIMT
MDTC_YERPA      RIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSRPTYRKMPSDAPIMIMT
MDTB_YERPS      QMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPYPPIYNKVNPADPPILTL
MDTB_YERPE      QMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPYPPIYNKVNPADPPILTL
MDTB_SHIBS      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECOSE      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECO55      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECOL5      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECOUT      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECOSM      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECOL6      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECOK1      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECO5E      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECO57      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECO45      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECO24      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_SHISS      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_SHIB3      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECO8A      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECO81      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTC_YERE8      RIAGVNEMTSTSSLGSTRIILQFDLSRDINGAARDVQAALNAAQSLLPSGMPNRPTYRKMPSDAPIMIMT
MDTB_SHIFL      QMSGLKQMSSQSSGGASVITLQFQLTLPLNVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECO7I      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_KLEP7      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPI-MT
MDTB_KLEP3      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPI-MT
MDTC_PECCP      RIAGVSEMTSTSSLGSTRVILVFNLDRDINGAARDVQAAINAAQNLLPSGMSSRPTYRKNPSDAPVMILT
MDTB_ENT38      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPI-MT
NOLG_RHIME      TIGGIDTITSESYEGRSIVVVQFEVDVDSQDAAQEVRDRVARLETKFPDGVATPQVTRYKPEGQAILSVA
Y895_HAEIN      QADNIDYMXXXXXXXXXXXXXKMKLNTDPAGALADVLAKVNAVKSALPNGIE-DPXXXXXXXXXXIMYIS
MDTB_ECOLI      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECOLC      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECODH      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECOBW      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECO27      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ESCF3      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECOLU      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_CITK8      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTB_ECOHS      QMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPPIMTL
MDTC_ENT38      RIAGVNEMTSSSSLGSTRIILEFNFNRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTB_SALAR      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTB_SERP5      QMSGLKQMASQSSGGASVVTLQFQLELPLDVAEQEVQAAINSATNLLPSDLPYPPIYSKVNPADP-PILT
MDTC_ERWCT      RIAGVSEMTSTSSLGSTRVILVFNLDRDINGAARDVQAAINAAQNLLPSGMSSRPTYRKNPSDAPVMILT
MDTC_ENTS8      RIAGVNEMTSTSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTB_ENTS8      QMSGLKQMASQSAGGASVVTLQFQLTLPLDVAEQEVQAAINAATXXXXXXXXXXXVYSKVNPADPPI-MT
MDTC_SALCH      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_SALPC      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_SERP5      RIAGVNEMTSMSSLGSTRVILQFDLDRDINGAARDVQAAINAAQSLLPTMPSRPSYRKVNPSDAPIMILT
MDTC_KLEP7      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECO81      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECOL5      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECOL6      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_CITK8      RIAGVXXXXXXXXXXXTRIILQFNFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_KLEP3      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECOUT      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECO27      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTB_SALPC      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTC_ECO55      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECOK1      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECO45      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTB_SALTI      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTB_SALPB      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTC_ECOSM      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTB_SALHS      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTB_SALA4      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTC_ECOSE      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECO8A      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTB_SALSV      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTB_SALEP      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTB_SALDC      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTC_ECO5E      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECO57      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTB_SALPK      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTB_SALPA      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTB_SALNS      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTC_ESCF3      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECOLI      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECODH      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECOBW      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECO24      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_SHIBS      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECOLU      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTB_SALCH      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTB_SALTY      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPPI-MT
MDTC_SHISS      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECOLC      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_ECO7I      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTB_SALG2      QMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINADTNLLPSDLPNPPIYSKVNPADPPI-MT
MDTC_PHOLL      RIAGVNEMTSSSSLGSTNITLEFDLNRDINSAARDVQAALNAAQSLLPSMPSRPHYYKVNPTDAPIMILT
MDTB_ERWCT      QMSGLKQMSTQSAGGASVITLQFQLELSLDVAEQDVQAAINAASNLLPNDLPYPPTYSKVNPADPPI-MT
MDTC_SHIB3      RIVGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTB_PHOLL      QMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEVQAAINAASNLLPNDLPYPPIYSKVNPADPPILML
MDTC_ECOHS      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_SALPA      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_SALPK      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_ERWT9      RIAGVXXXXXXXXXXXTHVILLFDFDRDINGAARDVQGAINAAQSLLPSMPNRPSYRKVNPSDAPIMIMT
MDTC_SHIFL      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_SHIF8      RIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_SALTI      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_SALNS      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
MDTC_SALA4      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_SALPB      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_SALTY      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_SALEP      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_SALSV      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_SALHS      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRRNPSDAPIMILT
MDTC_SALG2      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_SALDC      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSRPTYRKNPSDAPIMILT
MDTC_SALAR      RIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSRPTYRKNPSDAPIMILT
HELA_LEGPN      GLPSLDYTRSLSRYGLSQVTVVFKDGTNIYFARQLINERLQEVKDKLPPGVETTLGPISTGLGEIFMYTV
CZCA_ALCSC      GLPGLEQTRSLSRYGLSQVTVIFKDGTDVYFARQLVNQRIQEAKDNLPEGVVPAMGPISTGLGEIYLWTV
CZCA_RALME      GLPGLEQTRSLSRYGLSQVTVIFKDGTDVYFARQLVNQRIQEAKDNLPEGVVPAMGPISTGLGEIYLWTV
CNRA_RALME      GLNGVESTRSMSRNGFSQVTVIFKESANLYFMRQQVSERLAQARPNLPENVEPQMGPVSTGLGEVFHYSS
CUSA_ECOLI      SVPGAKTVRGFSQFGDSYVYVIFEDGTDPYWARSRVLEYLNQVQGKLPAGVS-AELGPDATGVGWIYEYA
CUSA_ECOL6      SVPGAKTVRGFSQFGDSYVYVIFEDGTDPYWARSRVLEYLNQVQGKLPAGVS-AELGPDATGVGWIYEYA
SILA_SALTY      SVPGAKTVRGFSQFGDSYVYVIFEDGTDLYWARSRVLEYLNQVQGKLPAGVS-SEIGPDATGVGWIFEYA
CUSA_ECO57      SVPGAKTVRGFSQFGDSYVYVIFEDGTDPYWARSRVLEYLNQVQGKLPAGVS-AELGPDATGVGWIYEYA
SWRC_BACSU      NLDGVSVVTSTSYENASSVMIEYDYEKDMDKAKTEAAEALENVN--LPDDAKDPEISRYSLNSFPILTLS
NCCA_ALCXX      GLNGVENMRSLSRNGFSQVTVIFKESSNLYFMRQQVTERLAQARPNLPAGVEPQMGPVSTGLGEVFHYSS
YCBL_BACUN      ----------------------------------------------------------------------
SECD_HELPY      ----------------------------------------------------------------------
SECD_HELPJ      ----------------------------------------------------------------------
NPC1_PIG        ----------------------------------------------------------------------
NPCL1_MOUSE     ----------------------------------------------------------------------
NPC1_MOUSE      ----------------------------------------------------------------------
NPCL1_RAT       ----------------------------------------------------------------------
NPC1_HUMAN      ----------------------------------------------------------------------
NPC1_CAEEL      ----------------------------------------------------------------------
MMPLC_MYCTU     ----------------------------------------------------------------------
SECD_TREPA      ----------------------------------------------------------------------
SECD_SYNY3      ----------------------------------------------------------------------
DISP_DROME      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LISKTGTMSETALADYAAGTVLPMLRRLPGIGKVEAYSAEYALRVWFNPDQLNAYGLTTADVEAAIRARN
ACRD_ECOLI      FVSTDGSMDKQDIADYVASNIQDPLSRVNGVGDIDAYGSQYSMRIWLDPAKLNSFQMTAKDVTDAIESQN
MEXB_PSEAE      VVSTDGSMTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGSQYSMRIWLDPAKLNSYQLTPGDVSSAIQAQN
ACRB_ECOLI      VINTDGTMTQEDISDYVAANMKDAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQN
ACRF_ECOLI      FVSDNPGTTQDDISDYVASNVKDTLSRLNGVGDVQLFGAQYAMRIWLDADLLNKYKLTPVDVINQLKVQN
MDTF_ECOL6      FISDNGSLNQYDIADYVASNIKDPLSRTAGVGSVQLFGSEYAMRIWLDPQKLNKYNLVPSDVISQIKVQN
MDTF_ECO57      FISDNGSLNQYDIADYVASNIKDPLSRTAGVGSVQLFGSEYAMRIWLDPQKLNKYNLVPSDVISQIKVQN
MDTF_ECOLI      FISDNGSLNQYDIADYVASNIKDPLSRTAGVGSVQLFGSEYAMRIWLDPQKLNKYNLVPSDVISQIKVQN
TTGB_PSEPU      LVSEDGSMTKDDLANYIVSNMQDPISRTAGVGDFQVFGAQYAMRIWLDPAKLNKFQLTPVDVKTAVAAQN
TTGB_PSEPK      LVSEDGSMTKDDLANYIVSNMQDPISRTAGVGDFQVFGAQYAMRIWLDPAKLNKFQLTPVDVKTAVAAQN
MEPB_PSEPU      LVSEDGSMTKDDLANYIVSNMQDPISRTAGVGDFQVFGAQYAMRIWLDPAKLNKFQLTPVDVKTAVAAQN
ARPB_PSEPU      LVSEDGSMTKDDLANYIVSNMQDPISRTAGVGDFQVFGAQYAMRIWLDPAKLNKFQLTPVDVKTAVAAQN
SRPB_PSEPU      LVDRSGKLDNFDLGNLIASQLQDPISRIPGVGDFQLFGSPYAMRIWLDPGKLNSYQLTPTDVASAIREQN
TTGH_PSEPU      LVDRSGKLDNFDLGNLIASQLQDPISRIPGVGDFQLFGSPYAMRIWLDPGKLNSYQLTPTDVASAIREQN
SEPB_PSEP1      LVDKTGKMTNFDLGNLIASQLQDPISRINGVGDFLLFGSPYAMRIWLDPGKLNSYQLTPGDVAQAIREQN
TTGE_PSEPU      LVDKTGKMTNFDLGNLIASQLQDPISRINGVGDFLLFGSPYAMRIWLDPGKLNSYQLTPGDVAQAIREQN
MDTC_YERPY      LTSDT--FSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLAVRVELNPSALFNQGVSLDAVRQAISAAN
MDTC_YERPS      LTSDT--FSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLAVRVELNPSALFNQGVSLDAVRQAISAAN
MDTC_YERPB      LTSDT--FSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLAVRVELNPSALFNQGVSLDAVRQAISAAN
MDTC_YERP3      LTSDT--FSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLAVRVELNPSALFNQGVSLDAVRQAISAAN
MDTC_YERPN      LTSDT--FSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLAVRVELNPSALFNQGVSLDAVRQAISAAN
MDTC_YERPG      LTSDT--FSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLAVRVELNPSALFNQGVSLDAVRQAISAAN
MDTC_YERPE      LTSDT--FSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLAVRVELNPSALFNQGVSLDAVRQAISAAN
MDTC_YERPA      LTSDT--FSQGQLYDYASTKLAQKIAQTEGVSDVTVGGSSLAVRVELNPSALFNQGVSLDAVRQAISAAN
MDTB_YERPS      AVTATA-IPMTQVEDMVETRIAQKISQXXXXXXXXXXXXQRAVRVKLNAPAVAALGLDSETIRTAISNAN
MDTB_YERPE      AVTATA-IPMTQVEDMVETRIAQKISQXXXXXXXXXXXXQRAVRVKLNAPAVAALGLDSETIRTAISNAN
MDTB_SHIBS      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECOSE      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECO55      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECOL5      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSESVRTAITGAN
MDTB_ECOUT      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECOSM      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECOL6      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECOK1      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECO5E      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECO57      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECO45      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECO24      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_SHISS      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_SHIB3      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECO8A      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECO81      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTC_YERE8      LTSDT--FSQGQLYDFASTQLAQKIAQTEXXXXXXXXXXXLAVRVELNPSALFNQGVSLDAVRQAISAAN
MDTB_SHIFL      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECO7I      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_KLEP7      LAVTSSAIPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAIAALGLTSETVRTAITSAN
MDTB_KLEP3      LAVTSSAIPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAIAALGLTSETVRTAITSAN
MDTC_PECCP      LTSDT--YSQGQLYDFASTQLSQKISQMEGVGDVSIGGSSLAVRVALNPVALFNQGISLDEVRQAIAQAN
MDTB_ENT38      LAVTSSAMPMTQVEDMVETRVAQKIXXXXXXXXXXXXXXXRAVRVKLNAQAIAALGLTSETIRTAIVSAN
NOLG_RHIME      VSSTSRTLPE--ITTLATRVINNRLSVISGVGQVSLISSERQVLVVVDPDRLGAYGLAVSTVIEAIRGEN
Y895_HAEIN      FRSKK--LDSSQVTDYINRVVKPQFFTIEGVAEVQVFAAEYALRIWLDPQKMAAQNLSVPTVMSALSANN
MDTB_ECOLI      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECOLC      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECODH      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECOBW      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECO27      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ESCF3      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_ECOLU      AVTSTA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_CITK8      AVTSTA-MPMTQVEDMVETRVAQKIXXXXXXXXXXXXXXXRAVRVKLNAQAIAALGLTSETVRAAITSAN
MDTB_ECOHS      AVTSIA-MPMTQVEDMVETRVAQKISQISGVGLVTLSGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTC_ENT38      LTSDTYSQGE--LYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPEALFNQGVSLDDVRSAISNAN
MDTB_SALAR      LAVTSNAVPMTQVEGMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAIAALGLTSETIRTAITGAN
MDTB_SERP5      LAVTSSAMPMTQVEDMVETRVAQKISQVTGVGLVTISGGQRAVRVKLNAAAVAAYGLDSETIRTAISNAN
MDTC_ERWCT      LTSDT--YSQGQLYDFASTQLSQKISQMEGVGDVSIGGSSLAVRVALNPVALFNQGISLDEVRQAIAQAN
MDTC_ENTS8      LTSDTFSQGE--LYDYASTQLAQTIAQIXXXXXXXXXXSSLAVRVALNPQALFNQGVSLDTVRSAIS--N
MDTB_ENTS8      LAVTSSALPMTQVEDMVETRVAQRISQXXXXXXXXXXXXQRAVRVKLNAQALASLGIDSETVRTAITSAN
MDTC_SALCH      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALPC      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SERP5      LTSDT--YSQGQLYDFASTQLAQKIAQTEXXXXXXXXXXXLAVRVELNPSALFNQGISLDAVRQTIS--N
MDTC_KLEP7      LTSDTYSQGE--LYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVDLNPQALFNQGVSLDAVRTAISDAN
MDTC_ECO81      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_ECOL5      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_ECOL6      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_CITK8      LTSDTWSQGE--LYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRSAISNAN
MDTC_KLEP3      LTSDTYSQGE--LYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVDLNPQALFNQGVSLDAVRTAISDAN
MDTC_ECOUT      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_ECO27      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTB_SALPC      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAVAALGLTSETVRTAITGAN
MDTC_ECO55      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_ECOK1      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_ECO45      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTB_SALTI      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_SALPB      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTC_ECOSM      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTB_SALHS      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAVAALGLTSETVRTAITGAN
MDTB_SALA4      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAVAALGLTSETVRTAITGAN
MDTC_ECOSE      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_ECO8A      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTB_SALSV      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAVAALGLTSETVRTAITGAN
MDTB_SALEP      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_SALDC      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTC_ECO5E      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_ECO57      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTB_SALPK      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAIRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_SALPA      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAIRVKLNAQAIAALGLTSETVRTAITGAN
MDTB_SALNS      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAVAALGLTSETIRTAITGAN
MDTC_ESCF3      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_ECOLI      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAVSNAN
MDTC_ECODH      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAVSNAN
MDTC_ECOBW      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAVSNAN
MDTC_ECO24      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_SHIBS      LTSDT--YSQGKLYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_ECOLU      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTB_SALCH      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAVAALGLTSETVRTAITGAN
MDTB_SALTY      LAVTSNSMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAVAALGLTSETVRTAITGAN
MDTC_SHISS      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTC_ECOLC      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAVSNAN
MDTC_ECO7I      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTB_SALG2      LAVTSNAMPMTQVEDMVETRVAQKISQVSGVGLVTLAGGQRAVRVKLNAQAIAALGLTSETVRTAITGAN
MDTC_PHOLL      LTSDTYNQGQ--LYDFASTQLAQKIAQXXXXXXXXXXXXXLAVRVELNPGVLFHQGVSLDAVRKAIS--N
MDTB_ERWCT      LAVTSSAMSMTQVQDMVDNRIAQKISQXXXXXXXXXXXXQRAVRVRLNAPALAAYGLTSETIRTAITAAN
MDTC_SHIB3      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAISNAN
MDTB_PHOLL      AVT-SDAMPMTQIQDMVETRIAQKISQVNGVGLVTLAGGQRAVRVKLNAQAVAAQGLDSETIRTAINNAN
MDTC_ECOHS      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDDVRTAVSNAN
MDTC_SALPA      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALPK      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_ERWT9      LTSDT--YSPGQLYDYASTKLAQRLAQIXXXXXXXXXXSSLAVRVDLNPQALFNQGVSLDAVRSTIANAN
MDTC_SHIFL      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLTPQALFNQGVSLDDVRTAISNAN
MDTC_SHIF8      LTSDTYSQGE--LYDFASTQLAPTISQIXXXXXXXXXXSSLAVRVGLTPQALFNQGVSLDDVRTAISNAN
MDTC_SALTI      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALNS      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALA4      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALPB      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALTY      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALEP      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALSV      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALHS      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALG2      LTSES--WSQGKLYDFASTQLAQTIAQXXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALDC      LTSES--WSQGKLYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRVGLNPQALFNQGVSLDEVREAIDSAN
MDTC_SALAR      LTSDSWSQGE--LYDFASTQLAQTIAQIXXXXXXXXXXSSLAVRIGLNPQALFNQGVSLDEVRKAIDSAN
HELA_LEGPN      TNKPNVPISQTELRTIQDWIIKPQLRNVEGVAEVNTIGGEKQFHITPDPSKLVRYRLSLNDVVEALERNN
CZCA_ALCSC      EAEEGARKADTDLREIQDWVVRPQLRNVPGVTEINGFNKQYLVAP--SLERLASYGLTLTDVVNALNKNN
CZCA_RALME      EAEEGARKADTDLREIQDWVVRPQLRNVPGVTEINGFNKQYLVAP--SLERLASYGLTLTDVVNALNKNN
CNRA_RALME      FLTERGERLDDRVSRLAYWIIRPQLRTTPGVADVDSLGG-YVKQFVVEPDKMAAYGVSYADLARALEDTN
CUSA_ECOLI      LVDRSGKHDLADLRSLQDWFLKYELKTIPDVAEVASVGGEY--QVVIDPQRLAQYGISLAEVKSALDASN
CUSA_ECOL6      LVDRSGKHDLADLRSLQDWFLKYELKTIPDVAEVASVGGEY--QVVIDPQRLAQYGISLAEVKSALDASN
SILA_SALTY      LVDRSGKHDLSELRSLQDWFLKFELKTIPNVAEVASVGGQYQIQV--NPVKLSQYGISLPEVKQALESSN
CUSA_ECO57      LVDRSGKHDLADLRSLQDWFLKYELKTIPDVAEVASVGGEY--QVVIDPQRLAQYGISLAEVKSALDASN
SWRC_BACSU      VSSDKDNLQE------------------------------------------------------------
NCCA_ALCXX      FLTERGERLTDRVSKLAYWIIRPQLRTTAGVADVDSLGG-YVKQFVVEPDKMAAYGISFEELAQALEDAN
YCBL_BACUN      ----------------------------------------------------------------------
SECD_HELPY      ----------------------------------------------------------------------
SECD_HELPJ      ----------------------------------------------------------------------
NPC1_PIG        ----------------------------------------------------------------------
NPCL1_MOUSE     ----------------------------------------------------------------------
NPC1_MOUSE      ----------------------------------------------------------------------
NPCL1_RAT       ----------------------------------------------------------------------
NPC1_HUMAN      ----------------------------------------------------------------------
NPC1_CAEEL      ----------------------------------------------------------------------
MMPLC_MYCTU     ----------------------------------------------------------------------
SECD_TREPA      ----------------------------------------------------------------------
SECD_SYNY3      ----------------------------------------------------------------------
DISP_DROME      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GSVTPGQLGGAPSKPGQSYQAVVRPPAPLADPEAFGRIVLRSAADGSAVLLRDVARVEMAAADYRYSSTL
ACRD_ECOLI      AQIAVGQLGGTPSVDKQALNATINAQSLLQTPEQFRDITLRVNQDGSEVRLGDVATVEMGAEKYDYLSRF
MEXB_PSEAE      VQISSGQLGGLPAVKGQQLNATIIGKTRLQTAEQFENILLKVNPDGSQVRLKDVADVGLGGQDYSINAQF
ACRB_ECOLI      AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
ACRF_ECOLI      DQIAAGQLGGTPALPGQQLNASIIAQTRFKNPEEFGKVTLRVNSDGSVVRLKDVARVELGGENYNVIARI
MDTF_ECOL6      NQISGGQLGGMPQAADQQLNASIIVQTRLQTPEEFGKILLKVQQDGSQVLLRDVARVELGAEDYSTVARY
MDTF_ECO57      NQISGGQLGGMPQAADQQLNASIIVQTRLQTPEEFGKILLKVQQDGSQVLLRDVARVELGAEDYSTVARY
MDTF_ECOLI      NQISGGQLGGMPQAADQQLNASIIVQTRLQTPEEFGKILLKVQQDGSQVLLRDVARVELGAEDYSTVARY
TTGB_PSEPU      VQVSSGQLGGLPALPGTQLNATIIGKTRLQTAEQFESILLKVNKDGSQVRLGDVAQVGLGGENYAVSAQF
TTGB_PSEPK      VQVSSGQLGGLPALPGTQLNATIIGKTRLQTAEQFESILLKVNKDGSQVRLGDVAQVGLGGENYAVSAQF
MEPB_PSEPU      VQVSSGQLGGLPALPGTQLNATIIGKTRLQTAEQFESILLKVNKDGSQVRLGDVAQVGLGGENYAVSAQF
ARPB_PSEPU      VQVSSGQLGGLPALPGTQLNATIIGKTRLQTAEQFESILLKVNKDGSQVRLGDVAQVGLGGENYAVSAQF
SRPB_PSEPU      VQVSSGQLGGLPTRSGVQLNATVLGKTRMTTPSQFDEILVKVNPDGSQVRVKDVGRAELGADSFAISAQY
TTGH_PSEPU      VQVSSGQLGGLPTRSGVQLNATVLGKTRMTTPSQFDEILVKVNPDGSQVRVKDVGRAELGADSFAISAQY
SEPB_PSEP1      VQVSSGQLGGLPTRSGVQLNATVVGKTRMTTPAEFEEILVKVKADGSQVRVKDLGRVVLASENFAISAKY
TTGE_PSEPU      VQVSSGQLGGLPTRSGVQLNATVVGKTRMTTPAEFEEILVKVKADGSQVRVKDLDRVVLASENFAISAKY
MDTC_YERPY      VRRPQGSVDAAETH----WQ--VQANDEIKTAEGYRPLIVHYN-NGSPVRLQDVANVIDSVQDVRNAGMS
MDTC_YERPS      VRRPQGSVDAAETH----WQ--VQANDEIKTAEGYRPLIVHYN-NGSPVRLQDVANVIDSVQDVRNAGMS
MDTC_YERPB      VRRPQGSVDAAETH----WQ--VQANDEIKTAEGYRPLIVHYN-NGSPVRLQDVANVIDSVQDVRNAGMS
MDTC_YERP3      VRRPQGSVDAAETH----WQ--VQANDEIKTAEGYRPLIVHYN-NGSPVRLQDVANVIDSVQDVRNAGMS
MDTC_YERPN      VRRPQGSVDAAETH----WQ--VQANDEIKTAEGYRPLIVHYN-NGSPVRLQDVANVIDSVQDVRNAGMS
MDTC_YERPG      VRRPQGSVDAAETH----WQ--VQANDEIKTAEGYRPLIVHYN-NGSPVRLQDVANVIDSVQDVRNAGMS
MDTC_YERPE      VRRPQGSVDAAETH----WQ--VQANDEIKTAEGYRPLIVHYN-NGSPVRLQDVANVIDSVQDVRNAGMS
MDTC_YERPA      VRRPQGSVDAAETH----WQ--VQANDEIKTAEGYRPLIVHYN-NGSPVRLQDVANVIDSVQDVRNAGMS
MDTB_YERPS      VNSAKGSLDG----PTRSVTLSANDQMKSAEEY---RDLIIAYQNGAPIRLQDVATIEQGAENNKLAAWA
MDTB_YERPE      VNSAKGSLDG----PTRSVTLSANDQMKSAEEY---RDLIIAYQNGAPIRLQDVATIEQGAENNKLAAWA
MDTB_SHIBS      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECOSE      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECO55      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECOL5      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECOUT      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECOSM      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECOL6      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECOK1      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECO5E      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECO57      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECO45      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECO24      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_SHISS      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_SHIB3      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECO8A      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECO81      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTC_YERE8      VRRPQGSIDSSE----QHWQ--VQANDEIKTAEGYRPLIIHYN-NGSPVRLQDVANIVDSVQDVRNAGMS
MDTB_SHIFL      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECO7I      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNSAPIRLGDVATVEQGAENSWLGAWA
MDTB_KLEP7      VNSAKGSLDG----PARA--VTLSANDQMQSAEDYRRLII-AYQNGAPIRLGDVASVEQGAENSWLGAWA
MDTB_KLEP3      VNSAKGSLDG----PARA--VTLSANDQMQSAEDYRRLII-AYQNGAPIRLGDVASVEQGAENSWLGAWA
MDTC_PECCP      VRQPLGNVENSQ----KSWQIKTNDELKTAD--AYAPLIIHYN-NGAAVRLSDVATVEDSVQNSRNAGMA
MDTB_ENT38      VNSAKGSLDG----PTRAVTLSANDQMQSADEY---RQLIVAYQNGAPIRLGDVATVEQGAENRWLGAWA
NOLG_RHIME      QDRAAGTLISGIN------QRIVTVEGRIANTSGFNRIIV-AQRNGYPVYLSEVATILDTGAEVTSLANY
Y895_HAEIN      VQTAAGNDNGYYVSYRNKVETTTK------SVEQLSNLIISSNGD-DLVRLRDIATVELNKENDNSRATA
MDTB_ECOLI      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECOLC      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECODH      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECOBW      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECO27      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ESCF3      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_ECOLU      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTB_CITK8      VNSAKGSLDG----PTRAVTLSANDQMQSVDEY---RQLIIAWQNGAPVRLGDVATVEQGAENSWLGAWA
MDTB_ECOHS      VNSAKGSLDG-PSRA-----VTLSANDQMQSAEEYRQLII-AYQNGAPIRLGDVATVEQGAENSWLGAWA
MDTC_ENT38      VRKPQGAIEDS------SHRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLSDVASVTDSVQDVRNAGMT
MDTB_SALAR      VNSAKGSLDG----PERAVTLSANDQMQSADE--YRRLII-AYKNGAPVRLGDVATVEQGAENSWLGAWA
MDTB_SERP5      VNSAKGSLDG----PTRSVTLSANDQMKSADDY---RQLIVAYQNGAAIRLQDIATIEQGAENTRLAAWA
MDTC_ERWCT      VRQPLGNVENSQKR----WQIQTNDELKTAD--AYAPLIIHYS-NGAAVRLSDVATVEDSVQNSRNAGMA
MDTC_ENTS8      ANVRRPQ--GAIEDAQRRWQLQTNDELKTA---AEYEPLIVHYNNGAAVHLRDVATVTDSVQDVRNAGMT
MDTB_ENTS8      VNSAKGSFDG----PERAVTLSANDQMKSADEY---RNLIIAYKNGAPVRLGDVATVEQGAENAWLGAWA
MDTC_SALCH      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALPC      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SERP5      ANVRRPQ--GSVENQQQRWQ--IQANDELKTAEVYRPLIIHYN-NGSAVRLSDVAEVNDSVQDVRNAGMT
MDTC_KLEP7      VRKPQGALEDS------AHRWQVQTNDELKTAADYQPLIVHYQ-NGAAVRLGDVATVSDSVQDVRNAGMT
MDTC_ECO81      VRKPQGAL------EDDTHRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECOL5      VRKPQGAL------EDDTHRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECOL6      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_CITK8      VRKPQGAIDD------KTHRWQVQTNDELKTATEYQPLIIHYN-NGAAVRLGDVATVTDSVQDVRNAGMT
MDTC_KLEP3      VRKPQGALEDS------AHRWQVQTNDELKTAADYQPLIVHYQ-NGAAVRLGDVATVSDSVQDVRNAGMT
MDTC_ECOUT      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECO27      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTB_SALPC      VNSAKGSLDG----PERAVTLSANDQMQSADE--YRRLII-AYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTC_ECO55      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECOK1      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECO45      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTB_SALTI      VNSAKGSLDG----PERAVTLSANDQMQSADEY---RKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTB_SALPB      VNSAKGSLDG----PERAVTLSANDQMQSADE--YRRLII-AYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTC_ECOSM      VRKPQGVLEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTB_SALHS      VNSAKGSLDG----PERAVTLSANDQMQSADE--YRRLII-AYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTB_SALA4      VNSAKGSLDG----PERAVTLSANDQMQSADE--YRRLII-AYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTC_ECOSE      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECO8A      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTB_SALSV      VNSAKGSLDG----PERAVTLSANDQMQSADD--YRRLII-AYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTB_SALEP      VNSAKGSLDG----PERAVTLSANDQMQSADEY---RKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTB_SALDC      VNSAKGSLDG----PERAVTLSANDQMQSADEY---RKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTC_ECO5E      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECO57      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTB_SALPK      VNSAKGSLDG----PERAVTLSANDQMQSADEY---RKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTB_SALPA      VNSAKGSLDG----PERAVTLSANDQMQSADEY---RKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTB_SALNS      VNSAKGSLDG----PERAVTLSANDQMQSADEY---RKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTC_ESCF3      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECOLI      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECODH      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECOBW      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECO24      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_SHIBS      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECOLU      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTB_SALCH      VNSAKGSLDG----PERAVTLSANDQMQSADE--YRRLII-AYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTB_SALTY      VNSAKGSLDG----PERAVTLSANDQMQSADE--YRRLII-AYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTC_SHISS      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECOLC      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_ECO7I      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTB_SALG2      VNSAKGSLDG----PERAVTLSANDQMQSADEY---RKLIIAYQNGAPVRLGDVATVEQGAENSWLGAWA
MDTC_PHOLL      ANVRRPQ--GYVDSEQQHWQIQMNDELKTAENY---RPIIVHYNNNSPVRLQDVANVKDSVQNVRAAGMS
MDTB_ERWCT      VNSAKGSLDG----PTRSVTLSANDQMKSVDDY---RKLIVAWKNGAPVRLQDVATIEQAAENIYLGAWA
MDTC_SHIB3      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTB_PHOLL      VNSAKGSLDG----PTRSVTLSANDQMKSVNDY---RNLIIAYKNGSPVRLQDVATIEQGAENTKLGAWS
MDTC_ECOHS      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_SALPA      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALPK      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_ERWT9      GAIEDSQLRWWIKTNDELHTAAEYRPLVI------------HYRNGAAVRLQDVATVTDSVQDVRNAGMS
MDTC_SHIFL      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_SHIF8      VRKPQGALEDG------THRWQIQTNDELKTAAEYQPLIIHYN-NGGAVRLGDVATVTDSVQDVRNAGMT
MDTC_SALTI      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALNS      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALA4      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALPB      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALTY      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALEP      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALSV      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALHS      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALG2      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALDC      VRRPQGAIEDSV------HRWQIQTNDELKTAAEYQPLIIHYN-NGAAVRLGDVASVTDSVQDVRNAGMT
MDTC_SALAR      VRRPQGAI------EDNVHRWQIQTNDELKTAAEYQPLIIHYK-NGAAVRLDDVASVTDSVQDVRNAGMT
HELA_LEGPN      ANVGAGYI------ETNGEQNLIRVPGQVQNMADIENIVIASF-EGTPVRIRDVAEVALGKELRTGAATE
CZCA_ALCSC      DNVGAGYI----ERRGEQY--LVRAPGQVASEDDIRNIIV-GTAQGQPIRIRDIGDVEIGKELRTGAATE
CZCA_RALME      DNVGAGYI----ERRGEQY--LVRAPGQVASEDDIRNIIV-GTAQGQPIRIRDIGDVEIGKELRTGAATE
CNRA_RALME      LSVGANFI----RRSGESY--LVRADARIKSADEISRAVI-AQRQNVPITVGQVARVKIGGELRSGAASR
CUSA_ECOLI      ------QEAGGSSIELAEAEYMVRASGYLQTLDDFNHIVLKASENGVPVYLRDVAKVQIGPEMRRGIAEL
CUSA_ECOL6      ------QEAGGSSIELAEAEYMVRASGYLQTLDDFNHIVLKASENGVPVYLRDVAKVQVGPEMRRGIAEL
SILA_SALTY      ------QEAGGSSVEIAEAEYMVRASGYLQSIDDFNNIVLKTGENGVPVYLRDVARVQTGPEMRRGIAEL
CUSA_ECO57      ------QEAGGSSIELAEAEYMVRASGYLQTLDDFNHIVLKASENGVPVYLRDVAKIQVGPEMRRGIAEL
SWRC_BACSU      ------------------------------------------------VKLSDIATIKDVKKAESVSRT-
NCCA_ALCXX      LSVGANFI----RRSGESY--LVRADARIKSADEIARAVI-AQRQGVPITVGQVANINVGGELRSGAASR
YCBL_BACUN      ----------------------------------------------------------------------
SECD_HELPY      ----------------------------------------------------------------------
SECD_HELPJ      ----------------------------------------------------------------------
NPC1_PIG        ----------------------------------------------------------------------
NPCL1_MOUSE     ----------------------------------------------------------------------
NPC1_MOUSE      ----------------------------------------------------------------------
NPCL1_RAT       ----------------------------------------------------------------------
NPC1_HUMAN      ----------------------------------------------------------------------
NPC1_CAEEL      ----------------------------------------------------------------------
MMPLC_MYCTU     ----------------------------------------------------------------------
SECD_TREPA      ----------------------------------------------------------------------
SECD_SYNY3      ----------------------------------------------------------------------
DISP_DROME      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NGREAASMGLKLADGANVLATSRTVRDALDEAAKAFPAGVAYDISYDTAHFVQSSISRVLMTLAEATVLV
ACRD_ECOLI      NGKPASGLGVKLASGANEMATAELVLNRLDELAQYFPHGLEYKVAYETTSFVKASIEDVVKTLLEAIALV
MEXB_PSEAE      NGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEAILLV
ACRB_ECOLI      NGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEAIILV
ACRF_ECOLI      NGKPAAGLGIKLATGANALDTAKAIKAKLAELQPFFPQGMKVLYPYDTTPFVQLSIHEVVKTLFEAIMLV
MDTF_ECOL6      NGKPAAGIAIKLATGANALDTSRAVKEELNRLSAYFPASLKTVYPYDTTPFIKISIQEVFKTLVEAIILV
MDTF_ECO57      NGKPAAGIAIKLATGANALDTSRAVKEELNRLSAYFPASLKTVYPYDTTPFIEISIQEVFKTLVEAIILV
MDTF_ECOLI      NGKPXXXXXXXXXXXXXXXDTSRAVKEELNRLSAYFPASLKTVYPYDTTPFIEISIQEVFKTLVEAIILV
TTGB_PSEPU      NGKPASGLAVKLATGANALDTAKALRETIKGLEPFFPPGVKAVFPYDTTPVVTESISGVIHTLIEAXXXX
TTGB_PSEPK      NGKPASGLAVKLATGANALDTAKALRETIKGLEPFFPPGVKAVFPYDTTPVVTESISGVIHTLIEAXXXX
MEPB_PSEPU      NGKPASGLAVKLATGANALDTAKALRETIKGLEPFFPPGVKAVFPYDTTPVVTESISGVIHTLIEAXXXX
ARPB_PSEPU      NGKPASGLAVKLATGANALDTAKALRETIKGLEPFFPPGVKAVFPYDTTPVVTESISGVIHTLIEAXXXX
SRPB_PSEPU      KDSPTASLALRLSTGGNLLETVDAVKKLMEQQKAYLPDGVEVIYPYDTTPVVEASIESVVHTIFEAXXXX
TTGH_PSEPU      KDSPTASLALRLSTGGNLLETVDAVKKLMEQQKAYLPDGVEVIYPYDTTPVVEASIESVVHTIFEAXXXX
SEPB_PSEP1      RGQDXXXXXXXXXXXXXXXETVKAVKAELEKQKAYLPEGVEVIYPYDTSPVVEASIDSVVHTILEAXXXX
TTGE_PSEPU      RGQDSAXXXXXXXXXXXXXXTVKAVKAELEKQKAYLPEGVEVIYPYDTSPVVEASIDSVVHTILEAXXXX
MDTC_YERPY      AGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXXXXXX
MDTC_YERPS      AGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXXXXXX
MDTC_YERPB      AGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXXXXXX
MDTC_YERP3      AGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXXXXXX
MDTC_YERPN      AGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXXXXXX
MDTC_YERPG      AGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXXXXXX
MDTC_YERPE      AGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXXXXXX
MDTC_YERPA      AGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXXXXXX
MDTB_YERPS      NTQSAIVLNIQRQPGVNVIATADSIREMLPELIKSLPKSVDVKVLTDRTSTIRASVNDVQFEXXXXXXXX
MDTB_YERPE      NTQSAIVLNIQRQPGVNVIATADSIREMLPELIKSLPKSVDVKVLTDRTSTIRASVNDVQFEXXXXXXXX
MDTB_SHIBS      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECOSE      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECO55      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECOL5      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECOUT      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECOSM      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECOL6      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECOK1      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECO5E      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAITLV
MDTB_ECO57      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECO45      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECO24      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_SHISS      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_SHIB3      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVEVTVLSDRTTNIRASVDDTQCELMMAIALV
MDTB_ECO8A      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVNDTQFELMMAIALV
MDTB_ECO81      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTC_YERE8      DGKPAVLLVISREPGANIIATVDRIRAELPALRASIPASIELNIAQDRSPTIRASLDEVERSXXXXXXXX
MDTB_SHIFL      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECO7I      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_KLEP7      NQQRAIVMNVQRQPGANIIDTADSIRQMLPQLTESLPKSVKVQVLSDRTTNIRASVRDTQFELMLAIALV
MDTB_KLEP3      NQQRAIVMNVQRQPGANIIDTADSIRQMLPQLTESLPKSVKVQVLSDRTTNIRASVRDTQFELMLAIALV
MDTC_PECCP      NAKPAILVMIRRAPDANIITTVDNIRAAMPELRASLPAEIQLDVAQDRSPTIRASLAEVEQSXXXXXXXX
MDTB_ENT38      NKEQAIVMNVQRQPGANIIDTADSIRAMLPQLIESLPKSVNVKVLSDRTTNIRASVSDTQFELMLAMALV
NOLG_RHIME      QGQTTLGLHIVKVQGANTVEVASAVRREVSALAELTKDNVQLTITRDNSRPIASQVSQVQRTLVEGGVLS
Y895_HAEIN      NGAESVVLAINPTSTANPLTVAEKIRPLYESIKTQLPDSMESDILYDRTIAINSSIHEVIKTIGEATLIV
MDTB_ECOLI      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECOLC      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECODH      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECOBW      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ECO27      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTB_ESCF3      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVNDTQFELMMAIALV
MDTB_ECOLU      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVNDTQFELMMAIALV
MDTB_CITK8      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVNVTVLSDRTTNIRASVTDTQFELMLAIALV
MDTB_ECOHS      NKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMAIALV
MDTC_ENT38      NAKPAILLMIRKLPEANIIQTVNSIRARLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTB_SALAR      NKAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTB_SERP5      NKQPAIVLNIQRQPGVNVITTADSIREMLPQLIKSLPKSVDVKVLTDRTTTIRASVSDVQFEXXXXXXXX
MDTC_ERWCT      NSKPAILVMIRRAPDANIITTVDNIRAAMPELRASLPAEIQLDVAQDRSPTIRASLAEVEQSXXXXXXXX
MDTC_ENTS8      NAKPAILLMIRKLPEANIIETVDRIRAALPELRDTIPAAIDMQIAQDRSPTIRASLAEVEQSLAISXXXX
MDTB_ENTS8      NKQPAIVMNVQRQPGANIITTAETIQKLLPQLTESLPKSVQVKVLTDRTTNISASVNDTQFELMLAIALV
MDTC_SALCH      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETLAISVALV
MDTC_SALPC      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETLAISVALV
MDTC_SERP5      NAKPAIILTISRAPDANIIETVDRIRAELPTLQNNIPASIQLNIAQDRSPTIRASLAEVEQSXXXXXXXX
MDTC_KLEP7      NAKPAILLMIRKLPEANIIQTVDSIRARLPELQQTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECO81      NAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECOL5      NAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECOL6      NAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_CITK8      NAKPAILLMIRKLPEANIIQTVDSIREKLPELQTLIPASIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_KLEP3      NAKPAILLMIRKLPEANIIQTVDSIRARLPELQQTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECOUT      NAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECO27      NAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTB_SALPC      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRTSVRDTQFELMLAIALV
MDTC_ECO55      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECOK1      NAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECO45      NAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTB_SALTI      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTB_SALPB      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTC_ECOSM      NAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTB_SALHS      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTB_SALA4      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTC_ECOSE      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECO8A      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTB_SALSV      NQAPANVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTB_SALEP      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTB_SALDC      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTC_ECO5E      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECO57      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTB_SALPK      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTB_SALPA      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTB_SALNS      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTC_ESCF3      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECOLI      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECODH      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECOBW      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECO24      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_SHIBS      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECOLU      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTB_SALCH      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTB_SALTY      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTC_SHISS      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECOLC      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_ECO7I      NAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTB_SALG2      NQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLAIALV
MDTC_PHOLL      GGEPAILLIIRREAGANIIATVNRIREQLPALHESIPASIQLKVAQDRTPTIRASIVEVERXXXXXXXXX
MDTB_ERWCT      NRQQAIIINVQRQPGANVITTTDSINKMLPALKASLPNSVEVATLTDRTTSIRASVKDVQFEXXXXXXXX
MDTC_SHIB3      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTB_PHOLL      NNTQAIVINVQRQPGANVIETTDNIRQMLPELISSLPKSVDMKILTDRTTTIRASVKDVQFEXXXXXXXX
MDTC_ECOHS      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_SALPA      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_SALPK      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_ERWT9      NARPAVLLVIRKSPQANIIDTVDRIRGEVPELRNTLPASIGLDIAQDSSRTIRASLHEVEQXXXXXXXXX
MDTC_SHIFL      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_SHIF8      NAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXXXXXX
MDTC_SALTI      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_SALNS      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_SALA4      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_SALPB      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_SALTY      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_SALEP      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_SALSV      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_SALHS      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_SALG2      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_SALDC      NAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
MDTC_SALAR      NAKPAILLMIRKLPETNIIQTVDSIRAKLPELQAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXXXXXX
HELA_LEGPN      NSKEVVLGTVFILMGENSRTVSERVAAKMKDINKTLPEGVEAITVYNRTTLVNATINTVKNNLLEGALLV
CZCA_ALCSC      NGKEVVLGTVFMLIGENSRAVSKAVDEKVASINRTMPEGVKIVTVYDRTRLVDKAIATVKKNLLEGAXXX
CZCA_RALME      NGKEVVLGTVFMLIGENSRAVSKAVDEKVASINRTMPEGVKIVTVYDRTRLVDKAIATVKKNLLEGAXXX
CNRA_RALME      NGNETVVGSALMLVGANSRTVAQAVGDKLEQISKTLPPGVVIVPTLNRSQLVIATIETVAKNLIEGXXXX
CUSA_ECOLI      NGEEVAGGVVILRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSGKLLEEFIVV
CUSA_ECOL6      NGEEVAGGVVILRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSGKLLEEFIVV
SILA_SALTY      NGQEVAGGVVILRSGKNARDVITAVRDKLETLKASLPEGVEIVTTYDRSQLIDRAIDNLSSKLLEEFFVV
CUSA_ECO57      NGEVVGGVVI-LRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSGKLLEEFIVV
SWRC_BACSU      NGKDSIGINIVKANDANTVEVADDVKAELKKF-KEDHKGFNYSATLDMAEPITQSVDTMLSKXXXXXXXX
NCCA_ALCXX      NGYETVVGSALMLVGANSRTVAQAVGDKLEEIKKTLPPGVVIVPTLNRSQLVMATIKTVAKNLVEGXXXX
YCBL_BACUN      ----------------------------------------------------------------------
SECD_HELPY      ----------------------------------------------------KDSVKTSIIALVGGFILV
SECD_HELPJ      ----------------------------------------------------KDSIKTSIIALVGGFILV
NPC1_PIG        ---------------ARLIASNITRTMGLEASSRVFPYSVFY-VFYEQYLTV---IDDTIFNLGVSLGAI
NPCL1_MOUSE     ---------------ANITAELRKV-PGTDPNFEVFP----YTISNVFYQQYLTVLPEGIFTLALCFVPT
NPC1_MOUSE      ------------ADYTDAMKKARLIASNITETMRSFPYSVFYVFYEQYLTIIDDTIFNLSVSLGS----I
NPCL1_RAT       ---------------ANITADLRKV-PGTDPNFEVFP----YTISNVFYQQYLTVLPEGIFTLALCFVPT
NPC1_HUMAN      ---------------ARLIASNVTETMGINGSARVFPYSVFYVFYEQYLTIIDDTIFNLGVSLGA----I
NPC1_CAEEL      ---------IKAMDTARMV--SRRLERSIDDTAHVFAYSKIFPF-----YEQYSTIMPILTTQLFITVVV
MMPLC_MYCTU     -------------------------------------------------------------------VSV
SECD_TREPA      --------------------------------------------------------------------LC
SECD_SYNY3      ----------------------------------------------------------------------
DISP_DROME      ---------------------------------------------------VQDTLSHVAICLAMAASLA


                         .         .         .         .         *         .         .:420
query           FLILYLFLGNLRATLIPCIVVPVSLLGTVACLYAFGLSLNVITLFGVVLAIGILVDDAIVVVENVERIMR
ACRD_ECOLI      FLVMYLFLQNFRATLIPTIAVPVVLMGTFSVLYAFGYSVNTLTMFAMVLAIGLLVDDAIVVVENVERIMS
MEXB_PSEAE      FLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
ACRB_ECOLI      FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
ACRF_ECOLI      FLVMYLFLQNMRATLIPTIAVPVVLLGTFAILAAFGYSINTLTMFGMVLAIGLLVDDAIXXXXXXXXXXX
MDTF_ECOL6      FLVMYLFLQNFRXXXXXXXXXXXXXLGTFAILSAVGFTINTLTMFGMVLAIGLLVDDAIVVVENVERVIA
MDTF_ECO57      FLVMYLFLQNFRXXXXXXXXXXXXXLGTFAILSAVGFTINTLTMFGMVLAIGLLVDDAIVVVENVERVIA
MDTF_ECOLI      FLVMYLFLQNFRXXXXXXXXXXXXXLGTFAILSAVGFTINTLTMFGMVLAIGLLVDDAIVVVENVERVIA
TTGB_PSEPU      XXXXXXXXQNFRATIITTMTVPVVLLGTFGILAAAGFSINTLTMFAMVLAIGLLVDDAIVVVENVERVMS
TTGB_PSEPK      XXXXXXXXQNFRATIITTMTVPVVLLGTFGILAAAGFSINTLTMFAMVLAIGLLVDDAIVVVENVERVMS
MEPB_PSEPU      XXXXXXXXQNFRATIITTMTVPVVLLGTFGILAAAGFSINTLTMFAMVLAIGLLVDDAIVVVENVERVMS
ARPB_PSEPU      XXXXXXXXQNFRATIITTMTVPVVLLGTFGILAAAGFSINTLTMFAMVLAIGLLVDDAIVVVENVERVMS
SRPB_PSEPU      XXXXXXXXQSFRATLIPTLAVPVVLLATFALLPYFGLNINVLTMYAMVLAIGLLVDDAIVVVENVERLMH
TTGH_PSEPU      XXXXXXXXQSFRATLIPTLAVPVVLLATFALLPYFGLNINVLTMYAMVLAIGLLVDDAIVVVENVERLMH
SEPB_PSEP1      XXXXXXXXQSLRATIIXXXXXXXXXXXXXXXXXYFGISINVLTMYAMVLAIGLLVDDAIVVVENVERLMH
TTGE_PSEPU      XXXXXXXXQSLRATIIXXXXXXXXXXXXXXXXXYFGISINVLTMYAMVLAIGLLVDDAIVVVENVERLMH
MDTC_YERPY      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTC_YERPS      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTC_YERPB      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTC_YERP3      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTC_YERPN      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTC_YERPG      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTC_YERPE      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTC_YERPA      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTB_YERPS      XXXXXXFLRNAAATIIPSIAVPLSLVGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_YERPE      XXXXXXFLRNAAATIIPSIAVPLSLVGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_SHIBS      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECOSE      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECO55      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECOL5      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECOUT      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECOSM      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECOL6      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECOK1      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECO5E      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECO57      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECO45      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECO24      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_SHISS      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_SHIB3      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECO8A      VMIIYLFLRNIPATIIPGFAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECO81      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_YERE8      XXXXXXXXRSGRATLIPAVAVPVSLIGTFTAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTB_SHIFL      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECO7I      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_KLEP7      VMIIYLFLRNVPATIIPGVAVPLSLVGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_KLEP3      VMIIYLFLRNVPATIIPGVAVPLSLVGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_PECCP      XXXXXXXXRSGRATAIPALAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHI-
MDTB_ENT38      VMIIYVFLRNVPATIIPAVAVPLSLVGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
NOLG_RHIME      VLIVFIFLNSWRSTVITGLTLPISVIGTFAAIYALGFTLNIMTLMALSLSIGILIDDAIVVRENITRHL-
Y895_HAEIN      LVVILMFIGSFRXXXXXXXXXXXXXXGVLMLLQSFNFSINLMTXXXXXXXXXXXXDDAIVVLENIDRHIK
MDTB_ECOLI      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECOLC      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECODH      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECOBW      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECO27      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ESCF3      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECOLU      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_CITK8      VMIIYLFLRNVPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_ECOHS      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_ENT38      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTB_SALAR      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_SERP5      XXXXXXXXRNVPATIIPSVAVPLSLIGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_ERWCT      XXXXXXXXRSWRATAIPALAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHI-
MDTC_ENTS8      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVALENISRHL-
MDTB_ENTS8      VMIIYLFLRNIPATIIPAVAVPLSLVGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_SALCH      IMVVFLFLRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALPC      IMVVFLFLRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SERP5      XXXXXXXXRSGRATLIPAVAVPVSLIGSFTAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHI-
MDTC_KLEP7      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTC_ECO81      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECOL5      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECOL6      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_CITK8      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTC_KLEP3      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHL-
MDTC_ECOUT      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECO27      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTB_SALPC      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_ECO55      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECOK1      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECO45      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTB_SALTI      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_SALPB      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_ECOSM      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTB_SALHS      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_SALA4      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_ECOSE      XXXXXXXXRSGRATIIPAVVVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECO8A      XXXXXXXXRSGRATIIPAVVVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTB_SALSV      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_SALEP      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_SALDC      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_ECO5E      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECO57      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTB_SALPK      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_SALPA      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_SALNS      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_ESCF3      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECOLI      XXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECODH      XXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECOBW      XXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECO24      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SHIBS      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECOLU      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTB_SALCH      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTB_SALTY      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_SHISS      XXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECOLC      XXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ECO7I      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTB_SALG2      VMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_PHOLL      XXXXXXXXRSGRATLIPAIAVPVSLIGTFTAMYLCGFSLNNLSLMALTVATGFVVDDAIVVLENISRHL-
MDTB_ERWCT      XXXXXXFLRNAVATLIPSIAVPLSLVGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVVIENIARYI-
MDTC_SHIB3      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTB_PHOLL      XXXXXXFLRNGIATLIPSIAVPLSLIGTFAVMYFCGFSVNNLTLMALTIATGFVVDDAIVVIENISRYI-
MDTC_ECOHS      XXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALPA      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALPK      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_ERWT9      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTVATGFVVDDAIVVLENISRHV-
MDTC_SHIFL      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SHIF8      XXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALTI      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALNS      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALA4      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALPB      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALTY      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALEP      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALSV      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALHS      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALG2      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALDC      XXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENIARHL-
MDTC_SALAR      XXXXXXXXRSGRATLIPAVAVPVSLISTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENITRHL-
HELA_LEGPN      CVILFLFLGNIRAALITAMVIPLSMLLTITGMVENQISANLMSL--GALDFGLIVDGAVIIVENCIKHLA
CZCA_ALCSC      XXXXXXXXGNXXXXXXXXXXXXXXMLFTFTGMVNYKISANLMSL--GALDFGIIIDGAVVIVENCVRLTR
CZCA_RALME      XXXXXXXXGNXXXXXXXXXXXXXXMLFTFTGMVNYKISANLMSL--GALDFGIIIDGAVVIVENCVRLTR
CNRA_RALME      XXXXXXXXGNWRAATIAALVIPLSLLVSAIGMNQFHISGNLMSL--GALDFGLIIDGAVIIVENAERQHR
CUSA_ECOLI      AVVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGGIAIAVGAMVDAAIVMIENAHKRLE
CUSA_ECOL6      AVVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGGIAIAVGAMVDAAIVMIENAHKRLE
SILA_SALTY      AIVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGGIAIAVGAMVDAAIVMIENAHKRLE
CUSA_ECO57      AVVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGGIAIAVGAMVDAAIVMIENAHKRLE
SWRC_BACSU      XXXXXXXXRDIKSTXXXXXXXXXXXXXXXXXXXXXDITLNIMTLGAMTVAIGRVVDDSIVVIENIYRRMR
NCCA_ALCXX      XXXXXXXXGNWRAAVIAALVIPLSLLISAIGMNGLNISGNLMSL--GALDFGLIIDGAVIIVENSLRRLA
YCBL_BACUN      ----------------------------------------------------------------------
SECD_HELPY      FMVLYYSM----AGVIACLALVVNLFLIVAVMAIFGATLTLPGM