[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08055.1

[Show Plain Result]


## Summary of Sequence Search
    1::243
    1::190     3e-75  66%  195 aa  MSRA2_RHILO RecName: Full=Peptide methionine sulfoxide reductase
   36::208     4e-58  55%  214 aa  MSRA2_SYNY3 RecName: Full=Peptide methionine sulfoxide reductase
   13::181     3e-44  47%  190 aa  MSRA_POLSQ RecName: Full=Peptide methionine sulfoxide reductase
   33::206     2e-42  47%  206 aa  MSRA_DEIRA RecName: Full=Peptide methionine sulfoxide reductase
    2::171     2e-42  48%  174 aa  MSRA_HALWD RecName: Full=Peptide methionine sulfoxide reductase
    2::174     4e-42  47%  174 aa  MSRA_PASMU RecName: Full=Peptide methionine sulfoxide reductase
    3::173     5e-41  46%  177 aa  MSRA_TRIEI RecName: Full=Peptide methionine sulfoxide reductase
    2::173     3e-40  45%  178 aa  MSRA_NATPD RecName: Full=Peptide methionine sulfoxide reductase
    3::172     2e-39  41%  177 aa  MSRA_HALSA RecName: Full=Peptide methionine sulfoxide reductase
    3::172     2e-39  41%  177 aa  MSRA_HALS3 RecName: Full=Peptide methionine sulfoxide reductase
    4::148     3e-38  50%  158 aa  MSRA_METHJ RecName: Full=Peptide methionine sulfoxide reductase
    2::176     3e-38  45%  176 aa  MSRA_CHRVO RecName: Full=Peptide methionine sulfoxide reductase
    2::171     7e-38  46%  174 aa  MSRA_NITSB RecName: Full=Peptide methionine sulfoxide reductase
    4::148     7e-38  50%  156 aa  MSRA_ACIC5 RecName: Full=Peptide methionine sulfoxide reductase
    4::175     6e-37  42%  176 aa  MSRA_THET2 RecName: Full=Peptide methionine sulfoxide reductase
    3::170     6e-37  44%  177 aa  MSRA_PICTO RecName: Full=Peptide methionine sulfoxide reductase
    5::156     8e-37  49%  169 aa  MSRA_METTH RecName: Full=Peptide methionine sulfoxide reductase
   17::185     8e-37  45%  192 aa  MSRA1_RHOBA RecName: Full=Peptide methionine sulfoxide reductase
    4::175     1e-36  42%  176 aa  MSRA_THET8 RecName: Full=Peptide methionine sulfoxide reductase
    2::170     1e-36  45%  176 aa  MSRA_SULAC RecName: Full=Peptide methionine sulfoxide reductase
    2::170     1e-36  45%  177 aa  MSRA_SULSO RecName: Full=Peptide methionine sulfoxide reductase
    2::169     1e-36  47%  176 aa  MSRA_LEPBJ RecName: Full=Peptide methionine sulfoxide reductase
    2::173     7e-36  45%  173 aa  MSRA_ACIBY RecName: Full=Peptide methionine sulfoxide reductase
    2::173     7e-36  45%  173 aa  MSRA_ACIBT RecName: Full=Peptide methionine sulfoxide reductase
    2::173     7e-36  45%  173 aa  MSRA_ACIBC RecName: Full=Peptide methionine sulfoxide reductase
    2::173     7e-36  45%  173 aa  MSRA_ACIB5 RecName: Full=Peptide methionine sulfoxide reductase
    2::173     7e-36  45%  173 aa  MSRA_ACIB3 RecName: Full=Peptide methionine sulfoxide reductase
    3::152     9e-36  49%  172 aa  MSRA_LACSS RecName: Full=Peptide methionine sulfoxide reductase
  197::366     9e-36  44%  522 aa  MSRAB_NEIMB RecName: Full=Peptide methionine sulfoxide reductase
  197::366     9e-36  44%  522 aa  MSRAB_NEIMA RecName: Full=Peptide methionine sulfoxide reductase
    8::154     1e-35  48%  164 aa  MSRA_METMJ RecName: Full=Peptide methionine sulfoxide reductase
    2::169     2e-35  47%  176 aa  MSRA_LEPBL RecName: Full=Peptide methionine sulfoxide reductase
    4::165     2e-35  42%  185 aa  MSRA_GRABC RecName: Full=Peptide methionine sulfoxide reductase
    3::145     3e-35  49%  178 aa  MSRA_ERWT9 RecName: Full=Peptide methionine sulfoxide reductase
    2::173     3e-35  45%  174 aa  MSRA_ACIBS RecName: Full=Peptide methionine sulfoxide reductase
    2::157     4e-35  47%  163 aa  MSRA_VESOH RecName: Full=Peptide methionine sulfoxide reductase
  197::365     8e-35  43%  522 aa  MSRAB_NEIGO RecName: Full=Peptide methionine sulfoxide reductase
    6::157     1e-34  46%  163 aa  MSRA_RUTMC RecName: Full=Peptide methionine sulfoxide reductase
  128::275     1e-34  47%  291 aa  MSRAB_TREPA RecName: Full=Peptide methionine sulfoxide reductase
    2::148     2e-34  46%  153 aa  MSRA_METBU RecName: Full=Peptide methionine sulfoxide reductase
    4::154     4e-34  46%  162 aa  MSRA_GEOMG RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-34  49%  212 aa  MSRA_SALPB RecName: Full=Peptide methionine sulfoxide reductase
    4::152     5e-34  47%  171 aa  MSRA_LEUMM RecName: Full=Peptide methionine sulfoxide reductase
    5::152     3e-33  47%  169 aa  MSRA_STAAC RecName: Full=Peptide methionine sulfoxide reductase
    5::152     3e-33  47%  169 aa  MSRA1_STAAW RecName: Full=Peptide methionine sulfoxide reductase
    5::152     3e-33  47%  169 aa  MSRA1_STAAS RecName: Full=Peptide methionine sulfoxide reductase
    5::152     3e-33  47%  169 aa  MSRA1_STAAR RecName: Full=Peptide methionine sulfoxide reductase
    5::152     3e-33  47%  169 aa  MSRA1_STAAN RecName: Full=Peptide methionine sulfoxide reductase
    5::152     3e-33  47%  169 aa  MSRA1_STAAM RecName: Full=Peptide methionine sulfoxide reductase
    5::152     3e-33  47%  169 aa  MSRA1_STAA8 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     4e-33  48%  212 aa  MSRA_SALTY RecName: Full=Peptide methionine sulfoxide reductase
   44::195     4e-33  48%  212 aa  MSRA_SALSV RecName: Full=Peptide methionine sulfoxide reductase
   44::195     4e-33  48%  212 aa  MSRA_SALNS RecName: Full=Peptide methionine sulfoxide reductase
    2::173     5e-33  40%  175 aa  MSRA_CLAM3 RecName: Full=Peptide methionine sulfoxide reductase
   47::197     7e-33  50%  219 aa  MSRA_RHOCS RecName: Full=Peptide methionine sulfoxide reductase
   44::195     1e-32  48%  212 aa  MSRA_SALTI RecName: Full=Peptide methionine sulfoxide reductase
   44::195     1e-32  48%  212 aa  MSRA_SALPK RecName: Full=Peptide methionine sulfoxide reductase
   44::195     1e-32  48%  212 aa  MSRA_SALPC RecName: Full=Peptide methionine sulfoxide reductase
   44::195     1e-32  48%  212 aa  MSRA_SALPA RecName: Full=Peptide methionine sulfoxide reductase
   44::195     1e-32  48%  212 aa  MSRA_SALHS RecName: Full=Peptide methionine sulfoxide reductase
   44::195     1e-32  48%  212 aa  MSRA_SALG2 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     1e-32  48%  212 aa  MSRA_SALEP RecName: Full=Peptide methionine sulfoxide reductase
   44::195     1e-32  48%  212 aa  MSRA_SALDC RecName: Full=Peptide methionine sulfoxide reductase
   44::195     1e-32  48%  212 aa  MSRA_SALCH RecName: Full=Peptide methionine sulfoxide reductase
   44::195     1e-32  47%  212 aa  MSRA_SALAR RecName: Full=Peptide methionine sulfoxide reductase
   44::195     1e-32  47%  212 aa  MSRA_ESCF3 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     2e-32  48%  212 aa  MSRA_SALA4 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     2e-32  46%  211 aa  MSRA_KLEP3 RecName: Full=Peptide methionine sulfoxide reductase
   22::195     2e-32  46%  212 aa  MSRA_ENTS8 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-32  46%  212 aa  MSRA_SHIB3 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-32  46%  212 aa  MSRA_ECO5E RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-32  46%  212 aa  MSRA_ECO57 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-32  46%  212 aa  MSRA_ECO27 RecName: Full=Peptide methionine sulfoxide reductase
    5::151     6e-32  48%  172 aa  MSRA1_RHILO RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_SHISS RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_SHIFL RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_SHIF8 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_SHIBS RecName: Full=Peptide methionine sulfoxide reductase
    4::152     8e-32  46%  172 aa  MSRA_LACS1 RecName: Full=Peptide methionine sulfoxide reductase
    8::154     8e-32  46%  162 aa  MSRA_GEOSL RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECOSM RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECOLU RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECOLI RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECOLC RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECOHS RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECODH RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECOBW RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECO8A RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECO81 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECO7I RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECO55 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECO45 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     8e-32  46%  212 aa  MSRA_ECO24 RecName: Full=Peptide methionine sulfoxide reductase
    2::151     1e-31  45%  209 aa  MSRA_PSEFL RecName: Full=Peptide methionine sulfoxide reductase
    4::153     1e-31  45%  175 aa  MSRA_LACRD RecName: Full=Peptide methionine sulfoxide reductase
    3::152     1e-31  43%  172 aa  MSRA2_LACLA RecName: Full=Peptide methionine sulfoxide reductase
   67::236     2e-31  42%  258 aa  MSRA_ARATH RecName: Full=Peptide methionine sulfoxide reductase;   
    2::173     2e-31  40%  175 aa  MSRA_CLAMS RecName: Full=Peptide methionine sulfoxide reductase
   44::195     3e-31  46%  212 aa  MSRA_SHIDS RecName: Full=Peptide methionine sulfoxide reductase
   46::200     3e-31  44%  215 aa  MSRA_PSEU2 RecName: Full=Peptide methionine sulfoxide reductase
    5::148     3e-31  47%  157 aa  MSRA_CLOBK RecName: Full=Peptide methionine sulfoxide reductase
    4::156     3e-31  42%  177 aa  MSRA2_STAAR RecName: Full=Peptide methionine sulfoxide reductase
   44::195     4e-31  46%  212 aa  MSRA_ECOL5 RecName: Full=Peptide methionine sulfoxide reductase
    5::148     5e-31  46%  157 aa  MSRA_CLOBJ RecName: Full=Peptide methionine sulfoxide reductase
    5::148     5e-31  46%  157 aa  MSRA_CLOBH RecName: Full=Peptide methionine sulfoxide reductase
    5::148     5e-31  46%  157 aa  MSRA_CLOB1 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     7e-31  46%  213 aa  MSRA_ENT38 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     7e-31  46%  212 aa  MSRA_ECOSE RecName: Full=Peptide methionine sulfoxide reductase
    5::148     7e-31  46%  157 aa  MSRA_CLOBL RecName: Full=Peptide methionine sulfoxide reductase
   44::195     9e-31  46%  212 aa  MSRA_ECOL6 RecName: Full=Peptide methionine sulfoxide reductase
   39::188     9e-31  40%  353 aa  MSRAB_HAEIN RecName: Full=Peptide methionine sulfoxide reductase
    4::156     9e-31  41%  177 aa  MSRA2_STAAW RecName: Full=Peptide methionine sulfoxide reductase
    4::156     9e-31  41%  177 aa  MSRA2_STAAS RecName: Full=Peptide methionine sulfoxide reductase
    4::156     9e-31  41%  177 aa  MSRA2_STAA8 RecName: Full=Peptide methionine sulfoxide reductase
   47::196     1e-30  45%  218 aa  MSRA_AZOC5 RecName: Full=Peptide methionine sulfoxide reductase
    2::148     1e-30  44%  168 aa  MSRA3_RHIME RecName: Full=Peptide methionine sulfoxide reductase
    4::156     1e-30  41%  177 aa  MSRA2_STAAN RecName: Full=Peptide methionine sulfoxide reductase
    4::156     1e-30  41%  177 aa  MSRA2_STAAM RecName: Full=Peptide methionine sulfoxide reductase
    2::151     1e-30  45%  179 aa  MSRA_NITWN RecName: Full=Peptide methionine sulfoxide reductase
    7::157     1e-30  42%  177 aa  MSRA_LISIN RecName: Full=Peptide methionine sulfoxide reductase
    2::147     1e-30  45%  169 aa  MSRA_LEIXX RecName: Full=Peptide methionine sulfoxide reductase
    4::144     1e-30  45%  147 aa  MSRA_DICDI RecName: Full=Peptide methionine sulfoxide reductase;   
    5::148     1e-30  45%  157 aa  MSRA_CLOBM RecName: Full=Peptide methionine sulfoxide reductase
   45::199     3e-30  44%  217 aa  MSRA_CYAP8 RecName: Full=Peptide methionine sulfoxide reductase
   52::198     4e-30  41%  211 aa  MSRA_METMA RecName: Full=Peptide methionine sulfoxide reductase
    7::157     4e-30  41%  177 aa  MSRA_LISW6 RecName: Full=Peptide methionine sulfoxide reductase
   45::198     6e-30  45%  220 aa  MSRA_SALTO RecName: Full=Peptide methionine sulfoxide reductase
   46::200     6e-30  44%  215 aa  MSRA_PSESM RecName: Full=Peptide methionine sulfoxide reductase
    2::150     7e-30  42%  169 aa  MSRA_STRU0 RecName: Full=Peptide methionine sulfoxide reductase
    2::150     7e-30  43%  169 aa  MSRA_STRPM RecName: Full=Peptide methionine sulfoxide reductase
    2::150     7e-30  43%  169 aa  MSRA_STRP3 RecName: Full=Peptide methionine sulfoxide reductase
    7::157     7e-30  40%  177 aa  MSRA_LISMO RecName: Full=Peptide methionine sulfoxide reductase
    7::157     7e-30  40%  177 aa  MSRA_LISMH RecName: Full=Peptide methionine sulfoxide reductase
    2::150     1e-29  43%  169 aa  MSRA_STREM RecName: Full=Peptide methionine sulfoxide reductase
    3::150     1e-29  44%  172 aa  MSRA_STRCO RecName: Full=Peptide methionine sulfoxide reductase
    2::146     1e-29  46%  147 aa  MSRA_PELUB RecName: Full=Peptide methionine sulfoxide reductase
   29::175     1e-29  41%  188 aa  MSRA_METAC RecName: Full=Peptide methionine sulfoxide reductase
    7::157     1e-29  40%  177 aa  MSRA_LISMF RecName: Full=Peptide methionine sulfoxide reductase
    7::157     1e-29  40%  177 aa  MSRA_LISMC RecName: Full=Peptide methionine sulfoxide reductase
    6::156     1e-29  42%  177 aa  MSRA_BACA2 RecName: Full=Peptide methionine sulfoxide reductase
    2::148     1e-29  44%  168 aa  MSRA2_RHOBA RecName: Full=Peptide methionine sulfoxide reductase
    2::150     1e-29  42%  169 aa  MSRA_STRPG RecName: Full=Peptide methionine sulfoxide reductase
    2::150     1e-29  42%  169 aa  MSRA_STRP8 RecName: Full=Peptide methionine sulfoxide reductase
    2::150     1e-29  42%  169 aa  MSRA_STRP6 RecName: Full=Peptide methionine sulfoxide reductase
    2::150     1e-29  43%  169 aa  MSRA_STRE4 RecName: Full=Peptide methionine sulfoxide reductase
   23::196     1e-29  43%  213 aa  MSRA_SERP5 RecName: Full=Peptide methionine sulfoxide reductase
   43::196     1e-29  46%  213 aa  MSRA_DICD3 RecName: Full=Peptide methionine sulfoxide reductase
    3::150     2e-29  43%  170 aa  MSRA_STRAW RecName: Full=Peptide methionine sulfoxide reductase
    2::151     2e-29  41%  169 aa  MSRA_STRA3 RecName: Full=Peptide methionine sulfoxide reductase
    4::152     2e-29  44%  177 aa  MSRA_MYCLE RecName: Full=Peptide methionine sulfoxide reductase
    4::152     2e-29  44%  177 aa  MSRA_MYCLB RecName: Full=Peptide methionine sulfoxide reductase
   65::217     2e-29  46%  235 aa  MSRA_HUMAN RecName: Full=Peptide methionine sulfoxide reductase;   
   48::199     2e-29  45%  222 aa  MSRA2_ANASP RecName: Full=Peptide methionine sulfoxide reductase
    7::184     2e-29  42%  311 aa  MSAB2_STRR6 RecName: Full=Peptide methionine sulfoxide reductase
    7::184     2e-29  42%  311 aa  MSAB2_STRPN RecName: Full=Peptide methionine sulfoxide reductase
    2::150     2e-29  42%  169 aa  MSRA_STRPZ RecName: Full=Peptide methionine sulfoxide reductase
    2::150     2e-29  42%  169 aa  MSRA_STRPD RecName: Full=Peptide methionine sulfoxide reductase
    2::150     2e-29  42%  169 aa  MSRA_STRPC RecName: Full=Peptide methionine sulfoxide reductase
    2::150     2e-29  42%  169 aa  MSRA_STRPB RecName: Full=Peptide methionine sulfoxide reductase
    2::150     2e-29  42%  169 aa  MSRA_STRP1 RecName: Full=Peptide methionine sulfoxide reductase
    2::151     2e-29  41%  169 aa  MSRA_STRA5 RecName: Full=Peptide methionine sulfoxide reductase
    2::151     2e-29  41%  169 aa  MSRA_STRA1 RecName: Full=Peptide methionine sulfoxide reductase
   13::185     2e-29  40%  191 aa  MSRA_RALSO RecName: Full=Peptide methionine sulfoxide reductase
    2::169     2e-29  42%  175 aa  MSRA_PSYWF RecName: Full=Peptide methionine sulfoxide reductase
    6::156     2e-29  42%  177 aa  MSRA_BACSU RecName: Full=Peptide methionine sulfoxide reductase
    6::153     2e-29  43%  178 aa  MSRA_BACP2 RecName: Full=Peptide methionine sulfoxide reductase
    6::154     2e-29  44%  176 aa  MSRA_BACHD RecName: Full=Peptide methionine sulfoxide reductase
    6::154     3e-29  42%  181 aa  MSRA_BACLD RecName: Full=Peptide methionine sulfoxide reductase
    2::150     4e-29  42%  169 aa  MSRA_STRS7 RecName: Full=Peptide methionine sulfoxide reductase
    4::150     4e-29  44%  170 aa  MSRA_NOCFA RecName: Full=Peptide methionine sulfoxide reductase
   63::214     4e-29  46%  233 aa  MSRA_MOUSE RecName: Full=Peptide methionine sulfoxide reductase;   
    2::167     5e-29  38%  173 aa  MSRA_PSYCK RecName: Full=Peptide methionine sulfoxide reductase
    5::148     5e-29  44%  157 aa  MSRA_CLOB6 RecName: Full=Peptide methionine sulfoxide reductase
   50::200     6e-29  44%  219 aa  MSRA_PSEMY RecName: Full=Peptide methionine sulfoxide reductase
    5::150     6e-29  45%  182 aa  MSRA_MYCTU RecName: Full=Peptide methionine sulfoxide reductase
    5::150     6e-29  45%  182 aa  MSRA_MYCTA RecName: Full=Peptide methionine sulfoxide reductase
    5::150     6e-29  45%  182 aa  MSRA_MYCBT RecName: Full=Peptide methionine sulfoxide reductase
    5::150     6e-29  45%  182 aa  MSRA_MYCBP RecName: Full=Peptide methionine sulfoxide reductase
    5::150     6e-29  45%  182 aa  MSRA_MYCBO RecName: Full=Peptide methionine sulfoxide reductase
    3::152     6e-29  43%  183 aa  MSRA1_LACLA RecName: Full=Peptide methionine sulfoxide reductase
    2::168     8e-29  39%  174 aa  MSRA_ARTS2 RecName: Full=Peptide methionine sulfoxide reductase
    2::168     8e-29  39%  174 aa  MSRA_ARTCA RecName: Full=Peptide methionine sulfoxide reductase
   29::214     1e-28  45%  233 aa  MSRA_RAT RecName: Full=Peptide methionine sulfoxide reductase;     
    5::150     1e-28  44%  171 aa  MSRA_MYCMM RecName: Full=Peptide methionine sulfoxide reductase
   43::197     1e-28  44%  222 aa  MSRA_METCA RecName: Full=Peptide methionine sulfoxide reductase
    2::150     2e-28  44%  169 aa  MSRA_STRMU RecName: Full=Peptide methionine sulfoxide reductase
    2::150     2e-28  42%  171 aa  MSRA_MYCPA RecName: Full=Peptide methionine sulfoxide reductase
    2::149     2e-28  43%  157 aa  MSRA_METM7 RecName: Full=Peptide methionine sulfoxide reductase
   51::191     2e-28  42%  356 aa  MSRAB_ACTAC RecName: Full=Peptide methionine sulfoxide reductase
    2::154     2e-28  40%  170 aa  MSRA_SCHPO RecName: Full=Probable peptide methionine sulfoxide
    2::167     2e-28  37%  173 aa  MSRA_PSYA2 RecName: Full=Peptide methionine sulfoxide reductase
   54::202     2e-28  45%  222 aa  MSRA_PSEPG RecName: Full=Peptide methionine sulfoxide reductase
   37::196     2e-28  43%  211 aa  MSRA_PHOPR RecName: Full=Peptide methionine sulfoxide reductase
   72::235     2e-28  40%  257 aa  MSRA_BRANA RecName: Full=Peptide methionine sulfoxide reductase;   
    5::153     2e-28  44%  309 aa  MSRAB_STRP8 RecName: Full=Peptide methionine sulfoxide reductase
    5::153     2e-28  44%  309 aa  MSRAB_STRP6 RecName: Full=Peptide methionine sulfoxide reductase
    5::153     2e-28  44%  309 aa  MSRAB_STRP1 RecName: Full=Peptide methionine sulfoxide reductase
   46::200     3e-28  44%  215 aa  MSRA_SACD2 RecName: Full=Peptide methionine sulfoxide reductase
   54::202     3e-28  44%  222 aa  MSRA_PSEPW RecName: Full=Peptide methionine sulfoxide reductase
    5::164     3e-28  39%  165 aa  MSRA_CAMJJ RecName: Full=Peptide methionine sulfoxide reductase
    5::164     3e-28  39%  165 aa  MSRA_CAMJE RecName: Full=Peptide methionine sulfoxide reductase
    5::164     3e-28  39%  165 aa  MSRA_CAMJ8 RecName: Full=Peptide methionine sulfoxide reductase
   44::195     4e-28  45%  212 aa  MSRA_YERE8 RecName: Full=Peptide methionine sulfoxide reductase
    2::149     4e-28  43%  171 aa  MSRA_MYCSS RecName: Full=Peptide methionine sulfoxide reductase
    2::149     4e-28  43%  171 aa  MSRA_MYCSK RecName: Full=Peptide methionine sulfoxide reductase
    2::150     4e-28  44%  169 aa  MSRA_MYCGI RecName: Full=Peptide methionine sulfoxide reductase
    5::149     4e-28  43%  157 aa  MSRA_METMP RecName: Full=Peptide methionine sulfoxide reductase
   42::196     4e-28  41%  212 aa  MSRA_ERWCT RecName: Full=Peptide methionine sulfoxide reductase
   29::174     5e-28  42%  196 aa  MSRA_SOLLC RecName: Full=Peptide methionine sulfoxide reductase;   
   54::202     5e-28  45%  222 aa  MSRA_PSEE4 RecName: Full=Peptide methionine sulfoxide reductase
    2::150     5e-28  44%  169 aa  MSRA_MYCVP RecName: Full=Peptide methionine sulfoxide reductase
    2::149     5e-28  43%  171 aa  MSRA_MYCSJ RecName: Full=Peptide methionine sulfoxide reductase
    2::149     5e-28  42%  157 aa  MSRA_METM5 RecName: Full=Peptide methionine sulfoxide reductase
   54::202     7e-28  44%  222 aa  MSRA_PSEPK RecName: Full=Peptide methionine sulfoxide reductase
    5::150     7e-28  43%  171 aa  MSRA_MYCUA RecName: Full=Peptide methionine sulfoxide reductase
    5::164     7e-28  38%  165 aa  MSRA_CAMJR RecName: Full=Peptide methionine sulfoxide reductase
   45::198     9e-28  44%  220 aa  MSRA_SALAI RecName: Full=Peptide methionine sulfoxide reductase
   50::194     1e-27  44%  212 aa  MSRA_VIBCM RecName: Full=Peptide methionine sulfoxide reductase
   50::194     1e-27  44%  212 aa  MSRA_VIBCH RecName: Full=Peptide methionine sulfoxide reductase
   50::194     1e-27  44%  212 aa  MSRA_VIBC3 RecName: Full=Peptide methionine sulfoxide reductase
   47::199     1e-27  44%  222 aa  MSRA_STRGG RecName: Full=Peptide methionine sulfoxide reductase
   46::200     1e-27  42%  215 aa  MSRA_PSE14 RecName: Full=Peptide methionine sulfoxide reductase
    3::150     2e-27  41%  166 aa  MSRA_CLOPH RecName: Full=Peptide methionine sulfoxide reductase
   42::196     2e-27  41%  212 aa  MSRA_PECCP RecName: Full=Peptide methionine sulfoxide reductase
    5::149     3e-27  42%  162 aa  MSRA_CLOAB RecName: Full=Peptide methionine sulfoxide reductase
    7::182     3e-27  35%  378 aa  MSRAB_VIBCH RecName: Full=Peptide methionine sulfoxide reductase
    5::153     3e-27  43%  309 aa  MSRAB_STRP3 RecName: Full=Peptide methionine sulfoxide reductase
    5::148     3e-27  42%  158 aa  MSRA_ALKMQ RecName: Full=Peptide methionine sulfoxide reductase
   63::214     4e-27  42%  233 aa  MSRA_BOVIN RecName: Full=Peptide methionine sulfoxide reductase;   
   49::200     4e-27  41%  222 aa  MSRA1_SYNY3 RecName: Full=Peptide methionine sulfoxide reductase
    4::160     6e-27  41%  173 aa  MSRA_NAUPA RecName: Full=Peptide methionine sulfoxide reductase
    3::155     6e-27  40%  164 aa  MSRA_CLOTE RecName: Full=Peptide methionine sulfoxide reductase
   41::193     8e-27  41%  212 aa  MSRA_VIBPA RecName: Full=Peptide methionine sulfoxide reductase
   24::181     8e-27  40%  359 aa  MSRAB_HELPY RecName: Full=Peptide methionine sulfoxide reductase
    6::148     1e-26  40%  157 aa  MSRA_MYCPN RecName: Full=Peptide methionine sulfoxide reductase
   46::198     1e-26  45%  221 aa  MSRA_METNO RecName: Full=Peptide methionine sulfoxide reductase
    2::149     1e-26  40%  157 aa  MSRA_METM6 RecName: Full=Peptide methionine sulfoxide reductase
   80::243     1e-26  38%  259 aa  MSRA_LACSA RecName: Full=Peptide methionine sulfoxide reductase;   
    5::164     1e-26  38%  165 aa  MSRA_CAMJD RecName: Full=Peptide methionine sulfoxide reductase
   52::200     1e-26  41%  216 aa  MSRA_AZOVD RecName: Full=Peptide methionine sulfoxide reductase
   50::201     2e-26  41%  215 aa  MSRA_PSEAE RecName: Full=Peptide methionine sulfoxide reductase
   50::201     2e-26  41%  215 aa  MSRA_PSEAB RecName: Full=Peptide methionine sulfoxide reductase
   50::201     2e-26  40%  215 aa  MSRA_PSEA8 RecName: Full=Peptide methionine sulfoxide reductase
   13::159     2e-26  39%  163 aa  MSRA1_ANASP RecName: Full=Peptide methionine sulfoxide reductase
   52::200     4e-26  43%  217 aa  MSRA1_RHIME RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-26  44%  212 aa  MSRA_YERPY RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-26  44%  212 aa  MSRA_YERPS RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-26  44%  212 aa  MSRA_YERPP RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-26  44%  212 aa  MSRA_YERPN RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-26  44%  212 aa  MSRA_YERPG RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-26  44%  212 aa  MSRA_YERPE RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-26  44%  212 aa  MSRA_YERPB RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-26  44%  212 aa  MSRA_YERPA RecName: Full=Peptide methionine sulfoxide reductase
   44::195     5e-26  44%  212 aa  MSRA_YERP3 RecName: Full=Peptide methionine sulfoxide reductase
    3::148     5e-26  40%  160 aa  MSRA_RHORT RecName: Full=Peptide methionine sulfoxide reductase
   48::199     8e-26  42%  221 aa  MSRA_FRASN RecName: Full=Peptide methionine sulfoxide reductase
   56::200     8e-26  44%  216 aa  MSRA_AGRT5 RecName: Full=Peptide methionine sulfoxide reductase
   47::197     1e-25  40%  211 aa  MSRA_MAGSA RecName: Full=Peptide methionine sulfoxide reductase
   41::180     2e-25  40%  359 aa  MSRAB_HELPJ RecName: Full=Peptide methionine sulfoxide reductase
   23::196     2e-25  40%  215 aa  MSRA_PHOLL RecName: Full=Peptide methionine sulfoxide reductase
    9::169     3e-25  40%  191 aa  MSRA_FRAAN RecName: Full=Peptide methionine sulfoxide reductase;   
   29::207     4e-25  41%  220 aa  MSRA_CORK4 RecName: Full=Peptide methionine sulfoxide reductase
   27::173     4e-25  41%  196 aa  MSRA2_CAUCR RecName: Full=Peptide methionine sulfoxide reductase
    5::149     1e-24  39%  157 aa  MSRA_CLOPS RecName: Full=Peptide methionine sulfoxide reductase
   46::198     2e-24  41%  221 aa  MSRA_METS4 RecName: Full=Peptide methionine sulfoxide reductase
    5::149     2e-24  39%  157 aa  MSRA_CLOP1 RecName: Full=Peptide methionine sulfoxide reductase
    7::156     2e-24  36%  311 aa  MSRAB_STRGC RecName: Full=Peptide methionine sulfoxide reductase
   50::198     4e-24  42%  216 aa  MSRA_XANC8 RecName: Full=Peptide methionine sulfoxide reductase
   50::198     4e-24  44%  216 aa  MSRA_XANC5 RecName: Full=Peptide methionine sulfoxide reductase
   18::168     4e-24  39%  198 aa  MSRA2_RHIME RecName: Full=Peptide methionine sulfoxide reductase
   50::198     5e-24  42%  216 aa  MSRA_XANCP RecName: Full=Peptide methionine sulfoxide reductase
   50::198     5e-24  42%  216 aa  MSRA_XANCB RecName: Full=Peptide methionine sulfoxide reductase
   50::198     6e-24  43%  216 aa  MSRA_XANCH RecName: Full=Peptide methionine sulfoxide reductase
    2::96      6e-24  52%  123 aa  MSRA_THEVU RecName: Full=Peptide methionine sulfoxide reductase
    7::147     6e-24  38%  165 aa  MSRA_HELHP RecName: Full=Peptide methionine sulfoxide reductase
    7::159     6e-24  36%  312 aa  MSAB1_STRR6 RecName: Full=Peptide methionine sulfoxide reductase
    7::159     6e-24  36%  312 aa  MSAB1_STRPN RecName: Full=Peptide methionine sulfoxide reductase
   50::198     8e-24  43%  216 aa  MSRA_XANAC RecName: Full=Peptide methionine sulfoxide reductase
   52::199     1e-23  38%  218 aa  MSRA_BRUSU RecName: Full=Peptide methionine sulfoxide reductase
   52::199     1e-23  38%  218 aa  MSRA_BRUSI RecName: Full=Peptide methionine sulfoxide reductase
   52::199     1e-23  38%  218 aa  MSRA_BRUO2 RecName: Full=Peptide methionine sulfoxide reductase
   52::199     1e-23  38%  218 aa  MSRA_BRUME RecName: Full=Peptide methionine sulfoxide reductase
   52::199     1e-23  38%  218 aa  MSRA_BRUC2 RecName: Full=Peptide methionine sulfoxide reductase
   52::199     1e-23  38%  218 aa  MSRA_BRUAB RecName: Full=Peptide methionine sulfoxide reductase
   52::199     1e-23  38%  218 aa  MSRA_BRUA2 RecName: Full=Peptide methionine sulfoxide reductase
   52::199     1e-23  38%  218 aa  MSRA_BRUA1 RecName: Full=Peptide methionine sulfoxide reductase
    5::149     2e-23  37%  157 aa  MSRA_CLOPE RecName: Full=Peptide methionine sulfoxide reductase
   39::202     3e-23  41%  220 aa  MSRA_CORDI RecName: Full=Peptide methionine sulfoxide reductase
   52::199     3e-23  38%  218 aa  MSRA_BRUMB RecName: Full=Peptide methionine sulfoxide reductase
    8::150     4e-23  38%  165 aa  MSRA_UREU1 RecName: Full=Peptide methionine sulfoxide reductase
   52::200     4e-23  39%  218 aa  MSRA_OCHAN RecName: Full=Peptide methionine sulfoxide reductase
   52::200     4e-23  39%  218 aa  MSRA_OCHA4 RecName: Full=Peptide methionine sulfoxide reductase
    8::150     7e-23  38%  165 aa  MSRA_UREPA RecName: Full=Peptide methionine sulfoxide reductase
    8::150     7e-23  38%  165 aa  MSRA_UREP2 RecName: Full=Peptide methionine sulfoxide reductase
    7::149     7e-23  37%  156 aa  MSRA_MYCA5 RecName: Full=Peptide methionine sulfoxide reductase
   55::200     1e-22  40%  217 aa  MSRA_CORGL RecName: Full=Peptide methionine sulfoxide reductase
   55::200     1e-22  39%  217 aa  MSRA_COREF RecName: Full=Peptide methionine sulfoxide reductase
   33::172     1e-22  40%  337 aa  MSRAB_CAMFE RecName: Full=Peptide methionine sulfoxide reductase
   55::200     2e-22  40%  217 aa  MSRA_CORGB RecName: Full=Peptide methionine sulfoxide reductase
   55::200     3e-22  40%  217 aa  MSRA_CORML RecName: Full=Peptide methionine sulfoxide reductase
    2::168     4e-22  34%  174 aa  MSRA_ARTAT RecName: Full=Peptide methionine sulfoxide reductase
    6::197     4e-21  38%  217 aa  MSRA_MARMM RecName: Full=Peptide methionine sulfoxide reductase
   46::197     5e-21  38%  217 aa  MSRA1_CAUCR RecName: Full=Peptide methionine sulfoxide reductase
   50::198     2e-20  41%  216 aa  MSRA_XYLFT RecName: Full=Peptide methionine sulfoxide reductase
   50::198     2e-20  41%  216 aa  MSRA_XYLFM RecName: Full=Peptide methionine sulfoxide reductase
   50::198     2e-20  41%  216 aa  MSRA_XYLFA RecName: Full=Peptide methionine sulfoxide reductase
   50::198     2e-20  41%  216 aa  MSRA_XYLF2 RecName: Full=Peptide methionine sulfoxide reductase
    8::150     4e-20  34%  160 aa  MSRA_MYCPE RecName: Full=Peptide methionine sulfoxide reductase
   22::171     7e-20  38%  184 aa  MSRA_YEAST RecName: Full=Peptide methionine sulfoxide reductase;   
   50::198     9e-20  39%  216 aa  MSRA_XANOP RecName: Full=Peptide methionine sulfoxide reductase
   50::198     9e-20  39%  216 aa  MSRA_XANOM RecName: Full=Peptide methionine sulfoxide reductase
   41::192     3e-19  39%  246 aa  MSRA_DROME RecName: Full=Peptide methionine sulfoxide reductase;   
    6::149     1e-18  35%  157 aa  MSRA_MYCGE RecName: Full=Peptide methionine sulfoxide reductase
   37::193     3e-18  34%  209 aa  MSRA_VIBVU RecName: Full=Peptide methionine sulfoxide reductase
    8::161     5e-18  37%  166 aa  MSRA_MYCPU RecName: Full=Peptide methionine sulfoxide reductase
    1::243

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWELPAISAEAAVKIPAPAVDEKAGTSHTETAVFAGGCFWG
MSRA2_RHILO     ------------------------------------------------MDEKAAPG-SETAIFAGGCFWG
MSRA2_SYNY3     ---------------------------------------------------------TEKAVFAGGCFWG
MSRA_POLSQ      ----------------------------------------------------------ERATLGGGCFWC
MSRA_DEIRA      ----------------------------------------------------------EQAIFAGGCFWC
MSRA_HALWD      ---------------------------------------------------------SETATVGGGCFWC
MSRA_PASMU      ---------------------------------------------------------TQQAIFAGGCFWC
MSRA_TRIEI      ----------------------------------------------------------DTIVLGGGCFWC
MSRA_NATPD      ---------------------------------------------------------TATATLGGGCFWC
MSRA_HALSA      ---------------------------------------------------------TETATLGGGCFWC
MSRA_HALS3      ---------------------------------------------------------TETATLGGGCFWC
MSRA_METHJ      ------------------------------------------------------------AFFAGGCFWG
MSRA_CHRVO      ----------------------------------------------------------EKAILGGGCFWC
MSRA_NITSB      ---------------------------------------------------------SESAIVGGGCFWC
MSRA_ACIC5      ------------------------------------------------------------ATFGAGCFWG
MSRA_THET2      ----------------------------------------------------------EIATLAGGCFWC
MSRA_PICTO      ----------------------------------------------------------DVCYLAGGCFWC
MSRA_METTH      -------------------------------------------------------SRYEKATFGAGCFWG
MSRA1_RHOBA     ----------------------------------------------------------EVATLAGGCFWC
MSRA_THET8      ----------------------------------------------------------EIATLAGGCFWC
MSRA_SULAC      ----------------------------------------------------------EVATLGGGCFWC
MSRA_SULSO      ----------------------------------------------------------EVATLGGGCFWC
MSRA_LEPBJ      ----------------------------------------------------------EQATLGGGCFWC
MSRA_ACIBY      ----------------------------------------------------------QQALFGGGCFWC
MSRA_ACIBT      ----------------------------------------------------------QQALFGGGCFWC
MSRA_ACIBC      ----------------------------------------------------------QQALFGGGCFWC
MSRA_ACIB5      ----------------------------------------------------------QQALFGGGCFWC
MSRA_ACIB3      ----------------------------------------------------------QQALFGGGCFWC
MSRA_LACSS      ---------------------------------------------------------TETAIFAGGCFWC
MSRAB_NEIMB     --------------------------------------------------------NTRTIYLAGGCFWG
MSRAB_NEIMA     --------------------------------------------------------NTRTIYLAGGCFWG
MSRA_METMJ      ----------------------------------------------------------ERATFGAGCFWG
MSRA_LEPBL      ----------------------------------------------------------EQATLGGGCFWC
MSRA_GRABC      ----------------------------------------------------------ETAVIGGGCFWC
MSRA_ERWT9      ---------------------------------------------------------TEYAIIAGGCFWC
MSRA_ACIBS      ----------------------------------------------------------QQALFGGGCFWC
MSRA_VESOH      ----------------------------------------------------------QTAYFSGGCFWC
MSRAB_NEIGO     --------------------------------------------------------NTRTIYLAGGCFWG
MSRA_RUTMC      --------------------------------------------------------------FAGGCFWC
MSRAB_TREPA     -----------------------------------------------------------TALFAAGCFWS
MSRA_METBU      ----------------------------------------------------------ERATFAAGCFWG
MSRA_GEOMG      ------------------------------------------------------TPELEKATFGAGCFWH
MSRA_SALPB      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_LEUMM      ----------------------------------------------------------ETAIFAGGCFWC
MSRA_STAAC      -----------------------------------------------------------TAYFAGGCFWC
MSRA1_STAAW     -----------------------------------------------------------TAYFAGGCFWC
MSRA1_STAAS     -----------------------------------------------------------TAYFAGGCFWC
MSRA1_STAAR     -----------------------------------------------------------TAYFAGGCFWC
MSRA1_STAAN     -----------------------------------------------------------TAYFAGGCFWC
MSRA1_STAAM     -----------------------------------------------------------TAYFAGGCFWC
MSRA1_STAA8     -----------------------------------------------------------TAYFAGGCFWC
MSRA_SALTY      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_SALSV      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_SALNS      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_CLAM3      ----------------------------------------------------------QTFILAGGCFWC
MSRA_RHOCS      ----------------------------------------------------------ETAVFGMGCFWG
MSRA_SALTI      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_SALPK      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_SALPC      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_SALPA      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_SALHS      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_SALG2      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_SALEP      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_SALDC      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_SALCH      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_SALAR      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_ESCF3      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_SALA4      ----------------------------------------------------------EIAYFAMGCFWG
MSRA_KLEP3      ----------------------------------------------------------EVALFAMGCFWG
MSRA_ENTS8      ------------------------------------------RMPVAALHTVTGHSMTEVALFAMGCFWG
MSRA_SHIB3      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECO5E      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECO57      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECO27      ----------------------------------------------------------EIAIFAMGCFWG
MSRA1_RHILO     ---------------------------------------------------------TERAVLAGGCFWG
MSRA_SHISS      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_SHIFL      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_SHIF8      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_SHIBS      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_LACS1      ----------------------------------------------------------DTAIFAGGCFWC
MSRA_GEOSL      ----------------------------------------------------------EKATFGAGCFWH
MSRA_ECOSM      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECOLU      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECOLI      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECOLC      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECOHS      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECODH      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECOBW      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECO8A      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECO81      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECO7I      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECO55      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECO45      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_ECO24      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_PSEFL      ------------------------------------------------------TRHTETAILAGGCFWG
MSRA_LACRD      ----------------------------------------------------------DTAIFAGGCFWC
MSRA2_LACLA     ---------------------------------------------------------TERAIFAGGCFWC
MSRA_ARATH      ---------------------------------PQAQADPSSAAIAQGPDDDVPSSGQQFAQFGAGCFWG
MSRA_CLAMS      ----------------------------------------------------------QTFILAGGCFWC
MSRA_SHIDS      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_PSEU2      ------------------------------------------------------SSNVEFAIFGMGCFWG
MSRA_CLOBK      -------------------------------------------------------------VLAGGCFWG
MSRA2_STAAR     ----------------------------------------------------------EYATLAGGCFWC
MSRA_ECOL5      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_CLOBJ      -------------------------------------------------------------VLAGGCFWG
MSRA_CLOBH      -------------------------------------------------------------VLAGGCFWG
MSRA_CLOB1      -------------------------------------------------------------VLAGGCFWG
MSRA_ENT38      ----------------------------------------------------------EIALFAMGCFWG
MSRA_ECOSE      ----------------------------------------------------------EIAIFAMGCFWG
MSRA_CLOBL      -------------------------------------------------------------VLAGGCFWG
MSRA_ECOL6      ----------------------------------------------------------EIAIFAMGCFWG
MSRAB_HAEIN     ------------------------------------------------------TQNIREIYLAGGCFWG
MSRA2_STAAW     ----------------------------------------------------------EYATLAGGCFWC
MSRA2_STAAS     ----------------------------------------------------------EYATLAGGCFWC
MSRA2_STAA8     ----------------------------------------------------------EYATLAGGCFWC
MSRA_AZOC5      -----------------------------------------------------------TAIFALGCFWG
MSRA3_RHIME     ---------------------------------------------------------TKRAVLAGGCFWG
MSRA2_STAAN     ----------------------------------------------------------EYATLAGGCFWC
MSRA2_STAAM     ----------------------------------------------------------EYATLAGGCFWC
MSRA_NITWN      ------------------------------------------------------TVSTERAVLAGGCFWG
MSRA_LISIN      ----------------------------------------------------------EKATFAGGCFWC
MSRA_LEIXX      ---------------------------------------------------------TERAILAGGCFWG
MSRA_DICDI      ------------------------------------------------------------ATFAAGCFWS
MSRA_CLOBM      -------------------------------------------------------------VLAGGCFWG
MSRA_CYAP8      -------------------------------------------------------SGLETAMFGLGCFWG
MSRA_METMA      ----------------------------------------------------------EKATFAAGCFWG
MSRA_LISW6      ----------------------------------------------------------EKATFAGGCFWC
MSRA_SALTO      ---------------------------------------------------------TAVAVFGMGCFWG
MSRA_PSESM      ------------------------------------------------------TSNVEFAIFGLGCFWG
MSRA_STRU0      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRPM      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRP3      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_LISMO      ----------------------------------------------------------EKATFAGGCFWC
MSRA_LISMH      ----------------------------------------------------------EKATFAGGCFWC
MSRA_STREM      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRCO      -------------------------------------------------------AQTQRAVLAGGCFWG
MSRA_PELUB      ----------------------------------------------------------EIAVLGLGCFWG
MSRA_METAC      ----------------------------------------------------------EKATFAAGCFWG
MSRA_LISMF      ----------------------------------------------------------EKATFAGGCFWC
MSRA_LISMC      ----------------------------------------------------------EKATFAGGCFWC
MSRA_BACA2      ----------------------------------------------------------EIATFAGGCFWC
MSRA2_RHOBA     ---------------------------------------------------------TERAVLAGGCFWG
MSRA_STRPG      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRP8      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRP6      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRE4      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_SERP5      --------------------------------------------PMPVATLNVVTDHSEVAIFAMGCFWG
MSRA_DICD3      --------------------------------------------------------HMEVAIFAMGCFWG
MSRA_STRAW      -------------------------------------------------------AQTQRAVLAGGCFWG
MSRA_STRA3      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_MYCLE      -------------------------------------------------------TNTRKAILAGGCFWG
MSRA_MYCLB      -------------------------------------------------------TNTRKAILAGGCFWG
MSRA_HUMAN      ---------------------------------------------------------TQMAVFGMGCFWG
MSRA2_ANASP     ----------------------------------------------------------EKALFGLGCFWG
MSAB2_STRR6     ---------------------------------------------------------------AGGCFWG
MSAB2_STRPN     ---------------------------------------------------------------AGGCFWG
MSRA_STRPZ      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRPD      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRPC      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRPB      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRP1      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRA5      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_STRA1      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_RALSO      ----------------------------------------------------------ETAVLGGGCFWC
MSRA_PSYWF      ----------------------------------------------------------QTIILGGGCFWC
MSRA_BACSU      ----------------------------------------------------------EIATFAGGCFWC
MSRA_BACP2      ----------------------------------------------------------ELATFAGGCFWC
MSRA_BACHD      ----------------------------------------------------------ERAMFAGGCFWC
MSRA_BACLD      ----------------------------------------------------------ELATFAGGCFWC
MSRA_STRS7      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_NOCFA      ---------------------------------------------------------TRRAILAGGCFWG
MSRA_MOUSE      ---------------------------------------------------------TQMAVFGMGCFWG
MSRA_PSYCK      ----------------------------------------------------------QTIILGGGCFWC
MSRA_CLOB6      -------------------------------------------------------------VLAGGCFWG
MSRA_PSEMY      ----------------------------------------------------------QQAVFGLGCFWG
MSRA_MYCTU      ----------------------------------------------------------QKAILAGGCFWG
MSRA_MYCTA      ----------------------------------------------------------QKAILAGGCFWG
MSRA_MYCBT      ----------------------------------------------------------QKAILAGGCFWG
MSRA_MYCBP      ----------------------------------------------------------QKAILAGGCFWG
MSRA_MYCBO      ----------------------------------------------------------QKAILAGGCFWG
MSRA1_LACLA     ---------------------------------------------------------TERAIFAGGCFWC
MSRA_ARTS2      ----------------------------------------------------------KTFVLGGGCFWC
MSRA_ARTCA      ----------------------------------------------------------KTFVLGGGCFWC
MSRA_RAT        -----------------------------------ISAEEALSIPVAAKHHVSGNEGTQMAVFGMGCFWG
MSRA_MYCMM      ----------------------------------------------------------QKAILAGGCFWG
MSRA_METCA      -------------------------------------------------------SGTARAFFGMGCFWG
MSRA_STRMU      ----------------------------------------------------------ERAIFAGGCFWC
MSRA_MYCPA      -------------------------------------------------------TNTQKAILAGGCFWG
MSRA_METM7      -------------------------------------------------------ANTETAVFGMGCFWS
MSRAB_ACTAC     ---------------------------------------------------------------AGGCFWG
MSRA_SCHPO      ----------------------------------------------------------QIAIIAAGCFWG
MSRA_PSYA2      ----------------------------------------------------------QTIILGGGCFWC
MSRA_PSEPG      ------------------------------------------------------------AIFGLGCFWG
MSRA_PHOPR      -------------------------------------------------DEKP--SNYSEIIIGMGCFWG
MSRA_BRANA      ---------------------------------------AASSAIAQGPDDDVPSPGQQFAQFGAGCFWG
MSRAB_STRP8     ---------------------------------------------------------------AGGCFWG
MSRAB_STRP6     ---------------------------------------------------------------AGGCFWG
MSRAB_STRP1     ---------------------------------------------------------------AGGCFWG
MSRA_SACD2      -------------------------------------------------------SNMQQCVFGLGCFWG
MSRA_PSEPW      ------------------------------------------------------------AIFGLGCFWG
MSRA_CAMJJ      -------------------------------------------------------------VLGGGCFWC
MSRA_CAMJE      -------------------------------------------------------------VLGGGCFWC
MSRA_CAMJ8      -------------------------------------------------------------VLGGGCFWC
MSRA_YERE8      ----------------------------------------------------------EVAIFAMGCFWG
MSRA_MYCSS      -------------------------------------------------------SDHKKAILAGGCFWG
MSRA_MYCSK      -------------------------------------------------------SDHKKAILAGGCFWG
MSRA_MYCGI      -------------------------------------------------------SDHKRAVLAGGCFWG
MSRA_METMP      ----------------------------------------------------------KTTVFGMGCFWG
MSRA_ERWCT      --------------------------------------------------------HMSVAIFAMGCFWG
MSRA_SOLLC      ----------------------------------------------------------EFAQFAAGCFWG
MSRA_PSEE4      ------------------------------------------------------------AIFALGCFWG
MSRA_MYCVP      -------------------------------------------------------SDHKRAVLAGGCFWG
MSRA_MYCSJ      -------------------------------------------------------SDHKKAILAGGCFWG
MSRA_METM5      -------------------------------------------------------TNTETAVFGMGCFWS
MSRA_PSEPK      ------------------------------------------------------------AIFGLGCFWG
MSRA_MYCUA      ----------------------------------------------------------QKAILAGGCFWG
MSRA_CAMJR      -------------------------------------------------------------ILGGGCFWC
MSRA_SALAI      ---------------------------------------------------------TQVAVFGMGCFWG
MSRA_VIBCM      -----------------------------------------------------------------GCFWG
MSRA_VIBCH      -----------------------------------------------------------------GCFWG
MSRA_VIBC3      -----------------------------------------------------------------GCFWG
MSRA_STRGG      ----------------------------------------------------------EVADFALGCFWG
MSRA_PSE14      ------------------------------------------------------SSNVEFAIFGLGCFWG
MSRA_CLOPH      ----------------------------------------------------------KTIYIAAGCFWG
MSRA_PECCP      --------------------------------------------------------HMSVAIFAMGCFWG
MSRA_CLOAB      -------------------------------------------------------------IFAGGCFWG
MSRAB_VIBCH     ------------------------------WGAPLFALVALTLSLFSQADTKPSTANYQQATLAGGCFWC
MSRAB_STRP3     ---------------------------------------------------------------AEGCFWG
MSRA_ALKMQ      -------------------------------------------------------------VLAGGCFWG
MSRA_BOVIN      ---------------------------------------------------------TQMAVFGMGCFWG
MSRA1_SYNY3     ----------------------------------------------------------ETALFGLGCFWG
MSRA_NAUPA      ------------------------------------------------------------AVFGGGCFWC
MSRA_CLOTE      -----------------------------------------------------GVKFMKEIILAGGCFWG
MSRA_VIBPA      --------------------------------------------------------HQQQILLGMGCFWG
MSRAB_HELPY     --------------------------------------------------ENMGSQHQKTIYLAGGCFWG
MSRA_MYCPN      --------------------------------------------------------------FGGGCFWG
MSRA_METNO      ----------------------------------------------------------ETALFGLGCFWG
MSRA_METM6      -------------------------------------------------------TNTETAVFGMGCFWS
MSRA_LACSA      ---------------------------------------------AQGPDDDIPAPGQQFAQFGAGCFWG
MSRA_CAMJD      -------------------------------------------------------------VLGGGCFWC
MSRA_AZOVD      ------------------------------------------------------------ALFGLGCFWG
MSRA_PSEAE      ----------------------------------------------------------QQVLFGMGCFWG
MSRA_PSEAB      ----------------------------------------------------------QQVLFGMGCFWG
MSRA_PSEA8      ----------------------------------------------------------QQVLFGMGCFWG
MSRA1_ANASP     ----------------------------------------------------------EKATFGAGCFWG
MSRA1_RHIME     -------------------------------------------------------------LFGMGCFWG
MSRA_YERPY      ----------------------------------------------------------DLAFFAMGCFWG
MSRA_YERPS      ----------------------------------------------------------DLAFFAMGCFWG
MSRA_YERPP      ----------------------------------------------------------DLAFFAMGCFWG
MSRA_YERPN      ----------------------------------------------------------DLAFFAMGCFWG
MSRA_YERPG      ----------------------------------------------------------DLAFFAMGCFWG
MSRA_YERPE      ----------------------------------------------------------DLAFFAMGCFWG
MSRA_YERPB      ----------------------------------------------------------DLAFFAMGCFWG
MSRA_YERPA      ----------------------------------------------------------DLAFFAMGCFWG
MSRA_YERP3      ----------------------------------------------------------DLAFFAMGCFWG
MSRA_RHORT      -----------------------------------------------------------TATFAAGCFWG
MSRA_FRASN      -----------------------------------------------------------TAVFGMGCFWG
MSRA_AGRT5      -----------------------------------------------------------------GCFWG
MSRA_MAGSA      ----------------------------------------------------------EVACFGMGCFWG
MSRAB_HELPJ     ---------------------------------------------------------------AGGCFWG
MSRA_PHOLL      --------------------------------------------PLKVSPNHAVTDHTEVAYFGMGCFWG
MSRA_FRAAN      ----------------------------------------------PALDLDSDTPENELAQFASGCFWG
MSRA_CORK4      -------------------------------------------LPHPAPHTVLGTDGQRSVVVGLGCFWG
MSRA2_CAUCR     ---------------------------------------------------------TETAVFAGGCFWC
MSRA_CLOPS      -------------------------------------------------------------VLAGGCFWG
MSRA_METS4      ----------------------------------------------------------ETALFGLGCFWG
MSRA_CLOP1      -------------------------------------------------------------ILAGGCFWG
MSRAB_STRGC     ---------------------------------------------------------------AGGCFWG
MSRA_XANC8      --------------------------------------------------------------FGLGCFWG
MSRA_XANC5      --------------------------------------------------------------FGLGCFWG
MSRA2_RHIME     ----------------------------------------------------ARAAEPQYAIFAGGCFWC
MSRA_XANCP      --------------------------------------------------------------FGLGCFWG
MSRA_XANCB      --------------------------------------------------------------FGLGCFWG
MSRA_XANCH      --------------------------------------------------------------FGLGCFWG
MSRA_THEVU      ------------------------------------------------------------ATFGAGCFWG
MSRA_HELHP      ---------------------------------------------------------------AGGCFWG
MSAB1_STRR6     ---------------------------------------------------------------AGGCFWG
MSAB1_STRPN     ---------------------------------------------------------------AGGCFWG
MSRA_XANAC      --------------------------------------------------------------FGLGCFWG
MSRA_BRUSU      -------------------------------------------------------------LFGMGCFWG
MSRA_BRUSI      -------------------------------------------------------------LFGMGCFWG
MSRA_BRUO2      -------------------------------------------------------------LFGMGCFWG
MSRA_BRUME      -------------------------------------------------------------LFGMGCFWG
MSRA_BRUC2      -------------------------------------------------------------LFGMGCFWG
MSRA_BRUAB      -------------------------------------------------------------LFGMGCFWG
MSRA_BRUA2      -------------------------------------------------------------LFGMGCFWG
MSRA_BRUA1      -------------------------------------------------------------LFGMGCFWG
MSRA_CLOPE      -------------------------------------------------------------ILAGGCFWG
MSRA_CORDI      -----------------------------------------------------GQPGTETIYIGIGCYWG
MSRA_BRUMB      -------------------------------------------------------------LFGMGCFWG
MSRA_UREU1      ---------------------------------------------------------------AGGCFWG
MSRA_OCHAN      -------------------------------------------------------------LFGMGCFWG
MSRA_OCHA4      -------------------------------------------------------------LFGMGCFWG
MSRA_UREPA      ---------------------------------------------------------------AGGCFWG
MSRA_UREP2      ---------------------------------------------------------------AGGCFWG
MSRA_MYCA5      ---------------------------------------------------------------AGGCFWG
MSRA_CORGL      -----------------------------------------------------------------GCFWG
MSRA_COREF      -----------------------------------------------------------------GCFWG
MSRAB_CAMFE     ---------------------------------------------------------------AGGCFWG
MSRA_CORGB      -----------------------------------------------------------------GCFWG
MSRA_CORML      -----------------------------------------------------------------GCFWG
MSRA_ARTAT      ----------------------------------------------------------KTFVLGGGCFWC
MSRA_MARMM      ------------------------------WKSRIIPAEQALPGRADALSPKADTPEGMQEIFLGGCFWG
MSRA1_CAUCR     ----------------------------------------------------------ETAIVAMGCFWG
MSRA_XYLFT      --------------------------------------------------------------FGLGCFWG
MSRA_XYLFM      --------------------------------------------------------------FGLGCFWG
MSRA_XYLFA      --------------------------------------------------------------FGLGCFWG
MSRA_XYLF2      --------------------------------------------------------------FGLGCFWG
MSRA_MYCPE      ---------------------------------------------------------------AGGCFWG
MSRA_YEAST      ---------------------------------------------------------------ACGCFWG
MSRA_XANOP      --------------------------------------------------------------FGLGCFWG
MSRA_XANOM      --------------------------------------------------------------FGLGCFWG
MSRA_DROME      -----------------------------------------------------------TATFGMGCFWG
MSRA_MYCGE      --------------------------------------------------------------FGGGCFWG
MSRA_VIBVU      ----------------------------------------------------SATQGQQEILFGMGCFWG
MSRA_MYCPU      ---------------------------------------------------------------AGGCFWG


                         .         .         *         .         .         .         .:140
query           VQGVFQHVRGVTRVTSGYSGGSASNAQYEMVGTGMTGHAESVEIRYDPTQISYGKLLQIFFSVAHNPTQL
MSRA2_RHILO     VQGVFQHVKGVSKAVSGYTGGAKDDAVYETVGTGRTGHAESVEITYDPSKVTYGQLLQVYFSVAHNPTQL
MSRA2_SYNY3     LEAMFEEVRGVKDVQTGYSGGTEATANYARVSGGGTDHAESIEIVYDPAQVSYGELLKIFFSVGHDPTQV
MSRA_POLSQ      LEAVYQQIQGVKSVVSGYAGGARPNPSYESVCTGATGHAEIVDIEFDPKVVSFRDLLEIFF-VIHNPTTL
MSRA_DEIRA      TEAVMQDLRGVQKVESGYIGGTVPNPDYRSVCGGQTGHAEAVRVTFDPNQISYRDLLGLFFA-THDPTSL
MSRA_HALWD      TEAAMKELAGVNTVTSGYAGGDIDNPTYKQVCSGTTDHAEVVQIEYDPTKIEYSELLEVFFA-THDPTQL
MSRA_PASMU      VEAVFNQIKGVEKATSGYINGTTENPTYKEVCTGETGHAEAVKVEFDATVISYEKLLDIFFSI-HNPTQL
MSRA_TRIEI      VESVFLSVVGVKEVESGYAGGNTKNPDYRSICSGKTGHAEVVKVSFDTEKISLSQILEIFFAT-HDPTTP
MSRA_NATPD      VEAAFEELDGVESVTSGYAGGHTEDPTYREVCSGNTGHAEVVQVAYDSDVLAYEDLLEVFFTV-HDPTQL
MSRA_HALSA      TEAAMEELAGVTDVTSGYAGGDTADPSYRDVCSGTTGHAEVVQVEYDTAELAYEDVLEVFFTV-HDPTTV
MSRA_HALS3      TEAAMEELAGVTDVTSGYAGGDTADPSYRDVCSGTTGHAEVVQVEYDTAELAYEDVLEVFFTV-HDPTTV
MSRA_METHJ      IEAGFQKVPGVINTKVGYMGGHTIEPTYQEVCSDTTGHAETIALEYDDTAITYRKLLEIFFSL-HNPTEV
MSRA_CHRVO      LEAAFSQLKGVERVVSGYCGGHTDSPDYRQVCSGDSGHVEVVEISYDPALIDYATLLQVFFAV-HDPTTL
MSRA_NITSB      LEAIFQRVKGVHRVTSGYAGCRRQNPTYEQVCTGTTKCAEVVKIDFDPHIINYEELLHIFFAV-HDPTQL
MSRA_ACIC5      VEASFRQLHGVQDVAAGYEGGKLDNPTYRDVCTDLTGHAEVVEIDFNPDEIRFEQLLEAFFGL-HDPTQL
MSRA_THET2      TEAAFKLLRGVLEVVPGYAGGHVPHPTYEEVCTGTTGHREAVQVRFDPGVLPYADLLRYFFAV-HDPTSE
MSRA_PICTO      MEAVFKDIYGINDVQPGYAGGTTVNPTYEEVCSQRTGHAETVRIRYDPEKISFDDILEIYFSVI-DPTTL
MSRA_METTH      VEDAFRKVDGVVSTRVGYMGGHLENPTYEDVCTGLTGHAEVVEVTFDPDVVGYSDLLDVFWSI-HDPTTL
MSRA1_RHOBA     TEAVFERMEGVNDVVSGYIGGKIKNPNYKQVCGKMTGHAEAVQIYYDPSKTNFEELLKVFFK-THDPTTL
MSRA_THET8      TEAAFKLLRGVLEVVPGYAGGHVPHPTYEEVCTGTTGHREAVQVRFDPGVLPYADLLRYFFAV-HDPTSE
MSRA_SULAC      TEAVFKRVKGVVSVKPGYSGGKVPNPTYEEVCTDETGHAEVVQITFDPSVITYRELLEIFFEI-HDPTTP
MSRA_SULSO      TEAVYKRVKGVISVKPGYSGGHVPNPTYEDVCTDTTGHAEVVQITFDSSIISYREILEIFFEI-HDPTTL
MSRA_LEPBJ      LEAVYQMVEGIESVVSGYAAGQTKNPDYRSVCSGTTGHAETVQITFDSKVISYFEILEIFW-ISHDPTTL
MSRA_ACIBY      VEAVFLQIRGVEKVTSGYAGGHTTHPTYEQVCQGDTQHAEVVLIDFDEQQVTYSQLLDVFFA-THDPTTL
MSRA_ACIBT      VEAVFLQIRGVEKVTSGYAGGHTTHPTYEQVCQGDTQHAEVVLIDFDEQQVTYSQLLDVFFA-THDPTTL
MSRA_ACIBC      VEAVFLQIRGVEKVTSGYAGGHTTHPTYEQVCQGDTQHAEVVLIDFDEQQVTYSQLLDVFFA-THDPTTL
MSRA_ACIB5      VEAVFLQIRGVEKVTSGYAGGHTTHPTYEQVCQGDTQHAEVVLIDFDEQQVTYSQLLDVFFA-THDPTTL
MSRA_ACIB3      VEAVFLQIRGVEKVTSGYAGGHTTHPTYEQVCQGDTQHAEVVLIDFDEQQVTYSQLLDVFFA-THDPTTL
MSRA_LACSS      MVHPFDQQPGILKVVSGYTGGHVANPTYEQVCSHTTGHTEAVEITFDPAVISYAELVEIYWRQT-DPTDA
MSRAB_NEIMB     LEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVV-DPTSL
MSRAB_NEIMA     LEAYFQRIDGVVDAVSGYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVV-DPTSL
MSRA_METMJ      VEEAFRRVPGVVETAVGFMGGTVENPTYPEVCTGRTGHAEVVQVTYDPGTVSYRALLDTFWD-AHDPTTP
MSRA_LEPBL      LEAVYQMVEGIESVVSGYAAGQTKNPDYRSVCSGTTGHAETVQITFDSKVISYFEILEIFW-ISHDPTTL
MSRA_GRABC      VEAVLRELNGVASIRPGYAGGHTANPTYKEVCTGTTFHAEVVEVTFDPAILSYVDLLRIFLTI-HDPTTP
MSRA_ERWT9      TEAVFKQIHGVVSVESGYIGGHTENPTYKQVCGGDTGHAEAIRIGFDPEKVSFGDLLDISFA-THDPTQL
MSRA_ACIBS      VEAVFLQIRGVEKVTSGYAGGHTTHPTYEQVCQGDTQHAEVVLIDFDEQQVTYSQLLDVFFA-THDPTTL
MSRA_VESOH      VEAIFQRIVGIIKLTSGYCNGNTSNPTYQDICLGVTGHAEVVKIEFDEFKISFKVLLDIFFEI-HNPTTL
MSRAB_NEIGO     LEAYFQRIDGVVDAVSGYANGNTENPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYYFRVV-DPTSL
MSRA_RUTMC      VEAIFQRIEGVVKLTSGYCNGNTVDPTYQDICTGTTGHAEVVKVEFYELKVSFKTLLNIFFEI-HNPTTK
MSRAB_TREPA     TEAYFXXXXXXXXXXXXYTGGTTKSPTYRNVCTGTTGHAEAVEILFDPQVISYEDLLKHFFRM-HDPTSL
MSRA_METBU      VEAAFSKVEGVISTKVGYTGGTLKDPTYKDVSTGSTGHAESIDIIFDESVITYGELLEVLWN-THDPTTK
MSRA_GEOMG      VEAEFRRVSGVVATHAGYMGGWKDHPTYEEVCSKETGHAEVVEVVYDPARVSYDELLRIFWTI-HDPTQL
MSRA_SALPB      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVISYEQLLQIFWE-NHDPTQG
MSRA_LEUMM      MVQPFDSLDGIEKVRSGYTGGHVENPTYEQVLTHTTGHTEAVKIWFDSEKISYRELVEIYWEQT-DPTDA
MSRA_STAAC      MTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVI-DPLDT
MSRA1_STAAW     MTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVI-DPLDT
MSRA1_STAAS     MTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVI-DPLDT
MSRA1_STAAR     MTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVI-DPLDT
MSRA1_STAAN     MTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVI-DPLDT
MSRA1_STAAM     MTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVI-DPLDT
MSRA1_STAA8     MTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVI-DPLDT
MSRA_SALTY      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVISYEQLLQTFWE-NHDPTQG
MSRA_SALSV      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQIFWE-NHDPTQG
MSRA_SALNS      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVISYEQLLQTFWE-NHDPTQG
MSRA_CLAM3      LDAVYRTLDGVQDVISGYIGGHTAHPSYDAVCTGATGHAEAVKVVFDEEVIPADVILDVFFTL-HDPRQL
MSRA_RHOCS      VERKFWQVPGVYSTAAGYAGGPTPNPTYEEVCTGRTGHAEVVLVVYDPATVSYAELLKVFWE-NHDPTQG
MSRA_SALTI      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWE-NHDPTQG
MSRA_SALPK      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWE-NHDPTQG
MSRA_SALPC      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWE-NHDPTQG
MSRA_SALPA      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWE-NHDPTQG
MSRA_SALHS      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWE-NHDPTQG
MSRA_SALG2      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWE-NHDPTQG
MSRA_SALEP      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWE-NHDPTQG
MSRA_SALDC      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWE-NHDPTQG
MSRA_SALCH      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWE-NHDPTQG
MSRA_SALAR      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRVVYDPAVISYEQLLQVFWE-NHDPAQG
MSRA_ESCF3      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGETGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_SALA4      VERLFWQLPGVYSTAAGYAGGYTPNPTYREVCSGQTGHAEAVRIVYDPAVIRYEQLLQTFWE-NHDPTQG
MSRA_KLEP3      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGQTGHAEAVRVVYDPQVISYEQLLQVFWE-NHDPAQG
MSRA_ENTS8      VERLFWALPGVYSTAAGYTGGYTPNPTYREVCSGQTGHAEAVRVVYDPNVISYEQLLQVFWE-NHDPAQG
MSRA_SHIB3      VESLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECO5E      VERLFWQLHGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECO57      VERLFWQLHGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECO27      VERLFWQLHGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA1_RHILO     MQDLIRRYPGVISTRVGYSGGDVANATYRNHGT----HAEAIEINFDPAVISYRTLLERFFQI-HDPTTR
MSRA_SHISS      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_SHIFL      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_SHIF8      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_SHIBS      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_LACS1      MVEPFDKMPGIISVRSGYTGGFVENPTYEQVCSHTTGHTEAVKIVFDPEIISYAELVNIYWRQT-DPTDA
MSRA_GEOSL      VEEEFRRVPGVVSTLAGYMGGWKEHPTYEEVCSKTTGHAEVVEVTFDPAAVTYDHLLRVFWD-CHDPTQL
MSRA_ECOSM      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECOLU      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECOLI      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECOLC      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECOHS      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECODH      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECOBW      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECO8A      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECO81      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECO7I      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECO55      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECO45      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_ECO24      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_PSEFL      MQDLLRRYPGVLHTRVGYTGGDVPNATYRNHGN----HAEAIEIVFDPAVISYRQILEFFFQI-HDPSTP
MSRA_LACRD      MVQPFDTYPGIEKVESGYTGGHVANPTYEQVCSGTTGHTEAVKITFDPDKISYKDLVEIYWHQT-DPTDA
MSRA2_LACLA     MVQPFEEREGILSVISGYTGGNVENPTYEQVKKHLTGHTEAVEIIFDNSKITYQSLVELYWTLT-DPTDA
MSRA_ARATH      VELAYQRVPGVTKTEVGYSHGIVHNPSYEDVCTGTTGHNEVVRVQYDPKECSFESLLDVFWN-RHDPTTL
MSRA_CLAMS      LDAVYRTLDGVQDVISGYIGGHTAHPSYDAVCTGATGHAEAVKVVFDEEVIPADVILDVFFTL-HDPRQL
MSRA_SHIDS      VERLFWQLPSVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQIFWE-NHDPAQG
MSRA_PSEU2      AERRLWQQEGVVSTVAGYAGGFTPNPTYEEVCSGLTGHTEVVLVVYEPAKISYEELLKVFWEV-HNPTQG
MSRA_CLOBK      VEEYMSRIKGIVETKVGYANGIKENPSYEEVCSGTTGHAEACYIKYDESIISLEELLNKFWSII-DPTVL
MSRA2_STAAR     MVKPFTSYPGIKSVVSGYSGGHADNPTYEQVCTNQTGHVEAVQITFDPEVTSFENILDIYFK-TFDPTDD
MSRA_ECOL5      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_CLOBJ      VEEYMSRIEGIVETKVGYANGIKENPSYEEVCSGVTGHAEACYIKYDESIISLEELLNKFWSII-DPTVL
MSRA_CLOBH      VEEYMSRIEGIVETKVGYANGIKENPSYEEVCSGVTGHAEACYIKYDESIISLEELLNKFWSII-DPTVL
MSRA_CLOB1      VEEYMSRIEGIVETKVGYANGIKENPSYEEVCSGVTGHAEACYIKYDESIISLEELLNKFWSII-DPTVL
MSRA_ENT38      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGETGHAEAVRIVYDPSVTRYEQLLQVFWE-NHDPAQG
MSRA_ECOSE      VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRA_CLOBL      VEEYMSRIKGIVETKVGYANGIKENPSYEEVCSGTTGHAEACYIKYDESIISLEELLNKFWSII-DPTVL
MSRA_ECOL6      VERLFWQLPGVYSTAAVYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWE-NHDPAQG
MSRAB_HAEIN     MEAYMERIHGVKDAISGYANGNTEKTSYQMI--GLTDHAETVKVTYDANQISLDKLLKYYFKVI-DPTSV
MSRA2_STAAW     MVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQITFDPEVTSFENILDIYFK-TFDPTDD
MSRA2_STAAS     MVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQITFDPEVTSFENILDIYFK-TFDPTDD
MSRA2_STAA8     MVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQITFDPEVTSFENILDIYFK-TFDPTDD
MSRA_AZOC5      AERAFWRTPGVWVTAVGYLAGLTPNPTYEEVCSGRTGHTEGVLVVYDPAVISYADLVKLFFE-SHDPTQG
MSRA3_RHIME     MQDLIRKLPGVIETRVGYTGGDVPNATYRNHGT----HAEGIEIIFDPERISYRRILELFFQI-HDPTTK
MSRA2_STAAN     MVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNKTGHVEAVQITFDPEVTSFENILDIYFK-TFDPTDD
MSRA2_STAAM     MVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNKTGHVEAVQITFDPEVTSFENILDIYFK-TFDPTDD
MSRA_NITWN      MQALLRRYPGVISTRVGYTGGDVPDATYRNHGD----HAEAIEVNFDPTVTSYRQLLEFFFQI-HDPTTE
MSRA_LISIN      MVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAVEITFDPAVFPYEKLVEVYWQQT-DPTDA
MSRA_LEIXX      MQDLIRKRPGVLRTRVGYTGGDVPNATYRNHGS----HAEAIEIEFDPSRIGYRDLLEFFFQI-HDPSTA
MSRA_DICDI      VELLFQRVAGVTKTRVGYTNGTVENPTYRQVCSGKTGCAEAVELEYDPEKVTYNQLLGLFWS-KHDPTTL
MSRA_CLOBM      VEEYISRIQGIVKTKVGYANGTKENPSYEEVCSGVTRHAEACYIKYDESIISLEELLNKFWSII-DPTVL
MSRA_CYAP8      AERKFWQCEGVYTTAVGYAAGITPNPTYQEVCTGLTGHNEVVLVVFDPKIISYEELLKVFWE-SHNPTQG
MSRA_METMA      IEEAFRQIKGVVATAVGYSGGHFKRPTYEQVCTLDTGHAEAVRVIFDPEIVSYKTLLDVFWKI-HDPTTK
MSRA_LISW6      MVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAIEITFDPAIFPYEKLVEVYWQQT-DPTDA
MSRA_SALTO      AERLFWTLPGVLTTSVGYAGGYTPNPSYDEVCSGRTGHAEVVHVRYDPTKITYEDLLKVFWE-NHDPTQG
MSRA_PSESM      AERRLWQQEGVVSTVAGYAGGFTPNPTYEEVCSGLTGHTEVVLVVYEPEKISYDSLLKVFWE-AHNPTQG
MSRA_STRU0      MVQPFEELDGIVSVRSGYTGGHVPNPSYEQVCSKTTGHTEAVEIIFDPQKIDYSDLVELYWQQT-DPTDA
MSRA_STRPM      MVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPEEISYKELVELYW-VQTDPTDA
MSRA_STRP3      MVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPEEISYKELVELYW-VQTDPTDA
MSRA_LISMO      MVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQQT-DPTDA
MSRA_LISMH      MVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQQT-DPTDA
MSRA_STREM      MVQPFEEQAGILSVRSGYTGGHVPNPSYEQVCSKTTGHTEAVEIIFDPSLISYSDLVELYWAQT-DPTDA
MSRA_STRCO      MEELIRRLPGVTATRVGYTGGDVPNATYRNHGT----HAEAIEILFDPEATDYRALLEFFFQI-HDPSTK
MSRA_PELUB      PEIKFSKLEGVIKTEVGYCGGDSKTVTYKEVCTCNTNHAEVVKLDFDPKIISYEKILNFFFEI-HDPTTL
MSRA_METAC      IEEAFRQVKGVVATAVGYSGGHFEKPTYEQVCTLDTGHAEAVRVIFDPKVVSYKNLLDVFWKI-HDPTTK
MSRA_LISMF      MVKPFDTQPGIEKVISGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQQT-DPTDA
MSRA_LISMC      MVKPFDTQPGIEKVISGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQQT-DPTDA
MSRA_BACA2      MVKPFDEQPGIEKVVSGYTGGHTENPTYEEVCSETTGHREAVQITFQPDIYPYEKLVELFWQQI-DPTDA
MSRA2_RHOBA     MQDLIRKLPGIESTRVGYTGGEVPNATYRNHGN----HAEGIEILFDPEKTSYRQLLEFFFQI-HDPTTP
MSRA_STRPG      MVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPEEISYKELVELYWAQT-DPTDA
MSRA_STRP8      MVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPEEISYKELVELYWAQT-DPTDA
MSRA_STRP6      MVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPEEISYKELVELYWAQT-DPTDA
MSRA_STRE4      MVQPFEEQAGILSVRSGYTGGHVHNPSYEQVCSKTTGHTEAVEIIFDPSLISYSDLVELYWAQT-DPTDA
MSRA_SERP5      VERLFWQQQGVYSTAAGYSGGYTPNPTYREVCSGQTGHTEVVRVVFDPKIISYKQLLQVFWE-NHDPAQG
MSRA_DICD3      VERLFWQQPGVYSTASGYCGGYTPNPTYREVCTGKTGHAEAVRVVFDPAVVSYPQLLQLFWE-NHNPAQG
MSRA_STRAW      MEDLIRRLPGVTATRVGYTGGDVPNATYRNHGT----HAEAIEILFDPARTDFRAILEFFFQI-HDPSTK
MSRA_STRA3      MVQPFEELDGIESVLSGYTGGHVENPTYKEVCSKTTGHTEAVEIIFNPEKISYANLVELYWAQT-DPTDA
MSRA_MYCLE      IQNLFRRQPGVISTRVGYTGGGTPNATYRNHGM----HAEAVEIIYDPAITDYRTLLEFFFQI-HDPTTR
MSRA_MYCLB      IQNLFRRQPGVISTRVGYTGGGTPNATYRNHGM----HAEAVEIIYDPAITDYRTLLEFFFQI-HDPTTR
MSRA_HUMAN      AERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWE-NHDPTQG
MSRA2_ANASP     AERKFWQQQGVYSTAVGYAAGFTPNPTYDEVCTGLTGHNEVVLVVFDPKVISYTQLLKVFWE-SHNPTQG
MSAB2_STRR6     VEEYFSRVPGVTDAVSGYANGRGETTKYELI--NQTGHAETVHVTYDAKQISLKEILLHYFRII-NPTSK
MSAB2_STRPN     VEEYFSRVPGVTDAVSGYANGRGETTKYELI--NQTGHAETVHVTYDAKQISLKEILLHYFRII-NPTSK
MSRA_STRPZ      MVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPKQIAYKDLVELYWAQT-DPTDA
MSRA_STRPD      MVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPKQIAYKDLVELYWAQT-DPTDA
MSRA_STRPC      MGQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPKQIAYKDLVELYWAQT-DPTDA
MSRA_STRPB      MVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPKQIAYKDLVELYWAQT-DPTDA
MSRA_STRP1      MVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPKQIAYKDLVELYWTQT-DPTDA
MSRA_STRA5      MVQPFEELDGIESVLSGYTGGHVENPTYKEVCSKTTGHTEAVEIIFNPEKISYADLVELYWAQT-DPTDA
MSRA_STRA1      MVQPFEELDGIESVLSGYTGGHVENPTYKEVCSKTTGHTEAVEIIFNPEKISYADLVELYWAQT-DPTDA
MSRA_RALSO      TEAXXXXXXXXXXXXXXYAGGHLERPTYRAVCGGDTGHAEVVRVEFDPAVIPYREILDIFFA-THDPTTL
MSRA_PSYWF      TESVFQSVKGVQKVTSGYMGGEDANANYKDVCSGTTGHIEVVRVDFDDTIVPLEVVLDIFFA-THDPTTR
MSRA_BACSU      MVKPFDEQPGIEKVVSGYTGGHTENPTYEEVCSETTGHREAVQITFHPDVFPYEKLLELFWQQI-DPTDA
MSRA_BACP2      MVKPFDEQPGIIKVESGYTGGHTVNPTYEEVCTNTTGHREAVQITFDPDIFPYEKLLELYWQQI-DPTDD
MSRA_BACHD      MVQPFDKQPGIESVVSGYAGGTVENPTYEQVKTGTTGHYEVVHITYVPELFPFEKLLSLYWPQI-DPTDP
MSRA_BACLD      MVKPFDEQPGILKVESGYTGGHTENPTYEEVCSNTTGHREAVQITFDPDVFPYEKLLELYWQQI-DPTDS
MSRA_STRS7      MVQPFEEQAGILSVRSGYTGGHVPNPSYEQVCSKTTGHTEAVEIIFDPSLISYSDLVELYWAQT-DPTDA
MSRA_NOCFA      MQDLIRRQPGVVSTRVGYTGGTNDHPTYR----NHPGHAEAVEIVYDPERTDYRALLEFFFQI-HDPTTK
MSRA_MOUSE      AERKFWVLKGVYSTQVGFAGGHTRNPTYKEVCSEKTGHAEVVRVVYRPEHISFEELLKVFWE-NHDPTQG
MSRA_PSYCK      TESVFLSVKGVQSVISGYMGGDAVSANYEAVCGGNTGHVEVIKVEFDESIVPLEVILDVFFA-THDPTTM
MSRA_CLOB6      VEEYMSRIKGIVETKVGYANGIKENPSYKVVCSGTTGHAEACYIKYDESIISLEELLNKFWNII-DPTVL
MSRA_PSEMY      AERRFWQQPGVFSTAVGYAGGFTPNPTYEEVCSGLTGHTEVVLVVFDPQQTSFDALLKVFWE-AHNPTQG
MSRA_MYCTU      LQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGT----HAEAVEIIFDPTVTDYRTLLEFFFQI-HDPTTK
MSRA_MYCTA      LQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGT----HAEAVEIIFDPTVTDYRTLLEFFFQI-HDPTTK
MSRA_MYCBT      LQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGT----HAEAVEIIFDPTVTDYRTLLEFFFQI-HDPTTK
MSRA_MYCBP      LQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGT----HAEAVEIIFDPTVTDYRTLLEFFFQI-HDPTTK
MSRA_MYCBO      LQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGT----HAEAVEIIFDPTVTDYRTLLEFFFQI-HDPTTK
MSRA1_LACLA     MVEPFEERPGILAVTSGYTGGHIEYPTYDQVLSKASGHTEAVEILFDNELISYDELLDIYWSLI-DPTDA
MSRA_ARTS2      LDAVYQKTKGVTSVISGYTGGHDRHPDYYSVCSGTTGHAEVVAVSFEEDVIPAEVILDMFFAL-HDPTTL
MSRA_ARTCA      LDAVYQKTKGVTAVVSGYTGGHDPYPDYYSVCSGTTGHAEVVAVTFDEEIIPAEVILDMFFAL-HDPTTL
MSRA_RAT        AERKFWLLKGVYSTQVGFAGGYTRNPTYKEVCSEKTGHAEVVRVVYRPEHVSFEELLKVFWE-NHDPTQG
MSRA_MYCMM      MQDLIRKQPGVIATRVGYSGGDVANATYRNHGT----HAEAVEIIFDPQATDYRTLLEFFFQI-HDPTTP
MSRA_METCA      AERRFWTLPGVYSTAVGYAGGSTPNPTYDEVCTGRTGHAEVVLVVYEPDKVGFDALLQVFWT-SHDPTQG
MSRA_STRMU      MVQPFEEQDGILSVRSGYTGGHVVNPTYEQVCSKMTGHTEAVEIIFDESKISYADLVEIYWRQT-DPTDS
MSRA_MYCPA      MQELIRKQPGVVSTRVGYTGGDVPNATYRNHGT----HAEAVEIIYDPAVTDYRQILEFFFQI-HDPTTK
MSRA_METM7      AEELFRHVDGVISTEVGYMGGNVKNPTYGQVCRGKSGHIEVVKVSYDSKIITYDDLLELFWK-NHDPTTP
MSRAB_ACTAC     IEAYMERIYGVEDAISGYANGKSDKTNYQKI--GITDHAETVKVTYDRNKVSLDKLLKYYFQVI-DPTSV
MSRA_SCHPO      VQEVYLRAAAILKTSVGYTGGITADPTYKEVCTNTTNHAEALKIEFDEKLTSYDKIIEFFFAM-HDPTTS
MSRA_PSYA2      TESVFLSVKGVESVISGYMGGNAVSANYEAVCGGDTGHIEVIKVKFNESTVPLEVILDVFFA-THDPTTM
MSRA_PSEPG      AERRFWQREGVVSTVVGYAGGFTPHPTYEEVCSGLTGHTEVVLVVFDKDKVSYRELLAMFWEL-HNPTQG
MSRA_PHOPR      AERLFWNLPGIYSTAVGYSGGFTPNPTYEEVCSGKTGHSEVVRIIYDPLIISLEQILTLFWE-SHNPTQG
MSRA_BRANA      AELAYQRVPGVTKTEVGYSHGFVDNPTYEDVCSETTGHNEIVRVQYDPKEVSFESLLDVFWK-RHDPTTL
MSRAB_STRP8     VEEYFSQVDGVLDAVSGYANGRGDTTNYQLI--HQTGHAETVEVAYDTNRISLKELLLHFFRII-DPTSL
MSRAB_STRP6     VEEYFSQVDGVLDAVSGYANGRGDTTNYQLI--HQTGHAETVEVAYDANRISLKELLLHFFRII-DPTSL
MSRAB_STRP1     VEEYFSQVDGVLDAVSGYANGRGDTTNYQLI--HQTGHAETVEVAYDANRISLKELLLHFFRII-DPTSL
MSRA_SACD2      AERKFWQLPGVYVTAVGYSAGFTPNPTYEEVCSGSTGHNEVVLVVYNPSQVSFKKLLAVFWE-SHNPTQG
MSRA_PSEPW      AERRFWQREGVVSTVVGYAGGFTPNPTYEEVCSGLTGHTEVVLVVFDKDKVSYRELLAMFWEL-HNPTQG
MSRA_CAMJJ      VEAVFERLKGVIDTEVGYSGGN-PNPSYESVCNG-DGNIEVVKINYDEKQISLLEILTLFFKI-HDPTSI
MSRA_CAMJE      VEAVFERLKGVINTEVGYSGGK-PNPSYESVCNG-DGNIEVVKINYDEKQISLLEILTLFFKI-HDPTSI
MSRA_CAMJ8      VEAVFERLKGVIDTEVGYSGGN-PNPSYESVCNG-DGNIEVVKINYDEKQISLLEILTLFFKI-HDPTSI
MSRA_YERE8      VERLFWQQPGVYSTAAGYSGGYTPNPTYHEVCSGRTAHAEVVRVVFDPAIISYKQLLQIFWE-NHDPAQG
MSRA_MYCSS      MQDLIRKQPGVVSTRVGYTGGQNDHPTYR----NHPGHAESIEITYDPAQTDYRALLEFFFQI-HDPTTK
MSRA_MYCSK      MQDLIRKQPGVVSTRVGYTGGQNDHPTYR----NHPGHAESIEITYDPAQTDYRALLEFFFQI-HDPTTK
MSRA_MYCGI      MQDLIRKQPGVVSTRVGYTGGQNDHPTYR----NHPGHAEAIEIVYDPAQTDYRALLEFFFQI-HDPTTK
MSRA_METMP      AEEVFRKINGVVSTEVGFMGGTIKNPTYGQVCRGKSGHIEVVKIDYDPEIISYDELLDLFWN-NHNPTTP
MSRA_ERWCT      AERLFWQQPGIYSTAAGYIGGYTPNPTYREVCSGQTDHAEAVRVVFDPATISYSQLLQLFWE-NHDPAQG
MSRA_SOLLC      VELAFQRVGGVVKTEVGYSQGNVHDPNYKLICSGTTEHAEAIRIQFDPNVCPYSNLLSLFWS-RHDPTTL
MSRA_PSEE4      AERRFWQREGVVSTVVGYAGGFTPNPTYEEVCSGLTGHTEVVLVVFDKNKVSYHDLLTMFWEL-HNPTQG
MSRA_MYCVP      MQDLIRKQPGVVSTRVGYTGGQNDHPTYR----NHPGHAEAIEIVYDPAQTDYRALLEFFFQI-HDPTTK
MSRA_MYCSJ      MQDLIRKQPGVVSTRVGYTGGQNDHPTYR----NHPGHAESIEITYDPAQTDYRALLEFFFQI-HDPTTK
MSRA_METM5      AEELFRKIKGVISTEVGFMGGTVKNPTYGQVCRGKSGHIEVVNITYNPKIVKYTDLLNLFWN-NHDPTTP
MSRA_PSEPK      AERRFWQREGVVSTVVGYAGGFTPHPTYEEVCSGLTGHTEVVLVVFDKDKVSYRELLAMFWEL-HNPTQG
MSRA_MYCUA      MQDLIRKQPGVIATRVGYSGGDVANATYRNHGT----HAEAVEIIFDPQATDYRTLLEFFFQI-HDPTTP
MSRA_CAMJR      IEAVFERLKGVINTEVGYSGGK-PNPSYESVCNG-DGNIEVVKINYDEKQISLLEILILFFKI-HDPTSI
MSRA_SALAI      AERLFWTLPGVLTTSVGYAGGYTPNPSYEEVCSGRTGHAEVVQVRYDPTKIAYEDLLKVFWE-NHDPTQG
MSRA_VIBCM      AERLFWQLDGVISTSVGYSGGFTPNPTYEEVCSGKTGHTEVVRVIFDPERLPLTELLRAFWE-RHDPTQG
MSRA_VIBCH      AERLFWQLDGVISTSVGYSGGFTPNPTYEEVCSGKTGHTEVVRVIFDPERLPLTELLRAFWE-RHDPTQG
MSRA_VIBC3      AERLFWQLDGVISTSVGYSGGFTPNPTYEEVCSGKTGHTEVVRVIFDPERLPLTELLRAFWE-RHDPTQG
MSRA_STRGG      AERKFWQTEGVWTTLVGYQGGYTENPSYEEACSGLTGHTEAVRVVFDPAVVSYEELLKLFWE-SHNPTQG
MSRA_PSE14      AERRLWQQEGVVSTVVGYAGGFTPNPTYEEVCSGLTAHTEVVLVVYEPEKISYKSLLKVFWE-AHNPTQG
MSRA_CLOPH      GEKYFSLIHGVLSTKVGYANGTTSNPTYEEVCHNNTGHAETVEIQYDDSILPLEKLLRLYYEVI-DPTSV
MSRA_PECCP      VERLFWQQPGIYSTAAGYIGGYTPNPTYREVCSGQTDHAEAVRVVFDPAVISYDQLLQLFWE-NHDPAQG
MSRA_CLOAB      VEAYFNTIDGVLNTKVGYANGNTEDPTYEDVCTDSTGYAEACYIEYDEKQLKLEKLIDAYWKVV-DPTLK
MSRAB_VIBCH     TESDMEKLPGVVDVISGYAGGDVDNPTYKQVSSGKTGHIEVIQVTFDPKIVTYEQVLDNFFRHI-DPTDD
MSRAB_STRP3     VEEYFSQVDGVLDAVSGYANGRGDTTNYQLI--HQTGHAETVEVTYDANRISLKELLLHFFRII-DPTSL
MSRA_ALKMQ      VEAYMERIDGVVETKVGYANGHVENPSYEEVCSSQTGHAEVCYIKFDETKISLEILLNGFWKII-DPTVE
MSRA_BOVIN      AERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVVFQPEHISFEELLKVFWE-NHDPTQG
MSRA1_SYNY3     AERKFWQIPGVYSTAVGYAAGYTPNPTYQEVCTGMTGHNEVVLVAFDPQQVSYDQLLKVFWE-SHNPTQG
MSRA_NAUPA      LDAXXXXXXXXXXXXXXXXXXXXPNPNYEQVCTGVTGHAEVVEIDYDENTVSYDELLDIFFKI-HDPTQL
MSRA_CLOTE      VEEYFSRIYGVVDTKVGYVNGVTKNPSYEEVCNGNTGYAEGCYIKFDESIIGLKRILDKFWDII-DPTIL
MSRA_VIBPA      AERLFWQLDGVVSTSVGYAGGFTPNPTYEEVCTGKTGHTEVVRVVFDERVISLAQLLAVFWE-KHDPTQG
MSRAB_HELPY     LEAYMERIYGVIDASSGYANGKTSSTNYEKLHE--SDHAESVKVIYDPKKISLDKLLRYYFKVV-DPVSV
MSRA_MYCPN      TQKYFDLIKGVQKTSVGYLNSNMKNPTYEQVCSGQTNAVEAVFVEYDENKVSLNELIDAFFKVI-DPTIR
MSRA_METNO      AERKFWQLGDGIWVTAGYAAGTTPNPTYEEVCTGLTGHNEVVLVAYDPAAMPFERLLKTFWE-SHDPTQG
MSRA_METM6      AEELFRKINGVISTEVGFMGGNIKNPTYGQVCRGRSGHIEVVNIIYNPKILKYDDLLELFWN-NHDPTTP
MSRA_LACSA      VELAFQRVPGVSKTEVGYTQGFLHNPTYNDICSGTTNHSEVVRVQYDPKACSFDSLLDCFWE-RHDPTTL
MSRA_CAMJD      VEAVFERLKGVIDTEVGYSGGN-PNPSYESVCNG-DGNIEVVKINYDEKQIPLLEILTLFFKI-HDPTSI
MSRA_AZOVD      AERRFWQQPGVWTTAVGYAGGLTPNPTYEEVCSGLTGHTEVVLVVFDPQETDYRTLLKVFWEI-HDPTQG
MSRA_PSEAE      AERRLWQQPGVWVTAVGYAGGYTPNPTYDEVCSGLTGHSEVVLVVYNPQETSFEQLLKVFWE-AHDPTQG
MSRA_PSEAB      AERRLWQQPGVWVTAVGYAGGYTPNPTYDEVCSGLTGHSEVVLVVYNPQETSFEQLLKVFWE-AHDPTQG
MSRA_PSEA8      AERRLWQQPGVWVTAVGYAGGYTPNPTYDEVCSGLTGHSEVVLVVYNPQETSFEQLLKVFWE-AHDPTQG
MSRA1_ANASP     VEAAFRKVKGVVSTSVGYMGGHFPNPCYLDVLSRITGHAEVVQIEYDPQLVSYEDLLAVFWDI-HDPTTL
MSRA1_RHIME     AERLLWEIPGVYVTAAGYSGGLTPNPTYQETTTGLTGHTEVVLVVYDPAKVSLQRLLKTFFE-EHDPTQG
MSRA_YERPY      AERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWE-NHDPAQG
MSRA_YERPS      AERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWE-NHDPAQG
MSRA_YERPP      AERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWE-NHDPAQG
MSRA_YERPN      AERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWE-NHDPAQG
MSRA_YERPG      AERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWE-NHDPAQG
MSRA_YERPE      AERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWE-NHDPAQG
MSRA_YERPB      AERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWE-NHDPAQG
MSRA_YERPA      AERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWE-NHDPAQG
MSRA_YERP3      AERLFWQQPGVYSTAAGYSGGHTPNPTYHEVCSGRTGHAEVVRVVFDPAVISYQQLLQIFWE-NHDPAQG
MSRA_RHORT      VEETFRKIPXXXXXXXXXXXXHFKEPTYRQVCAGDTGHAEAVRVDYDPDKVTYEQLLDVFWA-AHDPTQV
MSRA_FRASN      AERKFWQVPGVYSTAVGYAGGITPNPTYEEACSGLTGHTEAVLVVFDPAKVSFAELLRVFWE-AHDPTQG
MSRA_AGRT5      AERLFWKTPGVWVTAVGYAGGFTRNPTYHETTTGQTGHAEVVKVVYDPAVISLSGLLKIFFE-EHDPTQG
MSRA_MAGSA      AERLFWKTGGVYSTSVGYTGGFTLNPTYEEVCSAQTGHTEAVLVAFDPAEVSYTALLRLFWE-GHNPTQG
MSRAB_HELPJ     LEAYMERIYGVIDASSGYANGKTSSTNYEKLHE--SDHAESVKVIYDPKKISLDKLLRYYFKVI-DPVSV
MSRA_PHOLL      VERLFWQQPDIXXXXXXXXXXXXXNPTYEEICSGLTGHAEVVRIVYDPAKNSYENLLKLFWE-NHDPAQG
MSRA_FRAAN      SELRFQRVVGVIKTEVGYSQGHVHDPNYRLVCSGTTNHSEVVRVQFDPQVCPYSDLLSVFWS-RHDPTTL
MSRA_CORK4      AEKLFWQIDGVESTAVGYAGGYTPNPTYREVCTGRTGHAETVRVIYDPQEVSFEDLIRTFFE-AHDPTQG
MSRA2_CAUCR     MEHDMQGVPGVLKVESGYTGGHLKNPTYRDVTSETSGHYEAVRVTYDPAKLDYGFLLYRYWRLV-DPTDD
MSRA_CLOPS      VEEFLSRINGVVSTEVGYANGRTENPTYEDICTKNTYFAEVCLVNYDENIISLKELLAKFWTII-DPTSL
MSRA_METS4      AERKFWQLGDGIWVTAGYAAGTTPNPTYEEVCTGLTGHNEVVLVAYDPAVLPFGQLLRTFWE-SHDPTQG
MSRA_CLOP1      VEEFLSRINGVVSTEVGYANGRTENPTYEDICTKNTYFAEVCLVNYDENIISLKELLAKFWTII-DPTSL
MSRAB_STRGC     LEEYFSRIEGVKKTTVGYANGQVESTNYQLI--HQTDHAETVHLIYDEKRVSLREILLYYFRVI-DPLSV
MSRA_XANC8      AERKFWNVPGVYTTAVGYAGGKTPNATYSEVCSGQTGHTEAVLVVYDAQAVSFEQLLRTFWE-SHDPTQG
MSRA_XANC5      AERKFWNVPGVYTTAVGYAGGQTPNATYSEVCSGQTGHTEAVLVVFDEQAVSFAQLLRTFWE-SHDPTQG
MSRA2_RHIME     VESDFDAVPGVLETISGYAGGKSANPTYEDYAKG--GHREVVRVKFDPDRVSYAELVGVLFRTT-DPTDG
MSRA_XANCP      AERKFWNVPGVYTTAVGYAGGKTPNATYSEVCSGQTGHTEAVLVVYDAQAVSFEQLLRTFWE-SHDPTQG
MSRA_XANCB      AERKFWNVPGVYTTAVGYAGGKTPNATYSEVCSGQTGHTEAVLVVYDAQAVSFEQLLRTFWE-SHDPTQG
MSRA_XANCH      AERKFWNVPGVYTTAVGYAGGQTPNATYSEVCSGQTGHTEAVLVVFDEQAVSFAQLLRTFWE-SHDPTQG
MSRA_THEVU      VEETFRQVPGVIDTAVGYMGGTTENPTYEEVCTDKTGHAEVVQVEYDPEQVSYEELLNVFWD-NHNPTTL
MSRA_HELHP      IQGYFDKLKGTLCSQVGYANSAVENPSYEFVCSGNSGAVEALELHYDEDLLPLREIIGRFLSVI-NPCAL
MSAB1_STRR6     LEEYFSRISGVLETSVGYANGQVETTNYQLLKE--TDHAETVQVIYDEKEVSLREILLYYFRVI-DPLSI
MSAB1_STRPN     LEEYFSRISGVLETSVGYANGQVETTNYQLLKE--TDHAETVQVIYDEKEVSLREILLYYFRVI-DPLSI
MSRA_XANAC      AERKFWNVPGVYTTAVGYAGGQTPNATYSEVCSGQTGHTEAVLVVFDDHAVSFAQLLRTFWE-SHDPTQG
MSRA_BRUSU      AERLFWQXXXXXXXXXXXXXXITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWE-EHDPTQG
MSRA_BRUSI      AERLFWQXXXXXXXXXXXXXXITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWE-EHDPTQG
MSRA_BRUO2      AERLFWQXXXXXXXXXXXXXXITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWE-EHDPTQG
MSRA_BRUME      AERLFWQXXXXXXXXXXXXXXITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWE-EHDPTQG
MSRA_BRUC2      AERLFWQXXXXXXXXXXXXXXITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWE-EHDPTQG
MSRA_BRUAB      AERLFWQXXXXXXXXXXXXXXITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWE-EHDPTQG
MSRA_BRUA2      AERLFWQXXXXXXXXXXXXXXITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWE-EHDPTQG
MSRA_BRUA1      AERLFWQXXXXXXXXXXXXXXITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWE-EHDPTQG
MSRA_CLOPE      VEEFLSRINGVVSTEVGYANGRTENPTYEDICTKNTYFAEVCLVNYDENIISLKELLAKFWTII-DPTSL
MSRA_CORDI      AEKLFWETPGVVYTSVGFAGGITPNPTYRETCTGRTNHTEIVEVVYDPTQVTFDELV-VKAMEAHDPTQG
MSRA_BRUMB      AERLFWQXXXXXXXXXXXXXXITPNPTYEETCTGLTGHAEVVLVVYDPKVVTLNELLALFWE-EHDPTQG
MSRA_UREU1      IQKYFDSIKGVRHTIVGYSQGNVINPSYEQVCTQTTNHTETVQVDYDDRFVSLTSILEHLYQII-DPFSL
MSRA_OCHAN      AERLFWQXXXXXXXXXXXXXXXXXNPTYEETCTGLTGHAEVVLVVYDPKVVSLDELLTLFWE-EHDPTQG
MSRA_OCHA4      AERLFWQXXXXXXXXXXXXXXXXXNPTYEETCTGLTGHAEVVLVVYDPKVVSLDELLTLFWE-EHDPTQG
MSRA_UREPA      IQKYFDSIIGVNHTVVGYSQGNVINPSYEQVCTQTTNHTETVQIDYDDRFVSLISILEHLYQII-DPFSL
MSRA_UREP2      IQKYFDSIIGVNHTVVGYSQGNVINPSYEQVCTQTTNHTETVQIDYDDRFVSLISILEHLYQII-DPFSL
MSRA_MYCA5      VQGFLXXXXXXXXXXVGYANSLLENPTYELVKSHVTDAVETVEVIYDENILSLKDIVKKLFAVI-DPTAR
MSRA_CORGL      VEQMYWQMDGVEGTSVGYAGGFTPNPTYREVCSGRTGHTEIVEVVYDPSKISLEQLVARGLE-AHDPTQG
MSRA_COREF      VEQMYWKMDGVESTSVGYAGGYTPNPTYREVCSGRTGHTEIVEVVYDPEKITLAELVARGLE-AHDPTQG
MSRAB_CAMFE     TQAYFDKIRGVIKTDVGYANGKSDKTDYHSL--HYSGHAETVHITFDENIVSLAEILAHYFRII-DPFSV
MSRA_CORGB      VEQMYWQMDGVEGTSVGYAGGFTPNPTYREVCSGRTGHTEIVEVVYDPSKISLEQLVARGLE-AHDPTQG
MSRA_CORML      VEQMYWQMDGVEGTSVGYAGGFTPNPTYREVCSGRTGHTEIVEVVYDPSKISLEQLVARGLE-AHDPTQG
MSRA_ARTAT      LDAVYQKTRXXXXXXXXXXXXXXRNPDYYEVCSGTTGHAEVVAVTFDETVVPEEVILDMFFAL-HDPTTL
MSRA_MARMM      AERLFWETDGVWHTAVXXXXXXXXXXXXQETCSGATGHAELVRVVFDPEMLSLDQVLKIFWE-GHDPTQG
MSRA1_CAUCR     VERVFWKVPXXXXXXXXXXXXITPNPTYEEVCTGRTGHTEVVLVVFDPKVVTYEALLKTFWE-NHDPTQG
MSRA_XYLFT      AERLFWQLPGVFSTXXXXXXXXVPYPTYREVCSGETGHAEVVLVVYDHTVISFEQLLQTFWE-SHDPTQG
MSRA_XYLFM      AERLFWQLPGVFSTXXXXXXXXVPYPTYREVCSGETGHAEVVLVVYDHTVISFEQLLQTFWE-SHDPTQG
MSRA_XYLFA      AERLFWQLPGVFSTXXXXXXXXVPYPTYREVCSGETGHAEVVLVVYDHTVISFEQLLQTFWE-SHDPTQG
MSRA_XYLF2      AERLFWQLPGVFSTXXXXXXXXVPYPTYREVCSGETGHAEVVLVVYDHTVISFEQLLQTFWE-SHDPTQG
MSRA_MYCPE      IEQYYNLNQKIISTNVGYLNSKIDNPTYKDVCNNITDAVEAVELTYDDQVISLNEIIDLLFKVI-DPTSI
MSRA_YEAST      TEHMYRKYLNIVDCKVGYANGSPSSVSYKRVCGGDTDFAEVLQVSYNPKVITLRELTDFFFRI-HDPTTS
MSRA_XANOP      AERKFWKVPGVXXXXXXXXXXQTPNATYSEVCSGQTGHTEAVLVVFDEQAVSFEHLLRTFWE-SHDPTQG
MSRA_XANOM      AERKFWKVPGVXXXXXXXXXXQTPNATYSEVCSGQTGHTEAVLVVFDEQAVSFEHLLRTFWE-SHDPTQG
MSRA_DROME      AESLYGATRGVLRTTVGYAGGSSDLPTYRKMG----DHTEVLEIDYDPTVISFKELLDLFW----NNHEY
MSRA_MYCGE      IEKYFQLIKGVKKTSVGYLNSRIRNPSYEQVCSGYTNXXXXXXXXXXXXXXXXXXXXXXXXXVI-DPTIR
MSRA_VIBVU      AERLFWQLDXXXXXXXXXXXXFTLNPTYQEVCSGQTGHTEVVRVIFDPQVLPLEQLLEKFWE-RHDPTQG
MSRA_MYCPU      VERYFQKVKGVLDTKACYINGGFEGVKYKEVCEG-SSHVEAVRVIYDNSKITEEDLWKLYLRII-NPYSL


                         +         .         .         .         .         *         .:210
query           NYQGPDHGTQYRSAIFPRSPVQRSIAEAYITQLDTSKAYRAPIVTRVEDYKGFFPAENYHQDFLVKNPSY
MSRA2_RHILO     NFQGPDSGTQYRSTIFAENDTQKQIAQSYIDQLDKAKLYPAPIVTTIETGKTFYPAENYHQDFLTLNPTY
MSRA2_SYNY3     NRQGVDQGRQYRSAIFATTPEQKQVAQAYIDQLEESQAFDQAIATEVNDFDAFYPAEDYHQDFVQRNPAH
MSRA_POLSQ      NYQGNDHGTQYRSVIYTHSDEQAKIANEVVQELEDSKIYADPVVTQIESAPTIYPAEDYHQNYFQQHPHQ
MSRA_DEIRA      NRQGADVGTQYRSALFPLTQEQEQTAREMIEQLGTEDVFGRPIVTSIEPASTFYVAEDYHQNYYKNNPGQ
MSRA_HALWD      NRQGPDVGTQYRSIILTHTAEQRATAEAYIEALNDH--YDDAIVTEIESLERFWSAEEYHQDYFEKNPSD
MSRA_PASMU      NHQGEDVGTQYRTGIYYLNDEQEQLANKKIAELQPHFAEK--IVTEVLPAQTFYPAEDYHQGYLLQNPQN
MSRA_TRIEI      NRQGNDVGTQYRSVVMCHSQEQKDIAQEVISTLGNNGTFENPIVTEVVDLKDYYRAEEYHQNYFNKNPYQ
MSRA_NATPD      NRQGPDVGSQYRSIVLYHDDTQRELAEAYIESLDEAGEYDDDIVTEIERLETFYRAEENHQNYFEKNPQD
MSRA_HALSA      DREGPDVGSQYRSIVLPHDDQQHERATAFVDELAAADAFDGSIVTEIEPLETFYPAAEKHQNYFEKNPDA
MSRA_HALS3      DREGPDVGSQYRSIVLPHDDQQHERATAFVDELAAADAFDGSIVTEIEPLETFYPAAEKHQNYFEKNPDA
MSRA_METHJ      NRQGPDVGSQYRSVIFYTSPEQKEEAEMFIAEMNQSGRYHAAIATEVVPAETFWPAEEYHQSYFLK----
MSRA_CHRVO      NRQGHDVGTQYASAIFYLDETQRECARRVIAQLDAEQIFDAPIVTRVESAPRFHPAEDYHXXXXXXXXXX
MSRA_NITSB      NRQGADIGTQYRSVIFPLNEEQKAIAQKVIQKL--NPYFENKIVTTIENPGTFYEAESYHQNYYNTHPDQ
MSRA_ACIC5      NRQGPDWGTQYRSVIFYHSPEQQTVAQAFIDRLTAEKRFPRPIVTQVVPAATFWRAEEYHQRYLEK----
MSRA_THET2      DRQGPDVGPQYSPAIFYHSEEQKRVAEAVMREL--APLYPKPIATKLLPFTTFYPAEAYHRDYFARHPEA
MSRA_PICTO      NRQGEDVGTNYRTAIFYINEYQKERAVNYIKNLEASGKY-SKIVVSVEPYKNFYPAEDYHKNYFERHPEQ
MSRA_METTH      NRQGPDVGEQYRSVIFYHSDEQRRAAIESRRRLEESGRFRDRIVTAIEPAGTFYEAEEYHQQYLEKNP--
MSRA1_RHOBA     NRQGADGGPQYRSSIFVHNDEQREIAKKTMEKL--GEEYRDPIVTLIEPATKFYVAEEYHQDYYRRNPNA
MSRA_THET8      DRQGPDVGPQYSPAIFYHSEEQKRVAEAVMREL--APLYPKPIATKLLPFTTFYPAEAYHRDYFARHPEA
MSRA_SULAC      NRQGNDVGSQYRSIILYHSEEQKKIAEEMIKLYERKLGKK--VVTELVPFEAFYEAEDYHHDFYDKHKNY
MSRA_SULSO      NRQGNDVGTQYRSIILYHNEEQRKIAEEMIREVE--KRIGKKVVTELKPFEVFYEAEDYHHDFYDKHKYN
MSRA_LEPBJ      NRQGNDVGTQYRSIILYHSPEQKKQAEQSIQK--AGEHFSDPIVTQVEILKEFYPAEDYHQNYFRTNPKQ
MSRA_ACIBY      NRQGNDIGTQYRSVIYYFNEEQKQAAEHTI---QTLKDDDLDIVTELSPAPTFYPAEDYHQNYYEKNPSQ
MSRA_ACIBT      NRQGNDIGTQYRSVIYYFNEEQKQAAEHTI---QTLKDDDLDIVTELSPTPTFYPAEDYHQNYYEKNPSQ
MSRA_ACIBC      NRQGNDIGTQYRSVIYYFNEEQKQAAEHTI---QTLKDDDLDIVTELSPAPTFYPAEDYHQNYYEKNPSQ
MSRA_ACIB5      NRQGNDIGTQYRSVIYYFNEEQKQAAEHTI---QTLKDDDLDIVTELSPAPTFYPAEDYHQNYYEKNPSQ
MSRA_ACIB3      NRQGNDIGTQYRSVIYYFNEEQKQAAEHTI---QTLKDDDLDIVTELSPAPTFYPAEDYHQNYYEKNPSQ
MSRA_LACSS      MGQFQDRGDSYRPVIFVNSDQQRSIAEASKEKLIASGRFNEPIVTQIEAAKPFYPAEDYHQDFYKKEP--
MSRAB_NEIMB     NKQGNDTGTQYRSGVYYTDPAEKAVIAAALKR--EQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPNY
MSRAB_NEIMA     NKQGNDTGTQYRSGVYYTDPAEKAVIAAALKR--EQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPNY
MSRA_METMJ      NRQGPDIGTQYRSVIFVHTPEQEAEARASKEEMDQSGKFRRPIVTAIEPAGTFWRAEEYHQQYFAK----
MSRA_LEPBL      NRQGNDVGIQYRSIIPYHSPEQKKQAEQSIQK--AGEHFSDPIVTQVEILKEFYPAEDYHQNYFRTNPKQ
MSRA_GRABC      NRQGADVGTQYRSVIMPASTEQENAARGVLAEVEAAQIWQAPLSTTIEPLQIFYPAEPEHVDYFARHPEA
MSRA_ERWT9      NRQGNDIGTQYRSAIFPVS--EEQLEEAKMAIARAQSEHNDAIVTTIEAHSTWYPAEDYHQDY-------
MSRA_ACIBS      NRQGNDIGTQYRSVIYYFNEEQKQAAEHTI---QTLKDDDLDIVTELSPAPTFYPAEDYHQNYYEKNPSQ
MSRA_VESOH      NQQGNDRGTQYRSAIFYINNKQQLQAINMINLMSDN------IVTQVTKLDCFYPAEDYHQNYFNNNLSK
MSRAB_NEIGO     NKQGNDTGTQYRSGVYYTDPAEKAVIAAALKR--EQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPNY
MSRA_RUTMC      NQQGNDRGTQYRSAIFYTNDEQQSQAIDMVNQMSDK------IVTQIIKLDVFYPAENYHQNYFNNNSSQ
MSRAB_TREPA     NKQGGDVGTQYRSAIFYLSGTQKQQAETLMGRYAGAGKFTRPLVTTLEEARDFYPAEEYHQDYLTKNP--
MSRA_METBU      DSQGPDHGSQYRSAIFYHDDAQREAALRSREQLERSGKYDSTIKTEIVKASEFSPAEDYHQKYFQK----
MSRA_GEOMG      NRQGPDIGTNYRSVIFFHTPEQEQAARLSMEKEGGSGRYSRPIVTEIASASAFWWAEEYHQQYLEK----
MSRA_SALPB      MQQGNDHGTQYRSAIYPLTPEQNAAAHASCERFQSAMAAHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_LEUMM      MGQFQDRGDNYRPVIFVNSPEQREIAEESRAALAASNRFDEPIVTKIEDAKPFYEAEEYHQDFYKKDP--
MSRA_STAAC      GGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNP--
MSRA1_STAAW     GGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNP--
MSRA1_STAAS     GGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNP--
MSRA1_STAAR     GGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNP--
MSRA1_STAAN     GGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNP--
MSRA1_STAAM     GGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNP--
MSRA1_STAA8     GGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNP--
MSRA_SALTY      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQTAAGDHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_SALSV      MQQGNDHGTQYRSAIYPLTPEQSAAAHASRERFQSAMANHRPITTEITHATPFYYAEDEHQQYLHKNP--
MSRA_SALNS      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQTAAGDHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_CLAM3      NRQGADVGTQYRSAMFPADAAQEQLFRDAISR--AGELWDGTAVTTIEPVGTWYDAEDYHQDFFAKNPGQ
MSRA_RHOCS      MRQGNDVGTQYRSAIYATTPEQLRLAEAYASRL-KAQGYGA-VTTEIREAPAFYYAEDYHQQYLHKKP--
MSRA_SALTI      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSAMAAHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_SALPK      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSAMAAHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_SALPC      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSAMAAHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_SALPA      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSAMAAHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_SALHS      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSAMAAHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_SALG2      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSAMAAHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_SALEP      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSAMAAHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_SALDC      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSAMAAHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_SALCH      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQSAMAAHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_SALAR      MRQGNDHGTQYRSAIYPLTPEQSTAAHASRERFQSAMADERPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_ESCF3      MRQGNDHGTQYRSAIYPLTPEQDSAARASRERFQAAMIAARPVTTEIANATPFYYAEDDHQQYLHKNP--
MSRA_SALA4      MQQGNDHGTQYRSAIYPLTPEQNAAAHASRERFQAAMAAHRPITTEIAHATPFYYAEDEHQQYLHKNP--
MSRA_KLEP3      MRQGNDHGTQYRSAIYPLTPEQTAAAKASLARFQAAAHDTRHITTEIATAKPFYYAEDDHQQYLYKNP--
MSRA_ENTS8      MRQGNDVGTQYRSAIYPLTPEQEAAAQASLERMEAAGDYR-HITTEIAPAKPFYYAEDEHQQYLHKNP--
MSRA_SHIB3      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECO5E      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECO57      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECO27      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARRITTEIANATPFYYAEDDHQQYLHKNP--
MSRA1_RHILO     NRQGNDVGMSYRSAIYYTSDEQKRVAEDTIADVDASGLWPGKVVTEVAPAGAFWEAEPEHQDYLEKYPN-
MSRA_SHISS      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_SHIFL      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_SHIF8      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_SHIBS      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_LACS1      MGQFQDRGDSYRPVIFVHDEEQRKIAEESKKALAESGEFDKPIVTQIEDAKPFYEAEEYHQDFYKKNP--
MSRA_GEOSL      NRQGPDIGTNYRSVIFYHSPDQERAARASLEHEQRSGRHARPIVTEIVPAATFWWAEEYHQHYLEK----
MSRA_ECOSM      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARRITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECOLU      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARRITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECOLI      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECOLC      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECOHS      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECODH      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECOBW      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECO8A      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECO81      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARRITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECO7I      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARRITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECO55      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECO45      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECO24      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARHITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_PSEFL      NRQGNDLGPSYRSAIYYLNEQQRDIAEDTAADVDASHLWPGRVVTEIEPAGPFWEAEPEHQDYLERIPN-
MSRA_LACRD      SGQFQDRGDNYRPVIFVKNDEQRKIAEKSKKALQESGRFDAKIVTTIEDVQPFYPAEDYHQGFYKKDP--
MSRA2_LACLA     FGQFEDRGDNYRPVIFVENEEQEKIAKESKAQLQASGNFDSPIVTSIETVQKFWPAEDYHQGFYKKNP--
MSRA_ARATH      NRQGGDVGTQYRSGIYYYTDEQERIAREAVEK--QQKILNKRIVTEILPATKFYRAENYHQQYLAK----
MSRA_CLAMS      NRQGADVGTQYRSAMFPADAEQEQLFRDAIAR--AGDLLDGTPVTTIEPLGTWHDAEDYHQDFFAKNPGQ
MSRA_SHIDS      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARRITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_PSEU2      MRQGNDIGTQYRSVIYCTTPEQLDAAKASAEQAQLNKAGKGTITTEIEQAPTVYFAEAYHQQYLAKNP--
MSRA_CLOBK      NKQGNDRGTQYRTGIFYLD--QKDLNVIIKSKSQEQKNYRKPIVTEVEPLKCFYEAEEYHQKYLKKNP--
MSRA2_STAAR     QGQFFDRGESYQPVIFYHDKHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVH
MSRA_ECOL5      MRQGNDHSTQYRSAIYPLTPEQDAAARASLERFQAAMLAARRITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_CLOBJ      NKQGNDRGTQYRTCIFYLD--EKDLNVIIKSKYQEQKNYRKPIVTEVEPLKCFYEAEEYHQKYLKKNP--
MSRA_CLOBH      NKQGNDRGTQYRTGIFYLD--EKDLNVIIKSKYQEQKNYRKPIVTEVEPLKCFYEAEEYHQKYLKKNP--
MSRA_CLOB1      NKQGNDRGTQYRTGIFYLD--EKDLNVIIKSKYQEQKNYRKPIVTEVEPLKCFYEAEEYHQKYLKKNP--
MSRA_ENT38      MQQGNDHGTQYRSAIYPLTPEQDAAARASLARFDAMQAAHRTVTTEIANATPFYYAEDDHQQYLHKNP--
MSRA_ECOSE      MRQGNDQGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARRITTEIANATPFYYAEDDHQQYLHKNP--
MSRA_CLOBL      NKQGNDRGTQYRTGIFYLD--EKDLNVIIKSKSQEQKNYRKPIVTEVEPLKCFYEAEEYHQKYLKKNP--
MSRA_ECOL6      MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAMLAARRITTEIANATPFYYAEDDHQQYLHKNP--
MSRAB_HAEIN     NKQGNDRGRQYRTGIYYQDGADKAVIGQALAQLQTK--YKKPVQIEVQPLKNYIVAEEYHQDYLKKNPN-
MSRA2_STAAW     QGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVH
MSRA2_STAAS     QGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVH
MSRA2_STAA8     QGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVH
MSRA_AZOC5      MRQGNDVGTQYRSGIYTSDPQEKAVAEAVKASYEAALKAKGPITTEIIDGGPFYFAEDYHQQYLSKNP--
MSRA3_RHIME     DRQGNDIGTSYRSAIYYVDDEQKRIAQETIADVEASGLWPGKVVTEVEPVRDFWEAEPEHQNYLERYPN-
MSRA2_STAAN     QGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVH
MSRA2_STAAM     QGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVH
MSRA_NITWN      DRQGYDQGLSYRSAIFYTNEEQKRIAEETIAEIDASGLWPGYVVTDVEPAGPFWEAEPEHQDYLERVPN-
MSRA_LISIN      AGQFVDRGDSYRPVIFYHNEEQRQIAEKSKAALDASGRFKKPVVTEIAKAETFYPAEEYHQDFYKKEKAH
MSRA_LEIXX      NRQGNDVGASYRSAIFYEDEEQRRVAEETIAEVDASGLWSGKVVTEVSPAGPFWEAGPEHQDYLERIP--
MSRA_DICDI      NRQGNDVGTQYRSGIYYHNEEQKN--EAIASKEKEQLKYKDPISTEILPAGVFYPAETEHQQYL------
MSRA_CLOBM      NKQGNDRGTQYRTGIFYLD--EKDLNLIIKSKSQEKKNYRKPIVTEVEPLKCFYEAEEYHQKYLKKNP--
MSRA_CYAP8      MRQGNDVGTQYRSGIYVYSPQHKKAAETEVYQKALNQAGYGDITTEILDAPEFYYAEDYHQQYLAKNPN-
MSRA_METMA      DRQGPDVGKQYRSVIFYHSDEQXXXXXXXXXXXXXXGAFKNPVVTEIVPVSEFYMAEDYHQQYFEK----
MSRA_LISW6      AGQFVDRGDSYRPVIFCHNDEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAH
MSRA_SALTO      MRQGNDVGTQYRSAIYPTTDEQLTTARASRDAFAVARAGKGEITTEISPLGDYYLAEGYHQQYLTKNP--
MSRA_PSESM      MRQGNDIGTQYRSVIYCTTPEQXXXXXXXXXXXELSKAGLGGITTEIEEAPTVYFAETYHQQYLAKNP--
MSRA_STRU0      FGQFEDRGDNYRPVIFYFDERQKEIAEQSRENLQLSGRFQDPIVTQIEEAQPFYLAEDYHQAFYRKNP--
MSRA_STRPM      FGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNP--
MSRA_STRP3      FGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNP--
MSRA_LISMO      AGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAH
MSRA_LISMH      AGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAH
MSRA_STREM      FGQFEDRGDNYRPVIYYTDERQREIAERSKQSLQASGRFDQPIVTSIEPAEPFYLAEDYHQGFYQKNP--
MSRA_STRCO      NRQGNDIGLSYRSAIYYVDDEQKRIAEDTIADVDASGLWPGKVVTEVEPVGPFWEAEPEHQDYLQRYP--
MSRA_PELUB      NSQGPDFGTQYRSEIFYLSDRQKEIAESVIKKVNLKLS--GNVVTKSSLLKNYCPAEEYHQRYLEK----
MSRA_METAC      NRQGPDVGKQYRSVIFYHNXXXXXXXXXXXXXXXXXGVFKNPIVTEIVPVSEFYMAEDYHQQYFEK----
MSRA_LISMF      AGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAH
MSRA_LISMC      AGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAH
MSRA_BACA2      GGQFADRGSSYRAAIYYHNDEQKQIAEASKKQLEESGIFKKPIVTDILKAEPFYEAEGYHQHFYKKNPDH
MSRA2_RHOBA     NRQGNDRGPSYRSAIYYVDEEQKQIALDTIADVNASGLWPGKVVTEVEPVSDFWEAEPEHQDYLEKVPN-
MSRA_STRPG      FGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNP--
MSRA_STRP8      FGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNP--
MSRA_STRP6      FGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNP--
MSRA_STRE4      FGQFEDRGDNYRPVIYYTDERQREIAERSKQTLQASGRFDQPIVTSIEPAEPFYLAEDYHQGFYQKNP--
MSRA_SERP5      MRQGGDVGTQYRSAIYTLTPEQQTEAESSLQRFQQAMEQKRAITTEVAPALPFYYAEDDHQQYLYKNP--
MSRA_DICD3      MRQGNDIGTQYRSAIYTLTTEQETAAESYFQQAMRDAGNDHDITTEIQPAGPFYYAEDEHQQYLHKNP--
MSRA_STRAW      NRQGNDIGLSYRSAIYYVDDEQKRIAEDTIADVDASGLWPGKVVTEVEPVGPFWEAEPEHQDYLERYP--
MSRA_STRA3      FGQFEDRGDNYRPVIFYENEEQRQIAQKSKDKLQASGRFDRPIVTSIEPADTFYPAEDYHQAFYRTNPA-
MSRA_MYCLE      NRQGNDQGTSYRSAIFYLDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHYPN-
MSRA_MYCLB      NRQGNDQGTSYRSAIFYLDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHYPN-
MSRA_HUMAN      MRQGNDHGTQYRSAIYPTSAKQMEAAENY--QKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPN-
MSRA2_ANASP     MRQGNDVGTQYRSGIYVYSEAQKQLAEASAYQQALSSAGYEKITTEILDAPEFYYAEAYHQQYLAKNPN-
MSAB2_STRR6     NKQGNDVGTQYRTGVYYTDDKDLEVINQVFDEV--AKKYDQPLAVEKENLKNFVVAEDYHQDYLKKNPAY
MSAB2_STRPN     NKQGNDVGTQYRTGVYYTDDKDLEVINQVFDEV--AKKYDQPLAVEKENLKNFVVAEDYHQDYLKKNPAY
MSRA_STRPZ      FGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNP--
MSRA_STRPD      FGQFEDRGDNYRPVIYYTTERQKEIAEQSKASLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNP--
MSRA_STRPC      FGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNP--
MSRA_STRPB      FGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNP--
MSRA_STRP1      FGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNP--
MSRA_STRA5      FGQFEDRGDNYRPVIFYENEEQRQIAQKSKDKLQASGRFDRPIVTSIEPADTFYPAEDYHQAFYRTNPA-
MSRA_STRA1      FGQFEDRGDNYRPVIFYENEEQRQIAQKSKDKLQASGRFDRPIVTSIEPADTFYPAEDYHQAFYRTNPA-
MSRA_RALSO      ERQGNDIGPQYRSAVFAQSPEQFAEAGATIRALSAANVFDAPIVTEVVDASGFWQAEDEHQNYFRDHPAQ
MSRA_PSYWF      DRQGNDIGSQYRSVVFTDEETQKPTIDRTINKL---RDMGLDIVTEVHPVHEFHVAEDYHQDYFNKNPTQ
MSRA_BACSU      GGQFADRGSSYRAAIFYHNDKQKELAEASKQRLAESGIFKDPIVTDILKAEPFYEAEGYHQHFYKKNPAH
MSRA_BACP2      GGQFGDRGESYRTGIYVHHDEQRKLAEASKEKLNESGIFQKPIVTEILDAAPFYPAEEYHQHYYKKN---
MSRA_BACHD      DGQFHDRGPQYRTAIFYENEEQRALAERSREALEKSGKFKKPIVTSILPMATFYPAEEEHQQFYKKNP--
MSRA_BACLD      GGQFTDRGESYRTAIFYHNDKQRKLAEESKKKLGESGIFKDPIATDILEAGPFYPAEEYHQDYHKKHP--
MSRA_STRS7      FGQFEDRGDNYRPVIYYTDERQREIAERSKQTLQASGRFDQPIVTSIKPAEPFYLAEDYHQGFYQKNP--
MSRA_NOCFA      DRQGNDIGTSYRSAIFYLDDEQRRVAEDTIADVDASGLWPGKVVTEVTPASEFWEAEPEHQDYLLRYPN-
MSRA_MOUSE      MRQGNDFGTQYRSAVYPTSAVQMEAAEEY--QKVLSKHNFGPITTDIREGQVFYYAEDYHQQYLSKNP--
MSRA_PSYCK      DRQGNDVGSQYRSVVFYTDETQKPTIDRTINKL---RDMGINVVTEVHPAVEFYQAEDTHQDFFNRNPGQ
MSRA_CLOB6      NKQGNDRGTQYRTGIFYLNEKDLNIITE--SKSREQKNYKKAIVTEVEPLKCFYEAEEYHQKYLKKNP--
MSRA_PSEMY      MRQGNDQGTQYRSAIYDHAQLEAALASQARFQAELDKAGLGSITTEICEAPIFYYAETYHQQYLAKNP--
MSRA_MYCTU      DRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPN-
MSRA_MYCTA      DRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPN-
MSRA_MYCBT      DRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPN-
MSRA_MYCBP      DRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPN-
MSRA_MYCBO      DRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPN-
MSRA1_LACLA     DGQIYDRGANYRPVIFVESEEQRIAAQKSKIALEKSGIWDKPIVVPIEEAKTFWPAEEYHQQYYKKDP--
MSRA_ARTS2      NRQGYDVGTQYRSSMFYETTEEKILFEEAIERNQALWAH--PIVTEVSRLPVFHVAEDFHQDYYAKHPEQ
MSRA_ARTCA      NRQGYDVGTQYRSSMFYETTEEKILFEEAIDR--NQALWSHPIVTEVSRLPRFHVAEEFHQDYYAKHPEQ
MSRA_RAT        MRQGNDCGTQYRSAVYPTSAVQMEAAEEY--QKVLSKHGFGPITTDIREGQVFYYAEDYHQQYLSKNP--
MSRA_MYCMM      NRQGNDRGTSYRSAIYYLDDEQKRVALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPS-
MSRA_METCA      MRQGNDVGTQYRSVIFATTPEQLQWADAYERALE--RAGRGGITTEIRMAPDFYYAESYHQQYLAQHPN-
MSRA_STRMU      FGQFEDRGDNYRPVIFYFDEQQRKIAEQSKANLQASGHFNRPIVTTIEAAQPFYEAEKDHQAFYRKNP--
MSRA_MYCPA      DRQGNDRGPSYRSAIFYTDDEQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPN-
MSRA_METM7      NRQGWDVGEQYSSHIFYFTDEQRIVAEKSLEKMQCYMDLK--IVTAIKKASDFFPAEEYHQKYFMK----
MSRAB_ACTAC     NKQGNDRGRQYRTGIYYQDTADKSIIEKEITALQGK--YKNKIQIEVEPLHNYIVAEEYHQDYLKKNPN-
MSRA_SCHPO      NQQGNDIGTQYRSAIFTTNPEQATIAKRVMNEVQAKHYPNKKIVTQILPAGKWWDAEDYHQLYLEKNP--
MSRA_PSYA2      DRQANDVGSQYRSVVFYTDETQKPTVDRTINKL---RDMGINIVTEVHPAVEFYQAEDTHQDFFNRNPGQ
MSRA_PSEPG      MRQGNDVGTQYRSAIYCTSPEQLEQAEASAFQAELSKAGFGEITTEIDQAPTVYFAEAYHQQYLAKNP--
MSRA_PHOPR      MQQGNDIGTQYRSVIYTTTPNQLTYAQQCYXXXXXXXXXXXPITTEIEPAGTFYFAEDYHQQYLVKNPN-
MSRA_BRANA      NRQGNDVGTRYRSGIYFYTDEQEKLAREAMEK--QQKILNRKIVTEILPATKFYRAENYHQQYLAK----
MSRAB_STRP8     NKQGNDRGSQYRTGIYYTDKADLAIIDEVFK--EKAKDYKKKIVVEKAPLKHFIKAEDYHQDYLKKNPNY
MSRAB_STRP6     NKQGNDRGSQYRTGIYYTDKADLAIIDEVFK--EKAKDYKKKIVVEKAPLKHFIKAEDYHQDYLKKNPNY
MSRAB_STRP1     NKQGNDRGSQYRTGIYYTDKADLAIIDEVFK--EKAKDYKKKIVVEKAPLKHFIKAEDYHQDYLKKNPNY
MSRA_SACD2      MRQGNDLGTQYRSGVYVYSDEQAEQAEQVVQAMLTEKGY-GEITTEIIKAKEFYFAEAYHQQYLAKNPN-
MSRA_PSEPW      MRQGNDVGTQYRSAIYCTSPQQLEEAKASAFQAELNKAGYGEITTEIDQAPTVYFAEAYHQQYLAKNP--
MSRA_CAMJJ      DKQGGDIGIQYRSIIFYENEEDKILAQNFIE--EQQKIFSKKIVTKISRLQTYYKAENYHQHYFINNPNQ
MSRA_CAMJE      DKQGGDIGIQYRSIIFYENEEDKILAQNFIE--EQQKIFSKKIVTKISRLQTYYKAENYHQHYFINNPDQ
MSRA_CAMJ8      DKQGGDIGIQYRSIIFYENEEDKILAQNFIE--EQQKIFSKKIVTKISRLQTYYKAENYHQHYFINNPNQ
MSRA_YERE8      MRQGGDVGTQYRSAIYVLTPEQETQAQALFQQAMTKAGDSRAITSEIAAALPFYYAEDDHQQYLYKNP--
MSRA_MYCSS      NRQGNDVGTSYRSAIFYVDDEQKRVALDTIADVDASGLWPGKVVTEVTPAGEFWEAEPEHQDYLERMP--
MSRA_MYCSK      NRQGNDVGTSYRSAIFYVDDEQKRVALDTIADVDASGLWPGKVVTEVTPAGEFWEAEPEHQDYLERMP--
MSRA_MYCGI      NRQGNDIGTSYRSEIFYVDEEQRQIALDTIADVDASGLWPGKVVTEVSPAPDFWEAEPEHQDYLERYPT-
MSRA_METMP      NKQGWDVGEQYSSYIFYFDDEQKLIAEKSLEKMQENTDLK--IVTIIEKAGSFYPAEEYHQKYFMK----
MSRA_ERWCT      MRQGGDIGSQYRSAIYTLTPEQEQAAQASLQRFQQAMRENSAISTEIEPAGPFYYAEEDHQQYLHKNPN-
MSRA_SOLLC      NRQGNDVGKQYRSGIYYYNDAQAQLARESL-EAKQKEFMDKKIVTEILPAKRFYRAEEYHQQYLEK----
MSRA_PSEE4      MRQGNDVGTQYRSAIYCTSPQQLEEAKTSAFQAELSKAGFGEITTEIAQAPTVYFAEAYHQQYLAKNP--
MSRA_MYCVP      NRQGNDVGTSYRSEIFYVDDEQRRIALDTIADVDASGLWPGKVVTDVSPAPEFWEAEPEHQDYLERYPS-
MSRA_MYCSJ      NRQGNDVGTSYRSAIFYVDDDQKRVALDTIADVDASGLWPGKVVTEVTPAGEFWEAEPEHQDYLERMP--
MSRA_METM5      NRQGWDVGEQYSSHIFYFTEEQRLLAEKSFEKIQKSSDLR--IVTAIKKASDFFPAEEYHQKYFMK----
MSRA_PSEPK      MRQGNDIGTQYRSAIYCTSPEQLEQAKASAFQAELSKAGFGEITTEIDQAPTVYFAEAYHQQYLAKNP--
MSRA_MYCUA      NRQGNDRGTSYRSAIYYLDDEQKRVALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQHYLQRYPS-
MSRA_CAMJR      DKQGEDIGIQYRSIIFYENEEDKILAQNFIE--EQQKIFSKKIVTKISRLQTYYKAENYHQHYFINNPDQ
MSRA_SALAI      MRQGNDVGTQYRSAIYXXXXXXXXXRDAFAPVV--ARAGKGEITTEIGPLGDYYFAEDYHQQYLTKNP--
MSRA_VIBCM      MRQGNDRGTQYRSAIYTFSEDQREIAEAAAYQALLTAQHRPSITTEILPAGAYYFAETYHQQYLAKNPN-
MSRA_VIBCH      MRQGNDRGTQYRSAIYTFSEDQREIAEAAAYQALLTAQHRPSITTEILPAGAYYFAETYHQQYLAKNPN-
MSRA_VIBC3      MRQGNDRGTQYRSAIYTFSEDQREIAEAAAYQALLTAQHRPSITTEILPAGAYYFAETYHQQYLAKNPN-
MSRA_STRGG      FRQGNDVGTQYRSAIYTHSPXXXXXXXXXXXQKVLTASGHQEITTEILPAEGFWPAEAYHQQYLDKNP--
MSRA_PSE14      MRQGNDIGTQYRSVIYCTTPKQXXXXXXXXXXXELRKAGLGAITTEIEEAPTVYFAEAYHQQYLAKNP--
MSRA_CLOPH      NKQGGDQGIQYRTGIYYIDEADLEIIKPSLEEL--AKKYDKPIAIEVKQLLHFYDAEEYHQKYLDKNPS-
MSRA_PECCP      MRQGGDIGSQYRSAIYTLTPEQEQAAQESLQRFQQAKGDVRAISTEIVPAGPFYYAEDDHQQYLYKNPN-
MSRA_CLOAB      NRQGHDEGTQYRTGIY---YVDEEDLKVILESKDEQEKYDAPIVTEILPLKNFYDAEEYHQKYLDKNPN-
MSRAB_VIBCH     QGSFVDRGEQYRPAIFYHNAEQLEVAKRFMMEIDQLGIFKKPLKTELIEFKKFWPAEDYHQD--------
MSRAB_STRP3     NKQGNDRGSQYRTGIYYTDKADLAIIDEVFK--EKAKDYKKKIVVEKAPLKHFIKAEEYHQDYLKKNPNY
MSRA_ALKMQ      NRQGPDIGSQYRTGIYYGH--EEDLDTIIKSKEMQQKKYDANIVTEIEPLKAFYDAEEYHQKYLKKNP--
MSRA_BOVIN      MRQGNDHGSQYRSAIYPTS--AEHVGAALKSKEDYQKVLSGLITTDIREGQTFYYAEDYHQQYLSKDP--
MSRA1_SYNY3     MRQGNDVGTQYRSGIYTYSEXXXXXXXXXXXXXXXXXXXXGEITTEILPAPDFYYAEDYHQQYLAKNPN-
MSRA_NAUPA      NRQGNDVGTQYRSIIL---YLDXXXXXXXXXXXXXXXXXXXNVVTEVKPLEIFYPAEKYHQNYFAKNPHQ
MSRA_CLOTE      NRQGPDVGHQYRTGIYYYD--KEDLDDILKSKDEISKKYDKPIVTEVEKVTYFYLAEEYHQKYLKKNPN-
MSRA_VIBPA      MRQGNDLGTQYRSAIYTYSQDQQEIADKSKLQYQQAAELRSTITTEIVPAGPYYFAETYHQQYLAKNP--
MSRAB_HELPY     NKQGNDVGRQYRTGIYYVNSADKEVIDHALKAL--QKEVKGKIAIEVEPLKNYVRAEEYHQDYLKKHPS-
MSRA_MYCPN      NRQGNDIGTQYRTGVYWVDPQDEQLITQKFRELQAN--YPKPIVTENRAMENYFLAEEYHQDYLKKNP--
MSRA_METNO      MRQGNDVGTQYRSGLYVADAERRAQAEA--SRDAYGEALRAPITTEIRDPGPFYFAEAYHQQYLAKNPA-
MSRA_METM6      NRQGWDVGEQYSSHIFYFTEEQKLLAEKSFEKIQKNSELK--IVTAIRKASDFFPAEEYHQKYFMK----
MSRA_LACSA      NRQGNDVGTQYRSGIYFYTPEQEK--AAIEAKERHQKKLNRTVVTEILPAKKFYRAEEYHQQYLAKGGRF
MSRA_CAMJD      DKQGADIGIQYRSIIFYENEEDKILAQNFIEK--QQKIFSKKIVTQISRLQTYYKAENYHQHYFMNHPDQ
MSRA_AZOVD      MRQGNDIGTQYRSAIFDXXXXXXXXXXXXXXXXXLAKAGYGPVTTEIADAPPFYYAEDYHQQYLAKNP--
MSRA_PSEAE      MRQGGDIGTQYRSVIYTFDAAQKAAAMAESFQAELAKAGYDRITTEIADVPPFYYAEAYHQQYLAKNPN-
MSRA_PSEAB      MRQGGDIGTQYRSVIYTFDAAQKAAAMASREQAELAKAGYDRITTEIADVPPFYYAEAYHQQYLAKNPN-
MSRA_PSEA8      MRQGGDIGTQYRSVIYTFDAAQKALASRESFQAELAKAGYDRITTEIADVPPFYYAEAYHQQYLAKNPN-
MSRA1_ANASP     NRQGPDKGEQYRSVIFFHNXXXXXXXXXXXXXXXXXGRFELDIVTEIKHKSEYYLATEEHQQYFEK----
MSRA1_RHIME     MRQGNDVGTTYRSAIYVYD--EEQLAEANAARNAFQKALRVEITTEIAKAGPFYFAEDYHQQYLAKNP--
MSRA_YERPY      MRQGGDVGTQYRSAIYVLTPEQEEQAERFQQAMEKAGDQRV-ITSEITVALPFYYAEDDHQQYLHKNP--
MSRA_YERPS      MRQGGDVGTQYRSAIYVLTPEQEEQAERFQQAMEKAGDQRV-ITSEITVALPFYYAEDDHQQYLHKNP--
MSRA_YERPP      MRQGGDVGTQYRSAIYVLTPEQEEQAERFQQAMEKAGDQRV-ITSEITVALPFYYAEDDHQQYLHKNP--
MSRA_YERPN      MRQGGDVGTQYRSAIYVLTPEQEEQAERFQQAMEKAGDQRV-ITSEITVALPFYYAEDDHQQYLHKNP--
MSRA_YERPG      MRQGGDVGTQYRSAIYVLTPEQEEQAERFQQAMEKAGDQRV-ITSEITVALPFYYAEDDHQQYLHKNP--
MSRA_YERPE      MRQGGDVGTQYRSAIYVLTPEQEEQAERFQQAMEKAGDQRV-ITSEITVALPFYYAEDDHQQYLHKNP--
MSRA_YERPB      MRQGGDVGTQYRSAIYVLTPEQEEQAERFQQAMEKAGDQRV-ITSEITVALPFYYAEDDHQQYLHKNP--
MSRA_YERPA      MRQGGDVGTQYRSAIYVLTPEQEEQAERFQQAMEKAGDQRV-ITSEITVALPFYYAEDDHQQYLHKNP--
MSRA_YERP3      MRQGGDVGTQYRSAIYVLTPEQEEQAERFQQAMEKAGDQRV-ITSEITVALPFYYAEDDHQQYLHKNP--
MSRA_RHORT      DRQGPDIGDQYRSAIFYHDXXXXXXXXXXXXXXXXSGALSRAIATRIEPAGPFWPAEEYHQRYIDK----
MSRA_FRASN      MRQGNDVGTQYRSAVYTTGEDQXXXSRDAFQRVLTAAGY-PEITTEIAPAGPFYYAEEYHQQYLAKNP--
MSRA_AGRT5      MRQGNDVGTTYRSAIYATTEGQQKARDAFQQALDEA-GHGHAITTEIGPLETFYYAEDYHQQYLAKNP--
MSRA_MAGSA      MRQGNDIGTQYRSAIYWTTPXXXXXXXXXXXXXXLRRAGFGAITTEIAPAGRFYWAEGYHQQYLAKEP--
MSRAB_HELPJ     NKQGNDVGRQYRTGIYYVNSADKEVIDNALKAL--QKEVKGKIAIEVEPLKNYVRAEEYHQDYLKKHP--
MSRA_PHOLL      MRQGGDIGSQYRSAIYTVSPQQHELALAHFQKAMQQQSDNRPITTEITEAGPFYFAEDYHQQYLFKNP--
MSRA_FRAAN      NRQGGDVGTQYRSGIYYYNEEQDCLXXXXXXXXXXXXXXXR-VVTEILPAKRFYRAEEYHQQYLEK----
MSRA_CORK4      FRQGNDVGTQYRSVIYAQTDDEREIAESFSHSLDAGYGGITTDISLLSDTKTMYLAEDEHQQYLDKNPN-
MSRA2_CAUCR     GGQFCDRGPSYRPAVFV-TPAQRPIAEKSRTEA-AKRLKTGTMKTQILPAQTFYLAEEYHRDYAKRN---
MSRA_CLOPS      NKQGNDVGSQYRTGIYYVEP--SDLEEILNSKEELQKSYSKKIVTEVKPLENYYKAEEYHQKYLKKNPN-
MSRA_METS4      MRQGNDVGTQYRSGLYVSDPXXXXXXXXXXXXXXRAKGF-GSITTEIRDPGPFYFAEAYHQQYLAKNPA-
MSRA_CLOP1      NKQGNDVGSQYRTGIYYVDP--SDLEEILNSKEELQKSYSKKIVTEVKPLENYYKAEEYHQKYLKKNPN-
MSRAB_STRGC     NKQGNDVGRQYRTGVYYTNQADKAVIEQVFAEQE--KQLGQKIAVELEPLRHYVLAEDYHQDYLKKNPGY
MSRA_XANC8      MQQGSDVGTQYRSAIYCSTQAQYDAADAYQQQL-TAAGYGDITTEILYPAPTFYYAEDDHQQYLAKHPN-
MSRA_XANC5      MQQGNDVGTQYRSAIYCTTQAQYDAADAYQQQL-TAAGYGA-ITTEIRPAPTFYYAEDDHQQYLAKHPN-
MSRA2_RHIME     DGQFCDRGFAYTTAIHALN--ERQAMDXXXXXXXXXXXLGRPIVTPVEGAAKFWPAEDYHQDFGKRNP--
MSRA_XANCP      MQQGNDVGTQYRSAIYCSTQAQYDAADAYQQQL-TAAGYGDITTEILYPAPTFYYAEDDHQQYLAKHPN-
MSRA_XANCB      MQQGNDVGTQYRSAIYCSTQAQYDAADAYQQQL-TAAGYGDITTEILYPAPTFYYAEDDHQQYLAKHPN-
MSRA_XANCH      MQQGNDVGTQYRSAIYCTTQAQYDAADAYQQQL-TASGY-GDITTEIRPAPTFYYAEDDHQQYLAKHPN-
MSRA_THEVU      NRQGPDVGTNIARLFF------------------------------------------------------
MSRA_HELHP      NFQGNDIGTQYRNGVYFVQESDESIIKECLKLWE--KKHHKKAVTEVEKLQNFYSAELYHQKYLEKN---
MSAB1_STRR6     NQQGNDRGRQYRTGIYYQD--EADLPAIYTVVQEQERMLGRKIAVEVEQLRHYILAEDYHQDYLRKNPSY
MSAB1_STRPN     NQQGNDRGRQYRTGIYYQD--EADLPAIYTVVQEQERMLGRKIAVEVEQLRHYILAEDYHQDYLRKNPSY
MSRA_XANAC      MQQGNDMGTQYRSAIYCTTQAQYDAADAYQQQL-TAAGY-GEITTEIRPAPTFYYAEDDHQQYLAKHPN-
MSRA_BRUSU      MRQGNDIGTTYRSVIYTFNAVDRAVAEKSRDAYSQALASRGPVTTQIADAPDFYYAEDYHQQYLAKNP--
MSRA_BRUSI      MRQGNDIGTTYRSVIYTFNAVDRAVAEKSRDAYSQALASRGPVTTQIADAPDFYYAEDYHQQYLAKNP--
MSRA_BRUO2      MRQGNDIGTTYRSVIYTFNAVDRAVAEKSRDAYSQALASRGPVTTQIADAPDFYYAEDYHQQYLAKNP--
MSRA_BRUME      MRQGNDIGTTYRSVIYTFNAVDRAVAEKSRDAYSQALASRGPVTTQITDAPDFYYAEDYHQQYLAKNP--
MSRA_BRUC2      MRQGNDIGTTYRSVIYTFNAVDRAVAEKSRDAYSQALASRGPVTTQIADAPDFYYAEDYHQQYLAKNP--
MSRA_BRUAB      MRQGNDIGTTYRSVIYTFNAVDRAVAEKSRDAYSQALASRGPVTTQIADAPDFYYAEDYHQQYLAKNP--
MSRA_BRUA2      MRQGNDIGTTYRSVIYTFNAVDRAVAEKSRDAYSQALASRGPVTTQIADAPDFYYAEDYHQQYLAKNP--
MSRA_BRUA1      MRQGNDIGTTYRSVIYTFNAVDRAVAEKSRDAYSQALASRGPVTTQIADAPDFYYAEDYHQQYLAKNP--
MSRA_CLOPE      NKQGNDVGSQYRTGIYYVD--SSDLEDILNSKEELQKSYSKKIVTEVKPLENYYKAEEYHQKYLKKNPN-
MSRA_CORDI      YRQGNDTGTQYRSAIYTAGPRAREIVEHYAPKLAAAGLGR--ITTEILPLASYYMAEDEHQQYLHKNP--
MSRA_BRUMB      MRQGNDIGTTYRSVIYTFNAVDRAVAEKSRDAYSQALASRGPVTTQITEAPDFYYAEDYHQQYLAKNP--
MSRA_UREU1      NKQGEDIGNQYRSGIYYVDHEDALIIKNFLLQKQNQTSKK--IMIEVHKLHNFNIAEEYHQKYLDKNPN-
MSRA_OCHAN      MRQGNDIGTTYRSVIYTFDKADRDVAEKSREAYSQALAGRGPITTEIEDAPELYYAEDYHQQYLAKNPN-
MSRA_OCHA4      MRQGNDIGTTYRSVIYTFDKTDRDVAEKSREAYSQALAGRGPITTEIEDAPELYYAEDYHQQYLAKNPN-
MSRA_UREPA      NKQGDDVGSQYRSGIYYVDHDDEFIIKDFLLKKQNQTPKK--IMIEVERLRNFNIAEEYHQKYLDKNPN-
MSRA_UREP2      NKQGDDVGSQYRSGIYYVDHDDEFIIKDFLLKKQNQTPKK--IMIEVERLRNFNIAEEYHQKYLDKNPN-
MSRA_MYCA5      NYQGPDHGRQYRNGFY--FVDQEDGVMLRELMLEFSKKYEKPLATEILPLDNYYLAEDYHQDYFDKHPN-
MSRA_CORGL      FRQGNDVGTQYRSAYYTENEEDKAVVDAYGETLKQHGFGEITTEIGVISPSDYFLAEDYHQQYLDKNP--
MSRA_COREF      YRQGNDVGTQYRSAFYVETGEEETVRQIVSTYGETLKSHGFGEITTEVDVADYYLAEDYHQQYLHKNP--
MSRAB_CAMFE     NKQGNDVGSQYRTGIYYNSSLKNSISE-FIKHEQTK--YDKKIAVEVEPLKNYVLAEDYHQKYLDKNP--
MSRA_CORGB      FRQGNDVGTQYRSAYYTENEEDKAVVDAYGETLKQHGFGEITTEIGVISPSEYFLAEDYHQQYLDKNP--
MSRA_CORML      FRQGNDVGTQYRSAYYTENEEVKAVVDAYGETLKQHGFGEITTEIGVISPSEYFLAEDYHQQYLDKNP--
MSRA_ARTAT      NRQGYDVGTQYRSSMFYTTTEEKVLFEEAIER--AQALWSDPIVTEVSRLPEFHEAEEVHQNYYAKFPYQ
MSRA_MARMM      MRQGNDRGTQYRSAIYATTPEQHDAAARYQAELD--GAGLGTITTEIVKAGPFYYAEDEHQQYLARNPS-
MSRA1_CAUCR     MRQGNDIGTQYRSGLYVTSDXXXXXXXXXXXXXXXXLSARGTITTEIAPAGPFYFAEDYHQQYLAKNPN-
MSRA_XYLFT      MRQGNDIGTQYRSVIHCTTSEQYAAAEVYQQQLNTA-GYTAITTEILHPAPPFYYAENEHQQYLAKHPN-
MSRA_XYLFM      MRQGNDIGTQYRSVIHCTTSEQYAAAEVYQQQLNTA-GYTAITTEILHPAPPFYYAENEHQQYLAKHPN-
MSRA_XYLFA      MRQGNDIGTQYRSVIHCTTSKQYAAAEVYQQQLNTA-GYTAITTEILHPAPPFYYAENEHQQYLAKHPN-
MSRA_XYLF2      MRQGNDIGTQYRSVIHCTTSEQYAAAEVYQQQLNTA-GYTAITTEILHPAPPFYYAENEHQQYLAKHPN-
MSRA_MYCPE      NKQGNDIGRQYRTGIYSRDSNELMAIQEKINELQNN--YSKLIQTEVMLVDNYYLAEEYHQKYLEKNPN-
MSRA_YEAST      NSQGPDKGTQYRSGLFAHS--DADLKELAKIKEEWQPKWGNKIATVIEPIKNFYDAEEYHQLYLDKNP--
MSRA_XANOP      MQQGNDVGTQYRSAIYCTTQAQYAAADAYQQQL-TAAGYGAITTEIGFPAPTFYYAEDDHQQYLAKHPN-
MSRA_XANOM      MQQGNDVGTQYRSAIYCTTQAQYAAADAYQQQL-TAAGYGAITTEIGFPAPTFYYAEDDHQQYLAKHPN-
MSRA_DROME      GLTTPIK-RQYASLILYHDEEQKQVAHA--SKLEEQER-RAPITTEIASKENFYPAEAYHQKYRLQGHKD
MSRA_MYCGE      NRQGNDIGTQYRTGIYWTDSSDEKIINDKFLKL--QKNYSKPIVTENKKVENYYLAEEYHQDYLKKNPN-
MSRA_VIBVU      MRQGNDLGTQYRSAIYTFSDQQLDIXXXXXXXXXXXXXXHNTITTEIRPAGPYFYAETYHQQYLAKNP--
MSRA_MYCPU      NKQGNDRGVQYRIGLYDKDLLKKDLNEAFM-KSEGKKNYIE--IQKVEDVT---LAEEYHQNYLLKNVNY


                         .         .         .         +         .         .         .:280
query           PYIVINDLPKIGNLKTMFPDVYRNDAVLVxxxx
MSRA2_RHILO     PYIVYNDLPKVANLKQLFPALYSEKPVLV----
MSRA2_SYNY3     PYVLVHDLPKLRKFRQQYSD-------------
MSRA_POLSQ      GYCAAVVAPKLAKFRAKF---------------
MSRA_DEIRA      GYCMAVISPKVAKLRQYYGDKLR----------
MSRA_HALWD      AYCRMHAQPKVEKVRETFTE-------------
MSRA_PASMU      SYCNLVATPKFLKAKVKFEEIWK----------
MSRA_TRIEI      PYCVFSIPPKLQKLKKYFPD-------------
MSRA_NATPD      AYCRMHAQPKIETVREAFAE-------------
MSRA_HALSA      AYCTVNVAPKVSKVREQF---------------
MSRA_HALS3      AYCTVNVAPKVSKVREQF---------------
MSRA_METHJ      ---------------------------------
MSRA_CHRVO      XXXXLVISPKLAKIRRRFSHLLQN---------
MSRA_NITSB      GYCQVVIAPKLKKFMNMFQE-------------
MSRA_ACIC5      ---------------------------------
MSRA_THET2      PYCRLVIAPKLEKARKAFKSLLR----------
MSRA_PICTO      GYCRVVIKPKVEKVRQKF---------------
MSRA_METTH      ---------------------------------
MSRA1_RHOBA     GYCQAVVAAKVRKFNRNFGD-------------
MSRA_THET8      PYCRFVIAPKLEKARKAFKSLLR----------
MSRA_SULAC      PYCKLVIDPKVKKFMKNFPD-------------
MSRA_SULSO      PYCRLVISPKVKKFMKLFPD-------------
MSRA_LEPBJ      AYCHYVIKPKIDKLKTGF---------------
MSRA_ACIBY      GYCNFAIPPKLLKLHSKFQHLMKN---------
MSRA_ACIBT      GYCNFAIPPKLLKLHSKFQHLMKN---------
MSRA_ACIBC      GYCNFAIPPKLLKLHSKFQHLMKN---------
MSRA_ACIB5      GYCNFAIPPKLLKLHSKFQHLMKN---------
MSRA_ACIB3      GYCNFAIPPKLLKLHSKFQHLMKN---------
MSRA_LACSS      ---------------------------------
MSRAB_NEIMB     CHIDIRDEPLPGKTKT-----------------
MSRAB_NEIMA     CHIDIRDEPLPGKTKT-----------------
MSRA_METMJ      ---------------------------------
MSRA_LEPBL      AYCHYVIKPKIDKLKTGF---------------
MSRA_GRABC      AYCQAVIAPKV----------------------
MSRA_ERWT9      ---------------------------------
MSRA_ACIBS      GYCNFAIPPKLLKLYSKFQHLMKD---------
MSRA_VESOH      PYCQMLIRPKL----------------------
MSRAB_NEIGO     CHIDIRDEPLPGKTK------------------
MSRA_RUTMC      PYCQMLIAPKL----------------------
MSRAB_TREPA     ---------------------------------
MSRA_METBU      ---------------------------------
MSRA_GEOMG      ---------------------------------
MSRA_SALPB      ---------------------------------
MSRA_LEUMM      ---------------------------------
MSRA_STAAC      ---------------------------------
MSRA1_STAAW     ---------------------------------
MSRA1_STAAS     ---------------------------------
MSRA1_STAAR     ---------------------------------
MSRA1_STAAN     ---------------------------------
MSRA1_STAAM     ---------------------------------
MSRA1_STAA8     ---------------------------------
MSRA_SALTY      ---------------------------------
MSRA_SALSV      ---------------------------------
MSRA_SALNS      ---------------------------------
MSRA_CLAM3      GYCNAVAVPKVNKVRKSFAQYVR----------
MSRA_RHOCS      ---------------------------------
MSRA_SALTI      ---------------------------------
MSRA_SALPK      ---------------------------------
MSRA_SALPC      ---------------------------------
MSRA_SALPA      ---------------------------------
MSRA_SALHS      ---------------------------------
MSRA_SALG2      ---------------------------------
MSRA_SALEP      ---------------------------------
MSRA_SALDC      ---------------------------------
MSRA_SALCH      ---------------------------------
MSRA_SALAR      ---------------------------------
MSRA_ESCF3      ---------------------------------
MSRA_SALA4      ---------------------------------
MSRA_KLEP3      ---------------------------------
MSRA_ENTS8      ---------------------------------
MSRA_SHIB3      ---------------------------------
MSRA_ECO5E      ---------------------------------
MSRA_ECO57      ---------------------------------
MSRA_ECO27      ---------------------------------
MSRA1_RHILO     ---------------------------------
MSRA_SHISS      ---------------------------------
MSRA_SHIFL      ---------------------------------
MSRA_SHIF8      ---------------------------------
MSRA_SHIBS      ---------------------------------
MSRA_LACS1      ---------------------------------
MSRA_GEOSL      ---------------------------------
MSRA_ECOSM      ---------------------------------
MSRA_ECOLU      ---------------------------------
MSRA_ECOLI      ---------------------------------
MSRA_ECOLC      ---------------------------------
MSRA_ECOHS      ---------------------------------
MSRA_ECODH      ---------------------------------
MSRA_ECOBW      ---------------------------------
MSRA_ECO8A      ---------------------------------
MSRA_ECO81      ---------------------------------
MSRA_ECO7I      ---------------------------------
MSRA_ECO55      ---------------------------------
MSRA_ECO45      ---------------------------------
MSRA_ECO24      ---------------------------------
MSRA_PSEFL      ---------------------------------
MSRA_LACRD      ---------------------------------
MSRA2_LACLA     ---------------------------------
MSRA_ARATH      ---------------------------------
MSRA_CLAMS      GYCNAVAVPKVNKVRKSFAQYVR----------
MSRA_SHIDS      ---------------------------------
MSRA_PSEU2      ---------------------------------
MSRA_CLOBK      ---------------------------------
MSRA2_STAAR     YY-------------------------------
MSRA_ECOL5      ---------------------------------
MSRA_CLOBJ      ---------------------------------
MSRA_CLOBH      ---------------------------------
MSRA_CLOB1      ---------------------------------
MSRA_ENT38      ---------------------------------
MSRA_ECOSE      ---------------------------------
MSRA_CLOBL      ---------------------------------
MSRA_ECOL6      ---------------------------------
MSRAB_HAEIN     ---------------------------------
MSRA2_STAAW     YY-------------------------------
MSRA2_STAAS     YY-------------------------------
MSRA2_STAA8     YY-------------------------------
MSRA_AZOC5      ---------------------------------
MSRA3_RHIME     ---------------------------------
MSRA2_STAAN     YY-------------------------------
MSRA2_STAAM     YY-------------------------------
MSRA_NITWN      ---------------------------------
MSRA_LISIN      ---------------------------------
MSRA_LEIXX      ---------------------------------
MSRA_DICDI      ---------------------------------
MSRA_CLOBM      ---------------------------------
MSRA_CYAP8      ---------------------------------
MSRA_METMA      ---------------------------------
MSRA_LISW6      ---------------------------------
MSRA_SALTO      ---------------------------------
MSRA_PSESM      ---------------------------------
MSRA_STRU0      ---------------------------------
MSRA_STRPM      ---------------------------------
MSRA_STRP3      ---------------------------------
MSRA_LISMO      ---------------------------------
MSRA_LISMH      ---------------------------------
MSRA_STREM      ---------------------------------
MSRA_STRCO      ---------------------------------
MSRA_PELUB      ---------------------------------
MSRA_METAC      ---------------------------------
MSRA_LISMF      ---------------------------------
MSRA_LISMC      ---------------------------------
MSRA_BACA2      ---------------------------------
MSRA2_RHOBA     ---------------------------------
MSRA_STRPG      ---------------------------------
MSRA_STRP8      ---------------------------------
MSRA_STRP6      ---------------------------------
MSRA_STRE4      ---------------------------------
MSRA_SERP5      ---------------------------------
MSRA_DICD3      ---------------------------------
MSRA_STRAW      ---------------------------------
MSRA_STRA3      ---------------------------------
MSRA_MYCLE      ---------------------------------
MSRA_MYCLB      ---------------------------------
MSRA_HUMAN      ---------------------------------
MSRA2_ANASP     ---------------------------------
MSAB2_STRR6     PVIDASKYPKPSDKKTLSPEEY-----------
MSAB2_STRPN     PVIDASKYPKPSDKKTLSPEEY-----------
MSRA_STRPZ      ---------------------------------
MSRA_STRPD      ---------------------------------
MSRA_STRPC      ---------------------------------
MSRA_STRPB      ---------------------------------
MSRA_STRP1      ---------------------------------
MSRA_STRA5      ---------------------------------
MSRA_STRA1      ---------------------------------
MSRA_RALSO      GYCAFVISPKVAKFRERF---------------
MSRA_PSYWF      GYCQAVIPPKLGKLRKEF---------------
MSRA_BACSU      ---------------------------------
MSRA_BACP2      ---------------------------------
MSRA_BACHD      ---------------------------------
MSRA_BACLD      ---------------------------------
MSRA_STRS7      ---------------------------------
MSRA_NOCFA      ---------------------------------
MSRA_MOUSE      ---------------------------------
MSRA_PSYCK      AYCNFAIPPKLAKLRKEF---------------
MSRA_CLOB6      ---------------------------------
MSRA_PSEMY      ---------------------------------
MSRA_MYCTU      ---------------------------------
MSRA_MYCTA      ---------------------------------
MSRA_MYCBT      ---------------------------------
MSRA_MYCBP      ---------------------------------
MSRA_MYCBO      ---------------------------------
MSRA1_LACLA     ---------------------------------
MSRA_ARTS2      GYCQVIINPKLAKARKYY---------------
MSRA_ARTCA      GYCQVIINPKLAKARKYY---------------
MSRA_RAT        ---------------------------------
MSRA_MYCMM      ---------------------------------
MSRA_METCA      ---------------------------------
MSRA_STRMU      ---------------------------------
MSRA_MYCPA      ---------------------------------
MSRA_METM7      ---------------------------------
MSRAB_ACTAC     ---------------------------------
MSRA_SCHPO      ---------------------------------
MSRA_PSYA2      AYCNFAIPPKLAKLRKEF---------------
MSRA_PSEPG      ---------------------------------
MSRA_PHOPR      ---------------------------------
MSRA_BRANA      ---------------------------------
MSRAB_STRP8     CHIDIN---------------------------
MSRAB_STRP6     CHIDIN---------------------------
MSRAB_STRP1     CHIDIN---------------------------
MSRA_SACD2      ---------------------------------
MSRA_PSEPW      ---------------------------------
MSRA_CAMJJ      GYCQAVIAPKLQKIQS-----------------
MSRA_CAMJE      GYCQAVIAPKLQKIQS-----------------
MSRA_CAMJ8      GYCQAVIAPKLQKIQS-----------------
MSRA_YERE8      ---------------------------------
MSRA_MYCSS      ---------------------------------
MSRA_MYCSK      ---------------------------------
MSRA_MYCGI      ---------------------------------
MSRA_METMP      ---------------------------------
MSRA_ERWCT      ---------------------------------
MSRA_SOLLC      ---------------------------------
MSRA_PSEE4      ---------------------------------
MSRA_MYCVP      ---------------------------------
MSRA_MYCSJ      ---------------------------------
MSRA_METM5      ---------------------------------
MSRA_PSEPK      ---------------------------------
MSRA_MYCUA      ---------------------------------
MSRA_CAMJR      GYCQAVIAPKLQKIQS-----------------
MSRA_SALAI      ---------------------------------
MSRA_VIBCM      ---------------------------------
MSRA_VIBCH      ---------------------------------
MSRA_VIBC3      ---------------------------------
MSRA_STRGG      ---------------------------------
MSRA_PSE14      ---------------------------------
MSRA_CLOPH      ---------------------------------
MSRA_PECCP      ---------------------------------
MSRA_CLOAB      ---------------------------------
MSRAB_VIBCH     ---------------------------------
MSRAB_STRP3     CHIDIN---------------------------
MSRA_ALKMQ      ---------------------------------
MSRA_BOVIN      ---------------------------------
MSRA1_SYNY3     ---------------------------------
MSRA_NAUPA      PYCMYVVAPKV----------------------
MSRA_CLOTE      ---------------------------------
MSRA_VIBPA      ---------------------------------
MSRAB_HELPY     ---------------------------------
MSRA_MYCPN      ---------------------------------
MSRA_METNO      ---------------------------------
MSRA_METM6      ---------------------------------
MSRA_LACSA      GF-------------------------------
MSRA_CAMJD      GYCQAVIAPKLQKIQS-----------------
MSRA_AZOVD      ---------------------------------
MSRA_PSEAE      ---------------------------------
MSRA_PSEAB      ---------------------------------
MSRA_PSEA8      ---------------------------------
MSRA1_ANASP     ---------------------------------
MSRA1_RHIME     ---------------------------------
MSRA_YERPY      ---------------------------------
MSRA_YERPS      ---------------------------------
MSRA_YERPP      ---------------------------------
MSRA_YERPN      ---------------------------------
MSRA_YERPG      ---------------------------------
MSRA_YERPE      ---------------------------------
MSRA_YERPB      ---------------------------------
MSRA_YERPA      ---------------------------------
MSRA_YERP3      ---------------------------------
MSRA_RHORT      ---------------------------------
MSRA_FRASN      ---------------------------------
MSRA_AGRT5      ---------------------------------
MSRA_MAGSA      ---------------------------------
MSRAB_HELPJ     ---------------------------------
MSRA_PHOLL      ---------------------------------
MSRA_FRAAN      ---------------------------------
MSRA_CORK4      ---------------------------------
MSRA2_CAUCR     ---------------------------------
MSRA_CLOPS      ---------------------------------
MSRA_METS4      ---------------------------------
MSRA_CLOP1      ---------------------------------
MSRAB_STRGC     CHINVND--------------------------
MSRA_XANC8      ---------------------------------
MSRA_XANC5      ---------------------------------
MSRA2_RHIME     ---------------------------------
MSRA_XANCP      ---------------------------------
MSRA_XANCB      ---------------------------------
MSRA_XANCH      ---------------------------------
MSRA_THEVU      ---------------------------------
MSRA_HELHP      ---------------------------------
MSAB1_STRR6     CHIDVTDADK-----------------------
MSAB1_STRPN     CHIDVTDADK-----------------------
MSRA_XANAC      ---------------------------------
MSRA_BRUSU      ---------------------------------
MSRA_BRUSI      ---------------------------------
MSRA_BRUO2      ---------------------------------
MSRA_BRUME      ---------------------------------
MSRA_BRUC2      ---------------------------------
MSRA_BRUAB      ---------------------------------
MSRA_BRUA2      ---------------------------------
MSRA_BRUA1      ---------------------------------
MSRA_CLOPE      ---------------------------------
MSRA_CORDI      ---------------------------------
MSRA_BRUMB      ---------------------------------
MSRA_UREU1      ---------------------------------
MSRA_OCHAN      ---------------------------------
MSRA_OCHA4      ---------------------------------
MSRA_UREPA      ---------------------------------
MSRA_UREP2      ---------------------------------
MSRA_MYCA5      ---------------------------------
MSRA_CORGL      ---------------------------------
MSRA_COREF      ---------------------------------
MSRAB_CAMFE     ---------------------------------
MSRA_CORGB      ---------------------------------
MSRA_CORML      ---------------------------------
MSRA_ARTAT      GYCQVIINPKLAKARKYY---------------
MSRA_MARMM      ---------------------------------
MSRA1_CAUCR     ---------------------------------
MSRA_XYLFT      ---------------------------------
MSRA_XYLFM      ---------------------------------
MSRA_XYLFA      ---------------------------------
MSRA_XYLF2      ---------------------------------
MSRA_MYCPE      ---------------------------------
MSRA_YEAST      ---------------------------------
MSRA_XANOP      ---------------------------------
MSRA_XANOM      ---------------------------------
MSRA_DROME      LASSLNLSPKL----------------------
MSRA_MYCGE      ---------------------------------
MSRA_VIBVU      ---------------------------------
MSRA_MYCPU      CHINLDDIPE-----------------------