[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08099.1

[Show Plain Result]


## Summary of Sequence Search
    1::358
    1::344       0.0 100%  344 aa  PYRD_RALME RecName: Full=Dihydroorotate dehydrogenase;       
    1::343       0.0  94%  344 aa  PYRD_RALEJ RecName: Full=Dihydroorotate dehydrogenase;       
    1::343     e-180  91%  344 aa  PYRD_RALEH RecName: Full=Dihydroorotate dehydrogenase;       
    1::343     e-170  86%  344 aa  PYRD_CUPTR RecName: Full=Dihydroorotate dehydrogenase;       
    1::344     e-165  82%  344 aa  PYRD_RALSO RecName: Full=Dihydroorotate dehydrogenase;       
    6::344     e-146  75%  347 aa  PYRD_HERAR RecName: Full=Dihydroorotate dehydrogenase;       
    6::343     e-143  75%  345 aa  PYRD_JANMA RecName: Full=Dihydroorotate dehydrogenase;       
    1::340     e-126  65%  340 aa  PYRD_BURXL RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-124  65%  345 aa  PYRD_BURTA RecName: Full=Dihydroorotate dehydrogenase;       
    3::344     e-124  64%  349 aa  PYRD_BORPA RecName: Full=Dihydroorotate dehydrogenase;       
    3::344     e-123  64%  349 aa  PYRD_BORBR RecName: Full=Dihydroorotate dehydrogenase;       
    2::332     e-123  69%  338 aa  PYRD_AZOSB RecName: Full=Dihydroorotate dehydrogenase;       
    3::344     e-122  64%  349 aa  PYRD_BORPE RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-121  64%  342 aa  PYRD_BURPS RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-121  64%  345 aa  PYRD_BURP1 RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-121  64%  342 aa  PYRD_BURP0 RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-121  64%  345 aa  PYRD_BURMS RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-121  64%  345 aa  PYRD_BURMA RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-121  64%  345 aa  PYRD_BURM9 RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-121  64%  345 aa  PYRD_BURM7 RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-120  64%  342 aa  PYRD_BURP6 RecName: Full=Dihydroorotate dehydrogenase;       
    3::345     e-120  63%  349 aa  PYRD_BORA1 RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     e-120  64%  337 aa  PYRD_METFK RecName: Full=Dihydroorotate dehydrogenase;       
    1::339     e-120  65%  344 aa  PYRD_BURP8 RecName: Full=Dihydroorotate dehydrogenase;       
    3::345     e-120  63%  349 aa  PYRD_BORPD RecName: Full=Dihydroorotate dehydrogenase;       
    2::335     e-118  66%  337 aa  PYRD_THIDA RecName: Full=Dihydroorotate dehydrogenase;       
    6::348     e-116  62%  350 aa  PYRD_POLSJ RecName: Full=Dihydroorotate dehydrogenase;       
    2::333     e-115  61%  334 aa  PYRD_ACIAD RecName: Full=Dihydroorotate dehydrogenase;       
    2::332     e-115  64%  350 aa  PYRD_AZOSE RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-115  61%  345 aa  PYRD_BURCM RecName: Full=Dihydroorotate dehydrogenase;       
    5::343     e-114  61%  344 aa  PYRD_POLNS RecName: Full=Dihydroorotate dehydrogenase;       
    6::344     e-114  61%  348 aa  PYRD_DELAS RecName: Full=Dihydroorotate dehydrogenase;       
    2::335     e-114  63%  344 aa  PYRD_CHRVO RecName: Full=Dihydroorotate dehydrogenase;       
    6::343     e-113  61%  344 aa  PYRD_METPP RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-112  60%  341 aa  PYRD_NEIM0 RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-112  60%  345 aa  PYRD_BURM1 RecName: Full=Dihydroorotate dehydrogenase;       
    1::333     e-112  60%  335 aa  PYRD_NEIMF RecName: Full=Dihydroorotate dehydrogenase;       
    6::348     e-112  62%  351 aa  PYRD_DIAST RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-111  60%  335 aa  PYRD_NEIMB RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-111  60%  335 aa  PYRD_NEIMA RecName: Full=Dihydroorotate dehydrogenase;       
    2::333     e-110  58%  334 aa  PYRD_ACIBY RecName: Full=Dihydroorotate dehydrogenase;       
    2::333     e-110  58%  334 aa  PYRD_ACIBT RecName: Full=Dihydroorotate dehydrogenase;       
    2::333     e-110  58%  334 aa  PYRD_ACIBC RecName: Full=Dihydroorotate dehydrogenase;       
    2::333     e-110  58%  334 aa  PYRD_ACIB5 RecName: Full=Dihydroorotate dehydrogenase;       
    2::333     e-110  58%  334 aa  PYRD_ACIB3 RecName: Full=Dihydroorotate dehydrogenase;       
    2::334     e-109  59%  348 aa  PYRD_NITMU RecName: Full=Dihydroorotate dehydrogenase;       
    5::343     e-109  60%  344 aa  PYRD_POLSQ RecName: Full=Dihydroorotate dehydrogenase;       
    6::348     e-109  60%  351 aa  PYRD_ACISJ RecName: Full=Dihydroorotate dehydrogenase;       
    6::344     e-108  61%  345 aa  PYRD_LEPCP RecName: Full=Dihydroorotate dehydrogenase;       
    6::353     e-108  61%  359 aa  PYRD_ACIAC RecName: Full=Dihydroorotate dehydrogenase;       
    6::347     e-108  58%  350 aa  PYRD_POLNA RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-107  58%  345 aa  PYRD_BURS3 RecName: Full=Dihydroorotate dehydrogenase;       
   14::334     e-107  61%  342 aa  PYRD_NITEU RecName: Full=Dihydroorotate dehydrogenase;       
    3::335     e-106  58%  344 aa  PYRD_PSYWF RecName: Full=Dihydroorotate dehydrogenase;       
    3::335     e-106  59%  344 aa  PYRD_PSYCK RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-106  58%  345 aa  PYRD_BURCJ RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-106  58%  345 aa  PYRD_BURCH RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     e-106  58%  345 aa  PYRD_BURCA RecName: Full=Dihydroorotate dehydrogenase;       
    3::335     e-106  59%  344 aa  PYRD_PSYA2 RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     e-106  59%  336 aa  PYRD_PROMH RecName: Full=Dihydroorotate dehydrogenase;       
    2::331     e-106  57%  336 aa  PYRD_PHOPR RecName: Full=Dihydroorotate dehydrogenase;       
    3::336     e-106  55%  336 aa  PYRD_ERWT9 RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-105  56%  341 aa  PYRD_PSEFS RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     e-105  57%  336 aa  PYRD_VIBPA RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-105  56%  343 aa  PYRD_PSEU2 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-105  55%  336 aa  PYRD_ERWCT RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-105  56%  343 aa  PYRD_PSE14 RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     e-105  57%  336 aa  PYRD_VIBSL RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     e-105  55%  339 aa  PYRD_SHEB9 RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     e-105  55%  339 aa  PYRD_SHEB8 RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     e-105  57%  336 aa  PYRD_VIBHB RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     e-104  56%  339 aa  PYRD_SHESW RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     e-104  56%  339 aa  PYRD_SHEPC RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-104  56%  341 aa  PYRD_PSEPW RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-104  55%  336 aa  PYRD_PECCP RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     e-104  54%  339 aa  PYRD_SHEB2 RecName: Full=Dihydroorotate dehydrogenase;       
    6::345     e-104  57%  360 aa  PYRD_VEREI RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     e-104  55%  340 aa  PYRD_SHEWM RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     e-104  54%  339 aa  PYRD_SHESR RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     e-104  54%  339 aa  PYRD_SHESM RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     e-104  54%  339 aa  PYRD_SHEB5 RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-104  56%  340 aa  PYRD_PSEPK RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     e-104  54%  339 aa  PYRD_SHESA RecName: Full=Dihydroorotate dehydrogenase;       
    1::325     e-103  56%  342 aa  PYRD_CELJU RecName: Full=Dihydroorotate dehydrogenase;       
    1::337     e-103  56%  340 aa  PYRD_MARAV RecName: Full=Dihydroorotate dehydrogenase;       
    2::337     e-103  54%  339 aa  PYRD_SHEDO RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-103  55%  340 aa  PYRD_PSEMY RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-103  56%  335 aa  PYRD_NEIG1 RecName: Full=Dihydroorotate dehydrogenase;       
    2::331     e-103  56%  336 aa  PYRD_AERHH RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-103  54%  343 aa  PYRD_PSESM RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-103  55%  339 aa  PYRD_PSEPF RecName: Full=Dihydroorotate dehydrogenase;       
    2::331     e-103  56%  336 aa  PYRD_AERS4 RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-102  55%  341 aa  PYRD_PSEPG RecName: Full=Dihydroorotate dehydrogenase;       
    3::336     e-102  54%  336 aa  PYRD_ENTS8 RecName: Full=Dihydroorotate dehydrogenase;       
    1::333     e-102  56%  335 aa  PYRD_ACTP2 RecName: Full=Dihydroorotate dehydrogenase;       
    1::328     e-102  56%  335 aa  PYRD_HAEPS RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-102  56%  336 aa  PYRD_KLEP7 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-102  56%  336 aa  PYRD_KLEP3 RecName: Full=Dihydroorotate dehydrogenase;       
    1::333     e-102  56%  335 aa  PYRD_ACTPJ RecName: Full=Dihydroorotate dehydrogenase;       
    1::333     e-102  55%  335 aa  PYRD_ACTP7 RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     e-102  56%  351 aa  PYRD_STRM5 RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     e-102  55%  343 aa  PYRD_PSEU5 RecName: Full=Dihydroorotate dehydrogenase;       
    6::332     e-102  56%  340 aa  PYRD_METCA RecName: Full=Dihydroorotate dehydrogenase;       
    2::333     e-102  55%  334 aa  PYRD_ACIBS RecName: Full=Dihydroorotate dehydrogenase;       
    3::334     e-102  54%  336 aa  PYRD_ESCF3 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-101  56%  336 aa  PYRD_ENT38 RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     e-101  55%  336 aa  PYRD_BAUCH RecName: Full=Dihydroorotate dehydrogenase;       
    3::336     e-101  54%  336 aa  PYRD_COLP3 RecName: Full=Dihydroorotate dehydrogenase;       
    1::330     e-101  54%  333 aa  PYRD_LEGPL RecName: Full=Dihydroorotate dehydrogenase;       
    2::334     e-101  56%  336 aa  PYRD_SODGM RecName: Full=Dihydroorotate dehydrogenase;       
    2::331     e-101  55%  336 aa  PYRD_VIBF1 RecName: Full=Dihydroorotate dehydrogenase;       
    2::331     e-101  55%  336 aa  PYRD_VIBFM RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     e-101  53%  339 aa  PYRD_SHESH RecName: Full=Dihydroorotate dehydrogenase;       
    1::330     e-101  54%  333 aa  PYRD_LEGPH RecName: Full=Dihydroorotate dehydrogenase;       
    1::330     e-101  54%  333 aa  PYRD_LEGPC RecName: Full=Dihydroorotate dehydrogenase;       
    1::330     e-101  54%  333 aa  PYRD_LEGPA RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALTY RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALSV RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALPK RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALPC RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALPB RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALPA RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALNS RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALHS RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALEP RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALDC RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALA4 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALAR RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALG2 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALCH RecName: Full=Dihydroorotate dehydrogenase;       
    3::335     e-100  55%  339 aa  PYRD_SHEFN RecName: Full=Dihydroorotate dehydrogenase;       
    1::339     e-100  53%  339 aa  PYRD_PASMU RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     e-100  54%  336 aa  PYRD_SALTI RecName: Full=Dihydroorotate dehydrogenase;       
    3::336     e-100  54%  336 aa  PYRD_PSEHT RecName: Full=Dihydroorotate dehydrogenase;       
    2::336      e-99  55%  336 aa  PYRD_VIBVU RecName: Full=Dihydroorotate dehydrogenase;       
    2::331      e-99  53%  336 aa  PYRD_ALISL RecName: Full=Dihydroorotate dehydrogenase;       
    3::335     4e-99  52%  339 aa  PYRD_SHEAM RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     6e-99  55%  336 aa  PYRD_VIBVY RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     1e-98  54%  340 aa  PYRD_PSEE4 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     2e-98  53%  336 aa  PYRD_HAMD5 RecName: Full=Dihydroorotate dehydrogenase;       
    1::332     2e-98  53%  335 aa  PYRD_HAEDU RecName: Full=Dihydroorotate dehydrogenase;       
    2::339     4e-98  54%  347 aa  PYRD_DECAR RecName: Full=Dihydroorotate dehydrogenase;       
   14::334     5e-98  57%  342 aa  PYRD_NITEC RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     1e-97  53%  336 aa  PYRD_PHOLL RecName: Full=Dihydroorotate dehydrogenase;       
    2::340     1e-97  53%  340 aa  PYRD_MANSM RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     2e-97  54%  351 aa  PYRD_STRMK RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     2e-97  54%  336 aa  PYRD_EDWI9 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     2e-97  53%  336 aa  PYRD_CITK8 RecName: Full=Dihydroorotate dehydrogenase;       
    1::334     3e-97  54%  334 aa  PYRD_IDILO RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     3e-97  52%  347 aa  PYRD_COXBU RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     3e-97  52%  347 aa  PYRD_COXBR RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     3e-97  52%  347 aa  PYRD_COXBN RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     3e-97  52%  347 aa  PYRD_COXB2 RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     3e-97  52%  347 aa  PYRD_COXB1 RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     5e-97  52%  339 aa  PYRD_SHEON RecName: Full=Dihydroorotate dehydrogenase;       
    6::354     5e-97  55%  357 aa  PYRD_RHOFD RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     8e-97  53%  336 aa  PYRD_YERE8 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     8e-97  53%  336 aa  PYRD_SHIDS RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     8e-97  53%  336 aa  PYRD_SERP5 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     8e-97  53%  336 aa  PYRD_ECOSM RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     8e-97  53%  336 aa  PYRD_ECOLU RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     8e-97  53%  336 aa  PYRD_ECO7I RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     1e-96  53%  336 aa  PYRD_SHIFL RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     1e-96  53%  336 aa  PYRD_SHIF8 RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     1e-96  54%  335 aa  PYRD_PSEA6 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     1e-96  53%  336 aa  PYRD_ECOUT RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     1e-96  53%  336 aa  PYRD_ECOL6 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     1e-96  53%  336 aa  PYRD_ECOL5 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     1e-96  53%  336 aa  PYRD_ECOK1 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     1e-96  53%  336 aa  PYRD_ECO81 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     1e-96  53%  336 aa  PYRD_ECO45 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     1e-96  53%  336 aa  PYRD_ECO27 RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     2e-96  53%  336 aa  PYRD_YERPY RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     2e-96  53%  336 aa  PYRD_YERPS RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     2e-96  53%  336 aa  PYRD_YERPP RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     2e-96  53%  336 aa  PYRD_YERPN RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     2e-96  53%  336 aa  PYRD_YERPG RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     2e-96  53%  336 aa  PYRD_YERPE RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     2e-96  53%  336 aa  PYRD_YERPB RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     2e-96  53%  336 aa  PYRD_YERPA RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     2e-96  53%  336 aa  PYRD_YERP3 RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     2e-96  53%  351 aa  PYRD_XANAC RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_SHISS RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_SHIBS RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_SHIB3 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_ECOSE RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_ECOLI RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_ECOLC RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_ECOHS RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_ECODH RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_ECOBW RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_ECO8A RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_ECO5E RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_ECO57 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_ECO55 RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     3e-96  53%  336 aa  PYRD_ECO24 RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     4e-96  53%  351 aa  PYRD_XANC5 RecName: Full=Dihydroorotate dehydrogenase;       
    1::328     7e-96  52%  339 aa  PYRD_SACD2 RecName: Full=Dihydroorotate dehydrogenase;       
    1::334     7e-96  53%  346 aa  PYRD_MARMS RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     2e-95  50%  341 aa  PYRD_SHELP RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     4e-95  51%  339 aa  PYRD_SHEPA RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     4e-95  52%  342 aa  PYRD_PSEAE RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     4e-95  52%  342 aa  PYRD_PSEA8 RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     6e-95  53%  336 aa  PYRD_PSYIN RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     1e-94  52%  342 aa  PYRD_PSEAB RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     2e-94  52%  342 aa  PYRD_PSEA7 RecName: Full=Dihydroorotate dehydrogenase;       
    1::339     3e-94  52%  339 aa  PYRD_HAEIG RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     6e-94  50%  339 aa  PYRD_SHEPW RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     3e-93  53%  339 aa  PYRD_PSEF5 RecName: Full=Dihydroorotate dehydrogenase;       
    1::339     5e-93  51%  339 aa  PYRD_HAEI8 RecName: Full=Dihydroorotate dehydrogenase;       
    3::336     7e-93  51%  341 aa  PYRD_HAHCH RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     8e-92  51%  351 aa  PYRD_XYLFT RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     8e-92  51%  351 aa  PYRD_XYLF2 RecName: Full=Dihydroorotate dehydrogenase;       
    1::335     1e-91  51%  347 aa  PYRD_AZOVD RecName: Full=Dihydroorotate dehydrogenase;       
    4::341     1e-91  50%  348 aa  PYRD_AKKM8 RecName: Full=Dihydroorotate dehydrogenase;       
    2::340     2e-91  51%  340 aa  PYRD_ACTSZ RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     2e-91  51%  351 aa  PYRD_XYLFM RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     4e-90  51%  351 aa  PYRD_XANOR RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     4e-90  51%  351 aa  PYRD_XANOP RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     4e-90  51%  351 aa  PYRD_XANOM RecName: Full=Dihydroorotate dehydrogenase;       
    1::332     5e-90  51%  351 aa  PYRD_XYLFA RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     1e-88  49%  351 aa  PYRD_XANCP RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     1e-88  49%  351 aa  PYRD_XANCB RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     1e-88  49%  351 aa  PYRD_XANC8 RecName: Full=Dihydroorotate dehydrogenase;       
    1::325     3e-88  52%  339 aa  PYRD_TERTT RecName: Full=Dihydroorotate dehydrogenase;       
    3::337     4e-88  49%  339 aa  PYRD_SHEHH RecName: Full=Dihydroorotate dehydrogenase;       
    1::338     1e-87  50%  350 aa  PYRD_FLALU RecName: Full=Dihydroorotate dehydrogenase;       
    1::336     2e-87  50%  340 aa  PYRD_ALHEH RecName: Full=Dihydroorotate dehydrogenase;       
    1::339     2e-86  49%  339 aa  PYRD_HAEIE RecName: Full=Dihydroorotate dehydrogenase;       
    1::339     4e-86  49%  339 aa  PYRD_HAEIN RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     1e-85  49%  336 aa  PYRD_VIBCM RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     1e-85  49%  336 aa  PYRD_VIBCH RecName: Full=Dihydroorotate dehydrogenase;       
    2::336     1e-85  49%  336 aa  PYRD_VIBC3 RecName: Full=Dihydroorotate dehydrogenase;       
    1::336     4e-82  48%  342 aa  PYRD_HALHL RecName: Full=Dihydroorotate dehydrogenase;       
    5::330     4e-82  50%  340 aa  PYRD_GRAFK RecName: Full=Dihydroorotate dehydrogenase;       
    4::329     3e-81  49%  337 aa  PYRD_DICNV RecName: Full=Dihydroorotate dehydrogenase;       
    5::334     6e-78  50%  344 aa  PYRD_FLAJ1 RecName: Full=Dihydroorotate dehydrogenase;       
   10::340     1e-74  48%  364 aa  PYRD_OCHA4 RecName: Full=Dihydroorotate dehydrogenase;       
    3::332     5e-74  48%  353 aa  PYRD_GLOVI RecName: Full=Dihydroorotate dehydrogenase;       
   10::334     2e-73  49%  364 aa  PYRD_BRUME RecName: Full=Dihydroorotate dehydrogenase;       
   10::334     2e-73  49%  364 aa  PYRD_BRUMB RecName: Full=Dihydroorotate dehydrogenase;       
   10::334     4e-73  48%  364 aa  PYRD_BRUSU RecName: Full=Dihydroorotate dehydrogenase;       
   10::334     4e-73  48%  364 aa  PYRD_BRUSI RecName: Full=Dihydroorotate dehydrogenase;       
   10::334     4e-73  48%  364 aa  PYRD_BRUO2 RecName: Full=Dihydroorotate dehydrogenase;       
   10::334     4e-73  48%  364 aa  PYRD_BRUC2 RecName: Full=Dihydroorotate dehydrogenase;       
    2::337     4e-73  46%  363 aa  PYRD_ANADF RecName: Full=Dihydroorotate dehydrogenase;       
   10::326     5e-73  47%  363 aa  PYRD_AGRT5 RecName: Full=Dihydroorotate dehydrogenase;       
   10::334     6e-73  48%  364 aa  PYRD_BRUAB RecName: Full=Dihydroorotate dehydrogenase;       
   10::334     6e-73  48%  364 aa  PYRD_BRUA2 RecName: Full=Dihydroorotate dehydrogenase;       
   10::334     6e-73  48%  364 aa  PYRD_BRUA1 RecName: Full=Dihydroorotate dehydrogenase;       
    3::332     4e-72  43%  337 aa  PYRD_BUCAI RecName: Full=Dihydroorotate dehydrogenase;       
    1::341     1e-71  46%  361 aa  PYRD_ROSS1 RecName: Full=Dihydroorotate dehydrogenase;       
    5::339     1e-71  46%  350 aa  PYRD_FLAPJ RecName: Full=Dihydroorotate dehydrogenase;       
    3::328     2e-71  47%  356 aa  PYRD_AZOC5 RecName: Full=Dihydroorotate dehydrogenase;       
    8::334     3e-71  46%  363 aa  PYRD_MESSB RecName: Full=Dihydroorotate dehydrogenase;       
   10::327     3e-71  48%  363 aa  PYRD_AGRVS RecName: Full=Dihydroorotate dehydrogenase;       
    9::325     1e-70  45%  360 aa  PYRD_BART1 RecName: Full=Dihydroorotate dehydrogenase;       
   13::355     1e-70  46%  363 aa  PYRD_CHLSY RecName: Full=Dihydroorotate dehydrogenase;       
   13::355     1e-70  46%  363 aa  PYRD_CHLAA RecName: Full=Dihydroorotate dehydrogenase;       
    8::340     4e-70  46%  362 aa  PYRD_RHIEC RecName: Full=Dihydroorotate dehydrogenase;       
    1::334     5e-70  46%  364 aa  PYRD_BRASO RecName: Full=Dihydroorotate dehydrogenase;       
    2::337     2e-69  43%  364 aa  PYRD_ANADE RecName: Full=Dihydroorotate dehydrogenase;       
   63::344     2e-69  50%  364 aa  PYRD_THEEB RecName: Full=Dihydroorotate dehydrogenase;       
    3::331     2e-69  43%  336 aa  PYRD_BUCAP RecName: Full=Dihydroorotate dehydrogenase;       
    8::336     3e-69  46%  362 aa  PYRD_RHILW RecName: Full=Dihydroorotate dehydrogenase;       
    2::337     3e-69  44%  364 aa  PYRD_ANAD2 RecName: Full=Dihydroorotate dehydrogenase;       
    1::329     4e-69  50%  363 aa  PYRD_MYXXD RecName: Full=Dihydroorotate dehydrogenase;       
    3::343     4e-69  47%  363 aa  PYRD_ACIF5 RecName: Full=Dihydroorotate dehydrogenase;       
    3::343     4e-69  47%  363 aa  PYRD_ACIF2 RecName: Full=Dihydroorotate dehydrogenase;       
    8::355     7e-69  47%  374 aa  PYRD_ACAM1 RecName: Full=Dihydroorotate dehydrogenase;       
    8::354     9e-69  49%  376 aa  PYRD_ANAVT RecName: Full=Dihydroorotate dehydrogenase;       
    8::326     2e-68  47%  362 aa  PYRD_RHIE6 RecName: Full=Dihydroorotate dehydrogenase;       
    2::337     2e-68  43%  364 aa  PYRD_ANASK RecName: Full=Dihydroorotate dehydrogenase;       
    4::332     2e-68  46%  349 aa  PYRD_NOVAD RecName: Full=Dihydroorotate dehydrogenase;       
    8::354     8e-68  48%  376 aa  PYRD_ANASP RecName: Full=Dihydroorotate dehydrogenase;       
    3::326     1e-67  47%  348 aa  PYRD_PARL1 RecName: Full=Dihydroorotate dehydrogenase;       
    5::332     2e-67  49%  360 aa  PYRD_DEIDV RecName: Full=Dihydroorotate dehydrogenase;       
    1::326     3e-67  46%  362 aa  PYRD_RHIME RecName: Full=Dihydroorotate dehydrogenase;       
    2::337     4e-67  44%  367 aa  PYRD_ROSCS RecName: Full=Dihydroorotate dehydrogenase;       
    8::336     5e-67  44%  362 aa  PYRD_RHIL3 RecName: Full=Dihydroorotate dehydrogenase;       
    1::329     6e-67  46%  354 aa  PYRD_RHOSK RecName: Full=Dihydroorotate dehydrogenase;       
   61::352     6e-67  50%  376 aa  PYRD_NOSP7 RecName: Full=Dihydroorotate dehydrogenase;       
    1::357     1e-66  45%  378 aa  PYRD_TRIEI RecName: Full=Dihydroorotate dehydrogenase;       
    1::326     2e-66  45%  362 aa  PYRD_SINMW RecName: Full=Dihydroorotate dehydrogenase;       
    3::340     2e-66  44%  356 aa  PYRD_ARTCA RecName: Full=Dihydroorotate dehydrogenase;       
   54::359     2e-66  48%  381 aa  PYRD_SYNJB RecName: Full=Dihydroorotate dehydrogenase;       
    1::329     2e-66  46%  354 aa  PYRD_RHOS1 RecName: Full=Dihydroorotate dehydrogenase;       
    5::333     4e-66  47%  361 aa  PYRD_DEIGD RecName: Full=Dihydroorotate dehydrogenase;       
   67::350     5e-66  49%  375 aa  PYRD_CYAP4 RecName: Full=Dihydroorotate dehydrogenase;       
    6::329     7e-66  44%  338 aa  PYRD_SALAI RecName: Full=Dihydroorotate dehydrogenase;       
   39::336     1e-65  49%  367 aa  PYRD_RHORT RecName: Full=Dihydroorotate dehydrogenase;       
   10::311     2e-65  46%  328 aa  PYRD_AGRAE RecName: Full=Dihydroorotate dehydrogenase,
   41::315     3e-65  48%  346 aa  PYRD_THET8 RecName: Full=Dihydroorotate dehydrogenase;       
   57::355     3e-65  49%  378 aa  PYRD_SYNP6 RecName: Full=Dihydroorotate dehydrogenase;       
   57::355     3e-65  49%  378 aa  PYRD_SYNE7 RecName: Full=Dihydroorotate dehydrogenase;       
    3::325     4e-65  47%  350 aa  PYRD_NATPD RecName: Full=Dihydroorotate dehydrogenase;       
   52::321     5e-65  51%  360 aa  PYRD_MYCUA RecName: Full=Dihydroorotate dehydrogenase;       
    1::350     5e-65  44%  369 aa  PYRD_DEIRA RecName: Full=Dihydroorotate dehydrogenase;       
    3::329     6e-65  43%  357 aa  PYRD_XANP2 RecName: Full=Dihydroorotate dehydrogenase;       
   41::315     6e-65  48%  346 aa  PYRD_THET2 RecName: Full=Dihydroorotate dehydrogenase;       
   52::321     1e-64  51%  360 aa  PYRD_MYCMM RecName: Full=Dihydroorotate dehydrogenase;       
    1::329     1e-64  43%  365 aa  PYRD_BRAJA RecName: Full=Dihydroorotate dehydrogenase;       
   39::336     1e-64  45%  362 aa  PYRD_AGRRK RecName: Full=Dihydroorotate dehydrogenase;       
    9::326     2e-64  43%  362 aa  PYRD_BARBK RecName: Full=Dihydroorotate dehydrogenase;       
   87::439     4e-64  43%  460 aa  PYRD_ARATH RecName: Full=Dihydroorotate dehydrogenase,
    1::332     9e-64  44%  359 aa  PYRD_RHILO RecName: Full=Dihydroorotate dehydrogenase;       
    1::329     1e-63  43%  349 aa  PYRD_HALSA RecName: Full=Dihydroorotate dehydrogenase;       
    1::329     1e-63  43%  349 aa  PYRD_HALS3 RecName: Full=Dihydroorotate dehydrogenase;       
    2::326     3e-63  45%  343 aa  PYRD_ERYLH RecName: Full=Dihydroorotate dehydrogenase;       
    1::334     3e-63  43%  364 aa  PYRD_BRASB RecName: Full=Dihydroorotate dehydrogenase;       
   57::366     2e-62  46%  396 aa  PYRD_SYNPX RecName: Full=Dihydroorotate dehydrogenase;       
    2::322     4e-62  46%  354 aa  PYRD_MYCS2 RecName: Full=Dihydroorotate dehydrogenase;       
    3::357     4e-62  42%  363 aa  PYRD_KOCRD RecName: Full=Dihydroorotate dehydrogenase;       
   11::334     5e-62  45%  364 aa  PYRD_RHOPS RecName: Full=Dihydroorotate dehydrogenase;       
   75::362     5e-62  48%  392 aa  PYRD_PROMM RecName: Full=Dihydroorotate dehydrogenase;       
    9::324     6e-62  43%  362 aa  PYRD_BARQU RecName: Full=Dihydroorotate dehydrogenase;       
    9::336     1e-61  44%  356 aa  PYRD_SPHAL RecName: Full=Dihydroorotate dehydrogenase;       
    6::329     1e-61  43%  338 aa  PYRD_SALTO RecName: Full=Dihydroorotate dehydrogenase;       
    9::324     1e-61  42%  362 aa  PYRD_BARHE RecName: Full=Dihydroorotate dehydrogenase;       
    1::329     2e-60  44%  354 aa  PYRD_RHOS4 RecName: Full=Dihydroorotate dehydrogenase;       
    3::340     3e-60  41%  357 aa  PYRD_ARTS2 RecName: Full=Dihydroorotate dehydrogenase;       
    1::334     1e-59  44%  368 aa  PYRD_STRCO RecName: Full=Dihydroorotate dehydrogenase;       
   50::340     1e-59  46%  364 aa  PYRD_RHOP5 RecName: Full=Dihydroorotate dehydrogenase;       
    8::326     1e-59  41%  362 aa  PYRD_RHISN RecName: Full=Dihydroorotate dehydrogenase;       
    4::356     1e-59  42%  377 aa  PYRD_CYAP8 RecName: Full=Dihydroorotate dehydrogenase;       
   64::359     1e-59  44%  379 aa  PYRD_CYAA5 RecName: Full=Dihydroorotate dehydrogenase;       
   66::342     1e-59  46%  371 aa  PYRD_CORGL RecName: Full=Dihydroorotate dehydrogenase;       
   54::341     1e-59  45%  376 aa  PYRD_SYNJA RecName: Full=Dihydroorotate dehydrogenase;       
   11::334     1e-59  44%  364 aa  PYRD_RHOPT RecName: Full=Dihydroorotate dehydrogenase;       
   11::334     5e-59  43%  364 aa  PYRD_RHOPA RecName: Full=Dihydroorotate dehydrogenase;       
   66::342     5e-59  46%  371 aa  PYRD_CORGB RecName: Full=Dihydroorotate dehydrogenase;       
   11::327     6e-59  44%  364 aa  PYRD_RHOP2 RecName: Full=Dihydroorotate dehydrogenase;       
    1::345     1e-58  44%  369 aa  PYRD_NOCFA RecName: Full=Dihydroorotate dehydrogenase;       
    1::321     1e-58  45%  353 aa  PYRD_MYCVP RecName: Full=Dihydroorotate dehydrogenase;       
   92::379     1e-58  44%  405 aa  PYRD_DROME RecName: Full=Dihydroorotate dehydrogenase,
    1::339     1e-58  42%  344 aa  PYRD_CLAM3 RecName: Full=Dihydroorotate dehydrogenase;       
   41::366     2e-58  46%  395 aa  PYRD_MOUSE RecName: Full=Dihydroorotate dehydrogenase,
   82::366     3e-58  47%  395 aa  PYRD_RAT RecName: Full=Dihydroorotate dehydrogenase, mitochondrial;
   24::344     3e-58  44%  355 aa  PYRD_NOCSJ RecName: Full=Dihydroorotate dehydrogenase;       
    4::323     3e-58  45%  356 aa  PYRD_MYCSS RecName: Full=Dihydroorotate dehydrogenase;       
    4::323     3e-58  45%  356 aa  PYRD_MYCSK RecName: Full=Dihydroorotate dehydrogenase;       
    4::323     3e-58  45%  356 aa  PYRD_MYCSJ RecName: Full=Dihydroorotate dehydrogenase;       
    1::339     5e-58  41%  344 aa  PYRD_CLAMS RecName: Full=Dihydroorotate dehydrogenase;       
   70::417     5e-58  46%  444 aa  PYRD_ASHGO RecName: Full=Dihydroorotate dehydrogenase,
   53::328     7e-58  46%  359 aa  PYRD_CORST RecName: Full=Dihydroorotate dehydrogenase;       
   82::366     2e-57  46%  395 aa  PYRD_HUMAN RecName: Full=Dihydroorotate dehydrogenase,
    9::356     2e-57  42%  377 aa  PYRD_CYAP7 RecName: Full=Dihydroorotate dehydrogenase;       
    1::333     8e-57  40%  359 aa  PYRD_METNO RecName: Full=Dihydroorotate dehydrogenase;       
   82::366     8e-57  45%  395 aa  PYRD_BOVIN RecName: Full=Dihydroorotate dehydrogenase,
   69::345     2e-56  46%  377 aa  PYRD_COREF RecName: Full=Dihydroorotate dehydrogenase;       
    1::324     3e-56  41%  358 aa  PYRD_METC4 RecName: Full=Dihydroorotate dehydrogenase;       
   38::326     4e-56  39%  337 aa  PYRD_WIGBR RecName: Full=Dihydroorotate dehydrogenase;       
   82::366     5e-56  45%  395 aa  PYRD_PONAB RecName: Full=Dihydroorotate dehydrogenase,
   13::338     7e-56  41%  370 aa  PYRD_STRGG RecName: Full=Dihydroorotate dehydrogenase;       
    1::334     7e-56  41%  368 aa  PYRD_STRAW RecName: Full=Dihydroorotate dehydrogenase;       
    3::330     1e-55  41%  351 aa  PYRD_NITSB RecName: Full=Dihydroorotate dehydrogenase;       
    6::333     3e-55  41%  363 aa  PYRD_CORDI RecName: Full=Dihydroorotate dehydrogenase;       
    2::322     6e-55  40%  351 aa  PYRD_HELPG RecName: Full=Dihydroorotate dehydrogenase;       
    7::355     1e-54  39%  381 aa  PYRD_SYNY3 RecName: Full=Dihydroorotate dehydrogenase;       
   52::321     2e-54  47%  356 aa  PYRD_MYCLE RecName: Full=Dihydroorotate dehydrogenase;       
    2::322     5e-54  40%  351 aa  PYRD_HELPH RecName: Full=Dihydroorotate dehydrogenase;       
    4::331     6e-54  40%  350 aa  PYRD_HALMA RecName: Full=Dihydroorotate dehydrogenase;       
    4::331     1e-53  40%  352 aa  PYRD_SULDN RecName: Full=Dihydroorotate dehydrogenase;       
   10::337     2e-53  39%  343 aa  PYRD_LEIXX RecName: Full=Dihydroorotate dehydrogenase;       
   55::336     4e-53  43%  377 aa  PYRD_THEFY RecName: Full=Dihydroorotate dehydrogenase;       
    2::322     4e-53  38%  351 aa  PYRD_HELAH RecName: Full=Dihydroorotate dehydrogenase;       
  106::412     5e-53  43%  439 aa  PYRD_CANGA RecName: Full=Dihydroorotate dehydrogenase,
   69::419     7e-53  43%  446 aa  PYRD_SACKL RecName: Full=Dihydroorotate dehydrogenase,
   54::322     6e-52  46%  353 aa  PYRD_MYCA9 RecName: Full=Dihydroorotate dehydrogenase;       
    2::322     1e-51  38%  351 aa  PYRD_HELPJ RecName: Full=Dihydroorotate dehydrogenase;       
    6::333     1e-51  42%  354 aa  PYRD_SULNB RecName: Full=Dihydroorotate dehydrogenase;       
    1::336     4e-51  42%  356 aa  PYRD_RHOOB RecName: Full=Dihydroorotate dehydrogenase;       
    7::334     5e-51  36%  348 aa  PYRD_METI4 RecName: Full=Dihydroorotate dehydrogenase;       
   66::335     8e-51  44%  370 aa  PYRD_MYCPA RecName: Full=Dihydroorotate dehydrogenase;       
   14::322     1e-50  39%  351 aa  PYRD_HELPS RecName: Full=Dihydroorotate dehydrogenase;       
  217::535     4e-50  41%  569 aa  PYRD_PLAF7 RecName: Full=Dihydroorotate dehydrogenase homolog,
    1::321     4e-50  41%  353 aa  PYRD_MYCGI RecName: Full=Dihydroorotate dehydrogenase;       
    1::328     5e-50  41%  356 aa  PYRD_RHOE4 RecName: Full=Dihydroorotate dehydrogenase;       
    1::334     5e-50  38%  357 aa  PYRD_MYCBT RecName: Full=Dihydroorotate dehydrogenase;       
    1::334     5e-50  38%  357 aa  PYRD_MYCBP RecName: Full=Dihydroorotate dehydrogenase;       
   68::418     5e-50  42%  445 aa  PYRD2_KLULA RecName: Full=Dihydroorotate dehydrogenase,
    1::334     2e-49  38%  357 aa  PYRD_MYCTU RecName: Full=Dihydroorotate dehydrogenase;       
    1::334     2e-49  38%  357 aa  PYRD_MYCTA RecName: Full=Dihydroorotate dehydrogenase;       
    1::334     2e-49  38%  357 aa  PYRD_MYCBO RecName: Full=Dihydroorotate dehydrogenase;       
   14::353     4e-49  37%  366 aa  PYRD_KINRD RecName: Full=Dihydroorotate dehydrogenase;       
    2::326     6e-49  37%  359 aa  PYRD_NAUPA RecName: Full=Dihydroorotate dehydrogenase;       
  111::419     2e-48  44%  446 aa  PYRD2_KLUMA RecName: Full=Dihydroorotate dehydrogenase,
    2::322     2e-48  37%  351 aa  PYRD_HELPY RecName: Full=Dihydroorotate dehydrogenase;       
   99::421     7e-48  40%  443 aa  PYRD_SCHPO RecName: Full=Dihydroorotate dehydrogenase,
   66::430     9e-48  38%  444 aa  PYRD_CANAL RecName: Full=Dihydroorotate dehydrogenase,
   14::322     2e-44  37%  351 aa  PYRD_HELP2 RecName: Full=Dihydroorotate dehydrogenase;       
   10::275     2e-18  30%  306 aa  PYRD_METJA RecName: Full=Dihydroorotate dehydrogenase;       
    7::271     2e-18  31%  306 aa  PYRD_AQUAE RecName: Full=Dihydroorotate dehydrogenase;       
   10::281     4e-17  29%  303 aa  PYRD_PYRHO RecName: Full=Dihydroorotate dehydrogenase;       
   10::283     2e-16  29%  303 aa  PYRD_PYRAB RecName: Full=Dihydroorotate dehydrogenase;       
    7::272     2e-16  29%  311 aa  PYRD_SULSY RecName: Full=Dihydroorotate dehydrogenase;       
   10::266     2e-16  36%  305 aa  PYRD_GEOSF RecName: Full=Dihydroorotate dehydrogenase;       
   10::266     3e-15  33%  305 aa  PYRD_GEOSM RecName: Full=Dihydroorotate dehydrogenase;       
   10::266     7e-15  31%  305 aa  PYRD_GEOSL RecName: Full=Dihydroorotate dehydrogenase;       
   10::266     7e-15  31%  305 aa  PYRD_GEOMG RecName: Full=Dihydroorotate dehydrogenase;       
   40::282     7e-15  32%  303 aa  PYRD_BRAHW RecName: Full=Dihydroorotate dehydrogenase;       
   10::266     1e-14  35%  305 aa  PYRD_GEOUR RecName: Full=Dihydroorotate dehydrogenase;       
   10::266     1e-14  34%  305 aa  PYRD_GEOBB RecName: Full=Dihydroorotate dehydrogenase;       
   16::265     2e-14  34%  304 aa  PYRD_DESRM RecName: Full=Dihydroorotate dehydrogenase;       
    8::262     3e-14  33%  311 aa  PYRD_BACSU RecName: Full=Dihydroorotate dehydrogenase, catalytic
   12::283     5e-14  29%  302 aa  PYRD_PYRKO RecName: Full=Dihydroorotate dehydrogenase;       
    9::263     6e-14  31%  301 aa  PYRD_UNCMA RecName: Full=Dihydroorotate dehydrogenase;       
   11::265     6e-14  33%  307 aa  PYRD_PORGI RecName: Full=Dihydroorotate dehydrogenase;       
    9::265     6e-14  30%  307 aa  PYRD_DESAP RecName: Full=Dihydroorotate dehydrogenase;       
    9::267     8e-14  28%  312 aa  PYRDB_ENTFA RecName: Full=Dihydroorotate dehydrogenase B, catalytic
   11::285     1e-13  30%  304 aa  PYRD_PELPD RecName: Full=Dihydroorotate dehydrogenase;       
   10::269     1e-13  33%  307 aa  PYRD_LACDA RecName: Full=Dihydroorotate dehydrogenase;       
   12::266     1e-13  30%  309 aa  PYRD_HELMI RecName: Full=Dihydroorotate dehydrogenase;       
   10::264     1e-13  31%  312 aa  PYRD_ANOFW RecName: Full=Dihydroorotate dehydrogenase;       
   10::262     2e-13  30%  301 aa  PYRD_THETN RecName: Full=Dihydroorotate dehydrogenase;       
    7::254     2e-13  32%  304 aa  PYRD_PEDPA RecName: Full=Dihydroorotate dehydrogenase;       
    7::267     2e-13  30%  307 aa  PYRD_LACAC RecName: Full=Dihydroorotate dehydrogenase;       
   10::284     2e-13  32%  305 aa  PYRD_LACPL RecName: Full=Dihydroorotate dehydrogenase;       
   10::269     2e-13  31%  307 aa  PYRD_LACH4 RecName: Full=Dihydroorotate dehydrogenase;       
   10::269     2e-13  32%  307 aa  PYRD_LACDB RecName: Full=Dihydroorotate dehydrogenase;       
   10::281     2e-13  31%  305 aa  PYRD_BACHD RecName: Full=Dihydroorotate dehydrogenase;       
    9::251     3e-13  29%  304 aa  PYRD_FUSNN RecName: Full=Dihydroorotate dehydrogenase;       
    1::279     4e-13  27%  300 aa  PYRD_THEAC RecName: Full=Dihydroorotate dehydrogenase;       
    8::281     4e-13  33%  304 aa  PYRD_SOLUE RecName: Full=Dihydroorotate dehydrogenase;       
    1::264     4e-13  29%  303 aa  PYRD_BACV8 RecName: Full=Dihydroorotate dehydrogenase;       
    8::262     4e-13  31%  311 aa  PYRD_BACA2 RecName: Full=Dihydroorotate dehydrogenase;       
    9::283     5e-13  29%  302 aa  PYRD_SYNWW RecName: Full=Dihydroorotate dehydrogenase;       
   10::264     5e-13  32%  313 aa  PYRD_GEOKA RecName: Full=Dihydroorotate dehydrogenase;       
    1::264     5e-13  29%  303 aa  PYRD_BACTN RecName: Full=Dihydroorotate dehydrogenase;       
    1::280     7e-13  28%  301 aa  PYRD_THEVO RecName: Full=Dihydroorotate dehydrogenase;       
   11::254     9e-13  33%  307 aa  PYRD_LACSS RecName: Full=Dihydroorotate dehydrogenase;       
    8::262     9e-13  31%  310 aa  PYRD_BACP2 RecName: Full=Dihydroorotate dehydrogenase;       
   13::267     2e-12  29%  306 aa  PYRD_MYCPE RecName: Full=Dihydroorotate dehydrogenase;       
   10::267     2e-12  31%  307 aa  PYRD_LACJO RecName: Full=Dihydroorotate dehydrogenase;       
   10::264     2e-12  30%  313 aa  PYRD_GEOTN RecName: Full=Dihydroorotate dehydrogenase;       
    6::249     2e-12  30%  300 aa  PYRD_CLOPH RecName: Full=Dihydroorotate dehydrogenase;       
    8::264     2e-12  29%  304 aa  PYRD_LISMF RecName: Full=Dihydroorotate dehydrogenase;       
    8::264     2e-12  29%  304 aa  PYRD_LISMC RecName: Full=Dihydroorotate dehydrogenase;       
   10::264     2e-12  32%  313 aa  PYRD_BACCL RecName: Full=Dihydroorotate dehydrogenase, catalytic
   11::264     2e-12  29%  302 aa  PYRD_AZOPC RecName: Full=Dihydroorotate dehydrogenase;       
    7::265     5e-12  31%  270 aa  PYRD_THEP1 RecName: Full=Dihydroorotate dehydrogenase;       
    7::265     5e-12  31%  270 aa  PYRD_THEMA RecName: Full=Dihydroorotate dehydrogenase;       
   15::264     6e-12  30%  305 aa  PYRD_PARD8 RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     6e-12  28%  309 aa  PYRD_BACCR RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     6e-12  28%  309 aa  PYRD_BACC2 RecName: Full=Dihydroorotate dehydrogenase;       
    8::264     8e-12  29%  304 aa  PYRD_LISW6 RecName: Full=Dihydroorotate dehydrogenase;       
    8::264     8e-12  29%  304 aa  PYRD_LISMO RecName: Full=Dihydroorotate dehydrogenase;       
    8::264     8e-12  29%  304 aa  PYRD_LISIN RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     8e-12  28%  309 aa  PYRD_BACC4 RecName: Full=Dihydroorotate dehydrogenase;       
   10::266     1e-11  31%  307 aa  PYRD_PROAC RecName: Full=Dihydroorotate dehydrogenase;       
    8::264     1e-11  29%  304 aa  PYRD_LISMH RecName: Full=Dihydroorotate dehydrogenase;       
   12::285     1e-11  31%  304 aa  PYRD_GEOLS RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     1e-11  27%  309 aa  PYRD_BACAH RecName: Full=Dihydroorotate dehydrogenase;       
   10::288     1e-11  29%  304 aa  PYRD_BACSK RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     1e-11  28%  309 aa  PYRD_BACCN RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     2e-11  27%  309 aa  PYRD_BACWK RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     2e-11  27%  309 aa  PYRD_BACHK RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     2e-11  27%  309 aa  PYRD_BACCZ RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     2e-11  27%  309 aa  PYRD_BACCQ RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     2e-11  27%  309 aa  PYRD_BACC7 RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     2e-11  27%  309 aa  PYRD_BACC3 RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     2e-11  27%  309 aa  PYRD_BACC1 RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     2e-11  27%  309 aa  PYRD_BACC0 RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     2e-11  27%  309 aa  PYRD_BACAN RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     2e-11  27%  309 aa  PYRD_BACAC RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     2e-11  27%  309 aa  PYRD_BACAA RecName: Full=Dihydroorotate dehydrogenase;       
    1::264     3e-11  28%  303 aa  PYRD_BACFR RecName: Full=Dihydroorotate dehydrogenase;       
    1::264     3e-11  28%  303 aa  PYRD_BACFN RecName: Full=Dihydroorotate dehydrogenase;       
   11::266     4e-11  32%  306 aa  PYRD_DESMR RecName: Full=Dihydroorotate dehydrogenase;       
   10::249     9e-11  29%  305 aa  PYRD_STACT RecName: Full=Dihydroorotate dehydrogenase;       
   10::264     1e-10  30%  313 aa  PYRD_GEOSW RecName: Full=Dihydroorotate dehydrogenase;       
   10::264     1e-10  28%  309 aa  PYRD_EXIS2 RecName: Full=Dihydroorotate dehydrogenase;       
    1::262     1e-10  28%  303 aa  PYRD_NATTJ RecName: Full=Dihydroorotate dehydrogenase;       
    7::261     2e-10  26%  300 aa  PYRD_CALS8 RecName: Full=Dihydroorotate dehydrogenase;       
    7::261     2e-10  28%  300 aa  PYRD_ANATD RecName: Full=Dihydroorotate dehydrogenase;       
   16::260     2e-10  29%  314 aa  PYRD_METMA RecName: Full=Dihydroorotate dehydrogenase;       
   10::265     2e-10  29%  302 aa  PYRD_ALKMQ RecName: Full=Dihydroorotate dehydrogenase;       
    8::290     7e-10  27%  311 aa  PYRD_STRU0 RecName: Full=Dihydroorotate dehydrogenase;       
    3::263     7e-10  30%  300 aa  PYRD_PETMO RecName: Full=Dihydroorotate dehydrogenase;       
   13::270     9e-10  32%  308 aa  PYRD_LACRJ RecName: Full=Dihydroorotate dehydrogenase;       
   13::270     9e-10  32%  308 aa  PYRD_LACRD RecName: Full=Dihydroorotate dehydrogenase;       
   13::269     9e-10  30%  311 aa  PYRDB_LACLA RecName: Full=Dihydroorotate dehydrogenase B, catalytic
    4::265     2e-09  27%  291 aa  PYRD_SULAC RecName: Full=Dihydroorotate dehydrogenase;       
   46::289     2e-09  27%  310 aa  PYRD_STRA5 RecName: Full=Dihydroorotate dehydrogenase;       
   46::289     2e-09  27%  310 aa  PYRD_STRA3 RecName: Full=Dihydroorotate dehydrogenase;       
   46::289     2e-09  27%  310 aa  PYRD_STRA1 RecName: Full=Dihydroorotate dehydrogenase;       
    7::262     3e-09  31%  302 aa  PYRD_THEPX RecName: Full=Dihydroorotate dehydrogenase;       
   14::281     3e-09  26%  314 aa  PYRD_SACCA RecName: Full=Dihydroorotate dehydrogenase;       
    9::263     5e-09  27%  304 aa  PYRD_OCEIH RecName: Full=Dihydroorotate dehydrogenase;       
    7::280     8e-09  26%  300 aa  PYRD_PYRFU RecName: Full=Dihydroorotate dehydrogenase;       
   10::286     1e-08  28%  306 aa  PYRD_AERPE RecName: Full=Dihydroorotate dehydrogenase;       
   32::293     2e-08  28%  314 aa  PYRD_SACPA RecName: Full=Dihydroorotate dehydrogenase;       
   16::257     2e-08  27%  311 aa  PYRD_METAC RecName: Full=Dihydroorotate dehydrogenase;       
   32::293     3e-08  27%  314 aa  PYRD_SACMI RecName: Full=Dihydroorotate dehydrogenase;       
    7::262     4e-08  30%  302 aa  PYRD_THEP3 RecName: Full=Dihydroorotate dehydrogenase;       
   45::289     4e-08  30%  311 aa  PYRD_STRS7 RecName: Full=Dihydroorotate dehydrogenase;       
   11::263     4e-08  27%  300 aa  PYRD_CLOD6 RecName: Full=Dihydroorotate dehydrogenase;       
   32::293     7e-08  27%  314 aa  PYRD_YEAST RecName: Full=Dihydroorotate dehydrogenase;       
   45::289     7e-08  30%  311 aa  PYRD_STRE4 RecName: Full=Dihydroorotate dehydrogenase;       
   10::254     7e-08  27%  302 aa  PYRD_ALKOO RecName: Full=Dihydroorotate dehydrogenase;       
   13::269     7e-08  29%  311 aa  PYRDB_LACLM RecName: Full=Dihydroorotate dehydrogenase B, catalytic
   46::289     3e-07  26%  311 aa  PYRD_STRP1 RecName: Full=Dihydroorotate dehydrogenase;       
  513::835     3e-07  27% 1022 aa  DPYD_DANRE RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
    8::282     6e-07  24%  303 aa  PYRD_METTH RecName: Full=Dihydroorotate dehydrogenase;       
    9::267     6e-07  25%  305 aa  PYRD_DESAD RecName: Full=Dihydroorotate dehydrogenase;       
  704::835     6e-07  29% 1025 aa  DPYD_MOUSE RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
   46::289     8e-07  26%  311 aa  PYRD_STRPG RecName: Full=Dihydroorotate dehydrogenase;       
   10::267     8e-07  26%  299 aa  PYRD_ARCFU RecName: Full=Dihydroorotate dehydrogenase;       
   46::289     1e-06  26%  311 aa  PYRD_STRP8 RecName: Full=Dihydroorotate dehydrogenase;       
   14::286     1e-06  28%  307 aa  PYRD_CARHZ RecName: Full=Dihydroorotate dehydrogenase;       
  728::859     2e-06  32% 1053 aa  DPYD_CAEBR RecName: Full=Probable dihydropyrimidine dehydrogenase
  704::835     2e-06  29% 1025 aa  DPYD_RAT RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];    
  169::300     3e-06  32%  411 aa  YEIA_ECOLI RecName: Full=Uncharacterized protein yeiA;
  718::849     3e-06  32% 1059 aa  DPYD_CAEEL RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
   46::283     4e-06  27%  311 aa  PYRD_STRR6 RecName: Full=Dihydroorotate dehydrogenase;       
   46::283     6e-06  27%  311 aa  PYRD_STRPN RecName: Full=Dihydroorotate dehydrogenase;       
  704::835     6e-06  28% 1025 aa  DPYD_PIG RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];    
  704::835     6e-06  27% 1025 aa  DPYD_HUMAN RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
  704::835     6e-06  33% 1025 aa  DPYD_BOVIN RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
  702::833     1e-05  29% 1009 aa  DPYD_DICDI RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
  704::835     1e-05  27% 1025 aa  DPYD_PONAB RecName: Full=Dihydropyrimidine dehydrogenase [NADP+];  
   84::208     2e-05  32%  220 aa  DEOC_STACT RecName: Full=Deoxyribose-phosphate aldolase;       
   89::215     9e-05  30%  225 aa  DEOC_THEGJ RecName: Full=Probable deoxyribose-phosphate aldolase;  
  120::192     1e-04  28% 1194 aa  MED14_COCIM RecName: Full=Mediator of RNA polymerase II
  181::236     2e-04  43%  255 aa  GGGPS_METTP RecName: Full=Geranylgeranylglyceryl phosphate
   84::209     2e-04  32%  220 aa  DEOC_ENTFA RecName: Full=Deoxyribose-phosphate aldolase;       
   30::89      3e-04  40%  311 aa  PYRDA_ENTFA RecName: Full=Dihydroorotate dehydrogenase A;       
   32::281     3e-04  25%  315 aa  PYRD1_KLULA RecName: Full=Dihydroorotate dehydrogenase;       
   69::208     6e-04  31%  220 aa  DEOC_STRZJ RecName: Full=Deoxyribose-phosphate aldolase;       
   69::208     6e-04  31%  220 aa  DEOC_STRPJ RecName: Full=Deoxyribose-phosphate aldolase;       
   69::208     6e-04  31%  220 aa  DEOC_STRP4 RecName: Full=Deoxyribose-phosphate aldolase;       
   71::215     6e-04  32%  224 aa  DEOC_PYRKO RecName: Full=Probable deoxyribose-phosphate aldolase;  
  124::219     8e-04  30%  231 aa  DEOC_THETN RecName: Full=Deoxyribose-phosphate aldolase;       
   84::208     8e-04  31%  220 aa  DEOC_STRZT RecName: Full=Deoxyribose-phosphate aldolase;       
   86::211     8e-04  32%  223 aa  DEOC_GEOKA RecName: Full=Deoxyribose-phosphate aldolase;       
   69::214     8e-04  24%  220 aa  DEOC_CALS8 RecName: Full=Deoxyribose-phosphate aldolase;       
    1::358

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxVLNALYPLLRPALFSMDAEDAHHFTLNNLMRAKRMGLAGCIGNSIADDPRTVMGVR
PYRD_RALME      --------------MLNALYPLLRPALFSMDAEDAHHFTLNNLMRAKRMGLAGCIGNSIADDPRTVMGVR
PYRD_RALEJ      --------------MLNALYPLFRPALFSMDAEDAHHFTLNNLLRAQRLGLGGCIGNRIAEDPRTVMGVR
PYRD_RALEH      --------------MLNALYPLVRPALFSMDAEDAHHFTLNNLLRAHRMGLAGCIGNRIADDPRTVMGVR
PYRD_CUPTR      --------------MLNALYPLFRPALFSMDAEDAHHFTLNNLLRAHRMGLGSCIGNRIAEDPHTVMGVR
PYRD_RALSO      --------------MLNALYPLARPLLFSMDPEDAHHFTLNQLKRAHALGLSGCIGARVAPQPRTVMGIA
PYRD_HERAR      ------------------LYALARPFLFAIDPEAAHNLTLHALRRAASLGWTSAIAKP-AHDPRTVMGIT
PYRD_JANMA      ------------------LYTLARPFLFAIDPEAAHNLTLPALRRAAAMGLTSSIVKP-AHDPRTVMGIT
PYRD_BURXL      --------------MFSSLYPLVRAQLFRMDAEDAHHLTXXXXXXXXXXXXXXXXXPRVPDAPRTVMGLT
PYRD_BURTA      --------------MFSSLYPLARASLFKMDAEDAHHLTXXXXXXXXXXXXXXXXSSRVPDAPRTVMGLT
PYRD_BORPA      --------------ILFHAYPLARPALFAMDAETAHEVTLAQLQRAYDCGLTRKLLHAQPEAPATLMGLS
PYRD_BORBR      --------------ILFHAYPLARPALFAMDAETAHEVTLAQLQRAYDCGLTRKLLHAQPEAPATLMGLS
PYRD_AZOSB      ------------------LYDIARPFLFSLDAETAHEFTLAALNLAGRTLPAG---KPEAADAVRVMGID
PYRD_BORPE      --------------ILFHAYPLARPALFAMDAETAHEVTLAQLQRAYDCGLTRKLLHAQPEAPATLMGLS
PYRD_BURPS      --------------MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLACALSPRVPDAPRTVMGLS
PYRD_BURP1      --------------MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLACALSPRVPDAPRTVMGLS
PYRD_BURP0      --------------MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLACALSPRVPDAPRTVMGLS
PYRD_BURMS      --------------MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLACALSPRVPDAPRTVMGLS
PYRD_BURMA      --------------MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLACALSPRVPDAPRTVMGLS
PYRD_BURM9      --------------MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLACALSPRVPDAPRTVMGLS
PYRD_BURM7      --------------MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLACALSPRVPDAPRTVMGLS
PYRD_BURP6      --------------MFSSLYPLARASLFKMDAEDAHHLTLRMLGAAGRTGLACALSPRVPDAPRTVMGLS
PYRD_BORA1      --------------ILFNAYPLARPALFAMDAETAHEVTLASLQRAYDCGTTRRWLHDQPQLPTTLMGMT
PYRD_METFK      ------------------LYSIVKPWLFRLDAERAHDFTLKNLKRLERSGLLNLYPRPPKCKQRQVMGIN
PYRD_BURP8      --------------MFSSLYPLVRAQLFRMDAEDXXXXXXXXXXXXXXXXXXXXXXPRVPDSPRTVMGLT
PYRD_BORPD      --------------ILFQAYPLARPALFAMDAETAHEVTLAGLQRAYDCGATRRLLRTRPQAPATLMGLA
PYRD_THIDA      ------------------LYSLIRPALFSLDAEDAHGLTLTGLDVAQRLGLVG-LQPRATGKPVQVMGID
PYRD_POLSJ      -------------------YALARPFLFGLDPETAHELTMASLARTQGTPLSLAWCSSRVNDPIALAGLK
PYRD_ACIAD      ------------------LYSLARPMLFSLAPERAHELTLSMLKTAHKMGM---LRQTIQPKPVTCMGIE
PYRD_AZOSE      ------------------LYNIARPLLFSLDPETAHELSLAALHFFGRVLPAATPTES---DPVDVMGLH
PYRD_BURCM      --------------MFSSLYPLARASLFKMDAEDXXXXXXXXXXXXXXXXXXXXXSARVPDAPRTVMGLT
PYRD_POLNS      -------------------YSLLRPWLFCIDPEKAHNLTLSNLDRAQRWGFLERLITKPINDPQVLCGIE
PYRD_DELAS      -------------------YALTRPFLFGMDPESAHDLTMNLMAKGQNTLLQQAWAQPMVSDPVELAGLK
PYRD_CHRVO      ------------------LYPLLRPLLFKFDAETAHEHTLKMLDRAHRLHLTPLAASPAARQPVQAMGLT
PYRD_METPP      -------------------YALTRPFLFGLDAEHAHELTLASIARLQNTPLQCLWQQPRIDDPVTLAGVR
PYRD_NEIM0      ------------------MYPLARRILFALDAEKAHHFTLDALNMVYKLGLIPVTGNRTK--PVKLMGLD
PYRD_BURM1      --------------MFSSLYPLARASLFKMDAEDXXXXXXXXXXXXXXXXXXXXXSARVPDAPRTVMGLT
PYRD_NEIMF      ------------------MYPLARRILFALDAEKAHHFTLDALNMVYKLGLIPVTGNRTK--PVKLMGLD
PYRD_DIAST      -------------------YALARSFLFGMDAEAAHELTMDMLARGQRTPLQWAWCNETVSDPIELAGLR
PYRD_NEIMB      ------------------MYPLARRILFALDAEKAHHFTLDALYTVYKLGLIPVTDNRTK--PVKLMGMD
PYRD_NEIMA      ------------------MYPLARRILFALDAEKAHHFTLDALYTVYKLGLIPVTDNRTK--PVKLMGMD
PYRD_ACIBY      ------------------LYSLARPMLFSLAPERAHELTLSMLDKAHKLGM---MRQTVEAKPTTCMGIE
PYRD_ACIBT      ------------------LYSLARPMLFSLAPERAHELTLSMLDKAHKLGM---MRQTVEAKPTTCMGIE
PYRD_ACIBC      ------------------LYSLARPMLFSLAPERAHELTLSMLDKAHKLGM---MRQTVEAKPTTCMGIE
PYRD_ACIB5      ------------------LYSLARPMLFSLAPERAHELTLSMLDKAHKLGM---MRQTVEAKPTTCMGIE
PYRD_ACIB3      ------------------LYSLARPMLFSLAPERAHELTLSMLDKAHKLGM---MRQTVEAKPTTCMGIE
PYRD_NITMU      ------------------LYSLLRPLVFALEPETAHGIAFNAMETAHRLGLYRA--RPAPCRSRSIMGLT
PYRD_POLSQ      -------------------YSLLRPWLFCLDPEQAHNLTLKNLDRAQRFGLLQRLVSKPIADPQNLCGIE
PYRD_ACISJ      -------------------YALARSFLFGMDAEAAHELTMDMLARGQRTPLQWAWCNETVSDPIELAGLR
PYRD_LEPCP      -------------------YPLTRPFLFGMDPEAAHELTLGSIARFQNTPLQCLWSQSRIADPVTVAGLR
PYRD_ACIAC      -------------------YALTRPFLFGMDAEAAHELTMDMLARGQRTPLQWAWSGEQVSDPVQLAGLT
PYRD_POLNA      -------------------YALARPFLFGLDPETAHELTMASLARTQGTLLSAAYCSSKVSDPIELAGLK
PYRD_BURS3      --------------MFSSLYPLARASLFKMDAEDXXXXXXXXXXXXXXXXXXXXXSARVPDAPRTVMGLT
PYRD_NITEU      ------------------------------DPETAHTVTLDTLNLLKRTGLLP--DRTIDCTPVRVMELD
PYRD_PSYWF      -------------------YALLRPFLFNLDPEHAHELTLQLLEKAHKARALGFI-YSQQSLPTECMGLQ
PYRD_PSYCK      -------------------YALLRPFLFNMDPEHAHEMTLSLLDKAHKARVLGLVGQSM--QPTDCMGLQ
PYRD_BURCJ      --------------MFSSLYPLARASLFKMDAEDXXXXXXXXXXXXXXXXXXXXXSARVPDAPRTVMGLT
PYRD_BURCH      --------------MFSSLYPLARASLFKMDAEDXXXXXXXXXXXXXXXXXXXXXSARVPDAPRTVMGLT
PYRD_BURCA      --------------MFSSLYPLARASLFKMDAEDXXXXXXXXXXXXXXXXXXXXXSARVPDAPRTVMGLT
PYRD_PSYA2      -------------------YALLRPFLFNMDPEHAHEMTLSLLDKAHKARVLGLVGQSM--QPTDCMGLQ
PYRD_PROMH      -------------------YSLVRKALFRLDPERAHDFTFRQLKRLSHSPFQFLIQQSLPAKPVSCMGLS
PYRD_PHOPR      ------------------IYRLARSVFFQLDAEKAHDLAIQNFSRFTGTPLDLFYRQHVPDRPVEVMGIK
PYRD_ERWT9      -------------------YPFVRKALFKLDAERAHELTLQQLKRLSGTPLTKLIHQSLPFKPVNCMGLT
PYRD_PSEFS      ------------------MYTLARQLLFKLSPETSHDLSLDLIGAGGRLGLNGLVCKAPAKVPVSVMGLD
PYRD_VIBPA      ------------------LYRLARTGFFQLDAEKAHDLAIKNFQRFNGTPLDLFYRQQLPNRPVECMGLT
PYRD_PSEU2      ------------------MYNLARQLLFKLSPETSHDLSLDXXXXXXXXXXXXXXSKSPAKLPVSVMGLE
PYRD_ERWCT      -------------------YPVIKKALFQLDPERAHELTFQQLRRITNTPFEFLVRQSVPTKPVTCMGLS
PYRD_PSE14      ------------------MYNLARQLLFKLSPETSHDLSLDXXXXXXXXXXXXXXSKSPAKLPVSVMGLE
PYRD_VIBSL      ------------------LYRLARTGFFQLDAEKAHDLAIQNFKRFTGTPIDLLYRQQLPNRPVECMGLT
PYRD_SHEB9      -------------------YKIAQKVMFQMDPERAHHLAIGSLKMTANSPLTCLYGQTIAPAPVSVMGLT
PYRD_SHEB8      -------------------YKIAQKVMFQMDPERAHHLAIGSLKMTANSPLTCLYGQTIAPAPVSVMGLT
PYRD_VIBHB      ------------------LYRLARTGFFQLDAEKAHDLAIKNFQRFNGTPLDLFYRQQLPNRPVECMGLT
PYRD_SHESW      -------------------YKIAQKVMFQMDPERAHNLAIGSLKMTGNSPLNCFYRQTIAPAPVTFMGLT
PYRD_SHEPC      -------------------YKIAQKVMFQMDPERAHNLAIGSLKMTGNSPLNCFYRQTIAPAPVTFMGLT
PYRD_PSEPW      ------------------MYTLARQLLFKLSPETSHDLSLDLIGAGGRLGLNGVLCKQPAALPVSVMGLN
PYRD_PECCP      -------------------YPVIKKALFQLDPERAHELTFQQLRRITNTPFEFLVRQSVPTKPVTCMGLS
PYRD_SHEB2      -------------------YKIAQKVMFQMDPERAHHLAIGSLKMTANSPLTCLYGQTITPAPVSVMGLT
PYRD_VEREI      -------------------YALTRPFLFGLDAEAAHELIIDLLARGQRTPLQWAWCNQTVDDPIELAGLR
PYRD_SHEWM      -------------------YKLAQKVMFQMDPEKAHHFALNSLMATANTPLDCFYAQKIAPSPVEFMGVT
PYRD_SHESR      -------------------YKIAQKVMFQMDPERAHNLAIGSLKMTGNSPLNAFYAQNIAPAPVSFMGLT
PYRD_SHESM      -------------------YKIAQKVMFQMDPERAHNLAIGSLKMTGNSPLNAFYAQNIAPAPVSFMGLT
PYRD_SHEB5      -------------------YKIAQKVMFQMDPERAHHLAIGSLKMTANSPLTCLYGQTIAPAPVSVMGLT
PYRD_PSEPK      ------------------MYTLARQLLFKLSPETSHDLSLDLIGAGGRLGLNGMLCKQPASLPVSVMGLN
PYRD_SHESA      -------------------YKIAQKVMFQMDPERAHNLAIGSLKMTGNSPLNAFYAQNIAPAPVSFMGLT
PYRD_CELJU      ------------------MYSHVRDLLFRLNPETSHEFSLDMLGAAERLKLIGLMAAKVPETPVEVMGLR
PYRD_MARAV      ------------------MYGLLRNLLFRLPPERAHNVALGSLDVAQKLGILNTFTRQPEPCPVNVMGLE
PYRD_SHEDO      ------------------LYSLAQKFMFQMDAEQAHDLAIKSLKFTANSPLACGYSQALQSSPVNCMGIT
PYRD_PSEMY      ------------------MYSLARELLFKLSPETSHELSIDXXXXXXXXXXXXXXTKAPASLPTSVMGLQ
PYRD_NEIG1      ------------------MYPLARRILFALDAEKAHHFTLDALNTVYKLGLIPVTDNRTK--PIKLMGMD
PYRD_AERHH      ------------------LYPLARHFLFKLNPEQAHDLSIKYLPRLLGTPLDCFFRHSLPKRPVTVMGLS
PYRD_PSESM      ------------------MYNLARQLLFKLSPETSHDLSLDXXXXXXXXXXXXXXXKSAAKLPVSVMGLE
PYRD_PSEPF      ------------------MYTLARQLLFKLSPETSHDLSLDXXXXXXXXXXXXXXCKAPASLPVNVMGLQ
PYRD_AERS4      ------------------LYPLARHFLFKFNPEQAHDLSIKYLPRLLGTPLDCFFRHSLPKRPVTVMGLY
PYRD_PSEPG      ------------------MYTLARQLLFKLSPETSHDLSLDLIGAGGRLGLNGMLCKQPAALPVSVMGLN
PYRD_ENTS8      -------------------YPFVRKALFQLDPERAHEFTFQQMRRITGTPLEALLRQKVPSKPVSCMGLT
PYRD_ACTP2      ------------------MYSLIRKCLFSMDAETAHNFSIQALKLAGKLPINVL---PMPLNPVEVMGLQ
PYRD_HAEPS      ------------------MYPLIKKALFNLDAENAHQLAIQSLKLFGKTPFS--LACSLPDNPTEVMGLR
PYRD_KLEP7      -------------------YPFVRKALFQLDPERAHEVTFQQLRRVTGTPLEMLVRQKVPARPVTCMGLT
PYRD_KLEP3      -------------------YPFVRKALFQLDPERAHEVTFQQLRRVTGTPLEMLVRQKVPARPVTCMGLT
PYRD_ACTPJ      ------------------MYSLIRKCLFLMDAETAHNFSIQALKLAGKLPINVL---PMPLNPVEVMGLQ
PYRD_ACTP7      ------------------MYSLIRKCLFSMDAETAHNFSIQALKLAGKLPINVL---PMPLNPVEVMGLQ
PYRD_STRM5      ------------------MYSLARPFLFSLDAERAHGLGLSALDLAYRTGTTPLLAARIAPMPSTVFGLT
PYRD_PSEU5      ------------------MYNLARQLLFKLSPETSHELSLELIGAGGRLGLNAMLSKPPASLPVRVMGLD
PYRD_METCA      ---------------------LLRPLLFRLDPETAHEXXXXXXXXXXXXGPANPLKQSLPTSPRTVMGLE
PYRD_ACIBS      ------------------LYSLARPMLFSLAPERAHELTLSMLDKAHKLGI---MRQTVEAKPTTCMGIE
PYRD_ESCF3      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPVKPVSCMGLT
PYRD_ENT38      -------------------YPFVRKALFQLDPERAHELTFQQLRRITGTPLEALVRQKVQEKPVQCMGLT
PYRD_BAUCH      ------------------LYPLIRQFLFQLDPEKAHELTIQQLKRIAGTPLEYLVRQSVPTKAVTCMGIA
PYRD_COLP3      -------------------YPAIRKVLFQFDAETIHELTIKGLKSTGKSPFNAFYKQTVQDKPLTVMGIN
PYRD_LEGPL      ------------------MYSLLRPLLFRLDAEKAHSLTLSLLHY-----LPGFYFRKMAGQPVHAMGLV
PYRD_SODGM      ------------------LYPLIKQALFQLDPERAHELTFQQLKRITGTPLEWLVRQSVPTKTVNCMGIA
PYRD_VIBF1      ------------------LYRIARAGIFKLDAEKAHDLAIQNFKRFNGTPLDIFYRQNLASKPVEVMGIK
PYRD_VIBFM      ------------------LYRIARAGIFKLDAEKAHDLAIQNFKRFNGTPLDIFYRQNLASKPVEVMGIK
PYRD_SHESH      -------------------YKIAQKVMFQMDPEKAHHLAIASLKATANTPLDCFYAQKFTQAPVEFMGVT
PYRD_LEGPH      ------------------MYSLLRPLLFRLDAEKAHSLTLSLLHY-----LPGFYFRKIAGQPVHAMGLV
PYRD_LEGPC      ------------------MYSLLRPLLFRLDAEKAHSLTLSLLHY-----LPGFYFRKIAGQPVHAMGLV
PYRD_LEGPA      ------------------MYSLLRPLLFRLDAEKAHSLTLSLLHY-----LPGFYFRKIAGQPVHAMGLV
PYRD_SALTY      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALSV      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALPK      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALPC      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALPB      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALPA      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALNS      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALHS      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALEP      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALDC      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALA4      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALAR      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALG2      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SALCH      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_SHEFN      -------------------YKLAQKVMFQMDPELAHNIAIGSLKMTGNNLLNCFYRQQVKSSPVTCMGLT
PYRD_PASMU      ------------------MYALIRKALFSLDAEQAHDLTIKTLKTLGRSPFNPLLKTLFAGSPKTIMGLH
PYRD_SALTI      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPLEALVRQKVPTKPVTCMGLT
PYRD_PSEHT      -------------------YDLARRFMFTRDAEWAHEFALNNLSRFANTPLSAAWSQNIVNKPVNFLGLE
PYRD_VIBVU      ------------------LYRLARAGFFQLDAEKAHDLAIQNFKRFTGTPIDLFYRQQLPNRPVECMGLT
PYRD_ALISL      ------------------LYRIARAGIFKLDAEKAHDLAIQNFKRFNGTPLDIFYRQKLVSKPVEVMGIQ
PYRD_SHEAM      -------------------YKIAQSIMFQMDPERAHNLAIGSLKRTANTPMTAFYAQCIAPKPVTCMGII
PYRD_VIBVY      ------------------LYRLARAGFFQLDAEKAHDLAIQNFKRFTGTPIDLFYRQQLPNRPVECMGLT
PYRD_PSEE4      ------------------MYTLARQLLFKLSPETSHDLSLDXXXXXXXXXXXXXXCKQPAALPVSVMGLN
PYRD_HAMD5      -------------------YSCLKKILFQLDPEHSHEFTFRHLKRITGTPLQFLISQSVPTKSVDCMGLS
PYRD_HAEDU      ------------------MYSLIRKALFSMEAETAHYFSIQALKLMGKLPFSLC---STTLNPVEVMGLK
PYRD_DECAR      ------------------LYPLIRKFFFSLDAETAHGIGMKGIDLMNXXXXXXXXXXXXXXXXXXXMGLK
PYRD_NITEC      ------------------------------DAETAHTLTLDTLGLLQKTGLLP--NRTIYCTPVRAMGLD
PYRD_PHOLL      -------------------YPLARKALFQLDPEHAHELTFRQLKRITGTPFEFFIRQSIATKPVTCMGLS
PYRD_MANSM      ------------------LYPLIRKGIFALEPENAHHLAGNPILNKLLKALLACPSGN----EKTVMGIK
PYRD_STRMK      ------------------MYSLARPFLFSLDAERAHGLGLSALDLAYRTGTTPLLAARIAPMPSTVFGLT
PYRD_EDWI9      -------------------YPFIRKALFQLDPERAHEFTFRQLHRISGTPLIGLLRQSVPSKPVSCMGLS
PYRD_CITK8      -------------------YPFVRKALFQLDPERAHEFTFQQLRRVTGTPLEALVRQKVPAKPVSCMGLT
PYRD_IDILO      ------------------MYNLIKPLLFRQDPEKTHELMLGILSKWHRTPLSLFWKQNVASKPVRVMGID
PYRD_COXBU      ------------------IYRYLRPWLFKLEPETAHALTLNCLKWFYCYWLINRRLQRFPQKPTVVFGIE
PYRD_COXBR      ------------------IYRYLRPWLFKLEPETAHALTLNCLKWFYCYWLINRRLQRFPQKPTVVFGIE
PYRD_COXBN      ------------------IYRYLRPWLFKLEPETAHALTLNCLKWFYCYWLINRRLQRFPQKPTVVFGIE
PYRD_COXB2      ------------------IYRYLRPWLFKLEPETAHALTLNCLKWFYCYWLINRRLQRFPQKPTVVFGIE
PYRD_COXB1      ------------------IYRYLRPWLFKLEPETAHALTLNCLKWFYCYWLINRRLQRFPQKPTVVFGIE
PYRD_SHEON      -------------------YKIAQKVMFQMDPERAHNLAIGSLRMTGNGPLNAFYAQNITPAPVSFMGLT
PYRD_RHOFD      -------------------YALARPFLFSLDPETAHELTVRXXXXXXXXXXXXXYGTSRVNDPITLAGLT
PYRD_YERE8      -------------------YPLVKKALFQLDPERAHEFTFRQLKRLTGTPLQFLVSQSVPTKPVSCMGLS
PYRD_SHIDS      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_SERP5      -------------------YPLIRKALFQLDPERAHELTFQQLRRVTGTPLEFLIRQSVPTKPVSCMGLS
PYRD_ECOSM      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECOLU      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECO7I      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_SHIFL      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_SHIF8      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_PSEA6      ------------------MYAILQKFLFTQDAEWSHDFTINWLKRTQHNFLNVAYKQHIDDKPVEFLGIT
PYRD_ECOUT      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECOL6      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECOL5      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECOK1      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECO81      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECO45      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECO27      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_YERPY      -------------------YPLVRKALFQLDPERAHELTFRQLKRVSGTPLEFLVRQSVPTKPVSCMGLS
PYRD_YERPS      -------------------YPLVRKALFQLDPERAHELTFRQLKRVSGTPLEFLVRQSVPTKPVSCMGLS
PYRD_YERPP      -------------------YPLVRKALFQLDPERAHELTFRQLKRVSGTPLEFLVRQSVPTKPVSCMGLS
PYRD_YERPN      -------------------YPLVRKALFQLDPERAHELTFRQLKRVSGTPLEFLVRQSVPTKPVSCMGLS
PYRD_YERPG      -------------------YPLVRKALFQLDPERAHELTFRQLKRVSGTPLEFLVRQSVPTKPVSCMGLS
PYRD_YERPE      -------------------YPLVRKALFQLDPERAHELTFRQLKRVSGTPLEFLVRQSVPTKPVSCMGLS
PYRD_YERPB      -------------------YPLVRKALFQLDPERAHELTFRQLKRVSGTPLEFLVRQSVPTKPVSCMGLS
PYRD_YERPA      -------------------YPLVRKALFQLDPERAHELTFRQLKRVSGTPLEFLVRQSVPTKPVSCMGLS
PYRD_YERP3      -------------------YPLVRKALFQLDPERAHELTFRQLKRVSGTPLEFLVRQSVPTKPVSCMGLS
PYRD_XANAC      ------------------MYSLARPFLFSLDAERAHALALRSIDTAYRTGTTALLARRPVPLPTPAFGLM
PYRD_SHISS      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_SHIBS      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_SHIB3      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECOSE      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECOLI      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECOLC      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECOHS      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECODH      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECOBW      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECO8A      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECO5E      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECO57      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECO55      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_ECO24      -------------------YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPAKPVNCMGLT
PYRD_XANC5      ------------------MYSLARPFLFSLDAERAHALALRSIDTAYRTGTTALLARRPVPLPTPAFGLI
PYRD_SACD2      ------------------MYSFIRNCLFKLDAEVSHELSLDWLGAFERLHMLKPFALKVTPSPINVMGID
PYRD_MARMS      ------------------MYQLARSLLFKLDPEVSHEXXXXXXXXXXXXXXNRFLGGLPSTKPVDVMGLR
PYRD_SHELP      -------------------YKIAQKVMFQMDPEKAHNLAIGSLKSTANSPLNCFYAQKLQAAPVEFMGLT
PYRD_SHEPA      -------------------YKIAQKFMFQMDPELAHNFAIGSLKFTGNSPLNCFYAQNIKPAPVTMMGLT
PYRD_PSEAE      ------------------MYTLARQLLFKLSPETSHELSIDXXXXXXXXXXXXXXTPKPASLPVSVLGLE
PYRD_PSEA8      ------------------MYTLARQLLFKLSPETSHELSIDXXXXXXXXXXXXXXTPKPASLPVSVLGLE
PYRD_PSYIN      -------------------YQIMRSFLFMLNPEKAHDFSIKQLKLTQGTALDFIYXXXXXXXXXXXMGLT
PYRD_PSEAB      ------------------MYTLARQLLFKLSPETSHELSIDXXXXXXXXXXXXXXTPEPASLPVSVLGLE
PYRD_PSEA7      ------------------MYTLARQLLFKLSPETSHELSIDLIXXXXXXXXXXXXXXXXXSLPVSVLGLE
PYRD_HAEIG      ------------------MYQLFRHGIFQMDAEKAHDFTIQCLKLAGNPLFQPILKSLIHAPPKTVMGVN
PYRD_SHEPW      -------------------YKIAQKFMFQMDPELAHNFAIGSLKSTGNSPLNCFYAQKIKPAPVTMMGLT
PYRD_PSEF5      ------------------MYTLARQLLFKLSPETSHDLSLDXXXXXXXXXXXXXXCKAPAQMPVKVMGLE
PYRD_HAEI8      ------------------MYQLFRHGIFQMDAEKAHDFTIQCLKLASNPLFQPILKSLIHAPPKTVMGVN
PYRD_HAHCH      -------------------YQLARQFLFRLPAEASHNISLKMLKMADNAGMLGMFMPQMYSRPVELMGIT
PYRD_XYLFT      ------------------MYSLFRPLLFTCDAERAHDISLRTLDIAYHSGAXXXXXXXXXXXXXXAFGLN
PYRD_XYLF2      ------------------MYSLFRPLLFTCDAERAHDISLRTLDIAYHSGAXXXXXXXXXXXXXXAFGLN
PYRD_AZOVD      ------------------MYTLARQLLFKLSPETAHELTIDXXXXXXXXXXXXXXCHRPASLPVRVMGLD
PYRD_AKKM8      -----------------ALYSAAKSVLFQMNPETAHKVTLWGLRLAEKMRVLPLVMGEVPSDPVEILGMK
PYRD_ACTSZ      ------------------LYPLIRKGIFALEPETAHHIAGNPWLNRALKALLGCPQGT----EKTVMGIK
PYRD_XYLFM      ------------------MYSLFRPLLFTCDTERAHDISLRTLDIAYHSGAXXXXXXXXXXXXXXAFGLN
PYRD_XANOR      ------------------MYSLARPLLFSLDAERAHALALRSIDTAYRTGTTSLLSTRPVPLPTPAFGLM
PYRD_XANOP      ------------------MYSLARPLLFSLDAERAHALALRSIDTAYRTGTTSLLSTRPVPLPTPAFGLM
PYRD_XANOM      ------------------MYSLARPLLFSLDAERAHALALRSIDTAYRTGTTSLLSTRPVPLPTPAFGLM
PYRD_XYLFA      ------------------MYSLFRPLLFTCDTERAHDISLCTLDIAYHSGAXXXXXXXXXXXXXXAFGLN
PYRD_XANCP      ------------------MYSLARPFLFAFDAERAHALALRAIDTAYRTGTTALVATRPVPLPTPAFGLM
PYRD_XANCB      ------------------MYSLARPFLFAFDAERAHALALRAIDTAYRTGTTALVATRPVPLPTPAFGLM
PYRD_XANC8      ------------------MYSLARPFLFAFDAERAHALALRAIDTAYRTGTTALVATRPVPLPTPAFGLM
PYRD_TERTT      ------------------MYAFARKLLFSLDPETAHELSLDCLGAAERLQLLKPFVATPVSDPVEVMGLR
PYRD_SHEHH      -------------------YKIAQKFMFQMDPELAHNLAIGSLKSTGNSPLNCFYAQNIKPAPVTMMGLT
PYRD_FLALU      ------------------MYSLLRPALFCMDAERAHGAGLRALDLAYRSGTLGLLASRPAPLPTRAFGLE
PYRD_ALHEH      ------------------MYSLIRPLLMRMDAERSHEFSLAWMDXXXXXXXXXXXXXXXXPDPRRVMGLT
PYRD_HAEIE      ------------------MYQLFRHGIFQMDAEKAHNFTIQCLKLAGNKPILKSIIHAPKGFPKMVMGVN
PYRD_HAEIN      ------------------MYQLFRHGIFQMDAEKAHNFTIQCLKLAGNPLFQPILKSLIHAPPKTVMGVN
PYRD_VIBCM      ------------------LYRLARAGFFQLDAEKAHDLAISNFKRFTGTPFDLFYRQQLPHRPVQCMGLT
PYRD_VIBCH      ------------------LYRLARAGFFQLDAEKAHDLAISNFKRFTGTPFDLFYRQQLPHRPVQCMGLT
PYRD_VIBC3      ------------------LYRLARAGFFQLDAEKAHDLAISNFKRFTGTPFDLFYRQQLPHRPVQCMGLT
PYRD_HALHL      ------------------MYALIRQLLFRLEPEQAHRVS----MQLARLGLAAVPGRSLPAVPRRVMGID
PYRD_GRAFK      ---------------------LIRPTLFKFDPEEIHYFTFNFLRKCKIPGATSYLKSKFARLEREVFGLK
PYRD_DICNV      -------------------YPHLRPLLFCLNPEIAHNLTLQILSRA-----AVFIPRIKAGNPIHLLGHT
PYRD_FLAJ1      ---------------------IIRPILFWFDPEEVHYFTFSFVKFISKIPGVSSIIRSIYEVKREVFGIK
PYRD_OCHA4      -----------------------RRALFAFDAEQAHGLSIAGL----KTGLVTC---GAPNDPALVAGLQ
PYRD_GLOVI      ------------------LYRLARPLLFRADPEDAHRRALGALAWAAEQLWAGWLDSVFGPDPRLLWGLS
PYRD_BRUME      -----------------------RRALFTFDAEQAHGLSITGL----KTGIVTC---RTPEDPALVAGLK
PYRD_BRUMB      -----------------------RRALFTFDAEQAHGLSITGL----KTGIVTC---RTPEDPALVAGLK
PYRD_BRUSU      -----------------------RRALFTFDAEQAHGLSITGL----KTGIVTC---RTPEDPALVAGLK
PYRD_BRUSI      -----------------------RRALFTFDAEQAHGLSITGL----KTGIVTC---RTPEDPALVAGLK
PYRD_BRUO2      -----------------------RRALFTFDAEQAHGLSITGL----KTGIVTC---RTPEDPALVAGLK
PYRD_BRUC2      -----------------------RRALFTFDAEQAHGLSITGL----KTGIVTC---RTPEDPALVAGLK
PYRD_ANADF      ------------------IWPALRWTLFHLDPERAHRLAHGALHRVPP-GLARLRRPAVPPELRSCLGLD
PYRD_AGRT5      -----------------------RKGLFLIDPEKAHGLSVAAL---KSGFLPTCM---VPHDPRTVAGLV
PYRD_BRUAB      -----------------------RRALFTFDAEQAHGLSITGL----KTGIVTC---RTPEDPALVAGLK
PYRD_BRUA2      -----------------------RRALFTFDAEQAHGLSITGL----KTGIVTC---RTPEDPALVAGLK
PYRD_BRUA1      -----------------------RRALFTFDAEQAHGLSITGL----KTGIVTC---RTPEDPALVAGLK
PYRD_BUCAI      -------------------YYFIRKLLFLLEPEKAHFLTLKYLNIKNIQFFDFFFYKTIILSKKICMGLI
PYRD_ROSS1      ---------------MTSLYALIRPLLFRLDAERAHDLTAKALRVTSXXXXXXXXXXXXYEDPLLAVGLH
PYRD_FLAPJ      ---------------------IIRPILFCFDPEKVHYFTFSLIRTIAKIPGFTSIFKSLYEVEREVFGLK
PYRD_AZOC5      ------------------LYPLVRPFLPLFTPEQAHGLSI----RALKKGLVPADRSPADPVLRTVWNID
PYRD_MESSB      ---------------------LTRPVLFAFDPERAHELSI----AALKTGIPFCSGGQNSKLAVSVAGLN
PYRD_AGRVS      -----------------------RPGLFLFDAETAHGLSIAGL---KTSLMPKC---HLPDDPRTVAGLH
PYRD_BART1      -----------------------RSALFMLDPEHAHRLAIVGL----KSGLNGC--QKVVDKRLTIAGLK
PYRD_CHLSY      ----------------------IRPILFRLDAETAHERTLHILALISRSRLCKTIGTTIRDQQRTVCGIP
PYRD_CHLAA      ----------------------IRPILFRLDAETAHERTLHILALISRSRLCKTIGTTIRDQQRTVCGIP
PYRD_RHIEC      ---------------------LARRGLFLFDPETAHGMSI----AALKSGLVPAC--QIAPDPRTIAGLT
PYRD_BRASO      --------------MIRAFDQLSLPLLRWLDAEDAHRLAIQGLKLLPAV-------KPRADDAKLAVGLN
PYRD_ANADE      ------------------LWPALRSVLFQLDPERVHHLAHWXXXXXXXXXXXXXXXXXXXXXXXXCMGLD
PYRD_THEEB      ---------------------------------------------------------------RQVWGLR
PYRD_BUCAP      -------------------YYLIRKLLFLIDPEKAHTLVLMYLNSKKIQILRKIFIKPIPLKQIKCMGLT
PYRD_RHILW      ---------------------LARKGLFLFDPETAHGMSI----AALKSGLVPAC--QITPDPRTVAGLT
PYRD_ANAD2      ------------------LWPALRSVLFQLDPERVHHLAHWXXXXXXXXXXXXXXXXSIPALAVRCMGLD
PYRD_MYXXD      ------------------MYGLTRSLLFQLSAERAH-----------RLGMAGLLGRSLCESLREVAGLR
PYRD_ACIF5      -------------------YGLLRPLLFTLDPERAHTLSIAALEALGHMGLARVARRYTAHDPRLAQGLH
PYRD_ACIF2      -------------------YGLLRPLLFTLDPERAHTLSIAALEALGHMGLARVARRYTAHDPRLAQGLH
PYRD_ACAM1      ----------------------LQPLLFSADPETVHRQLMRNVDQGLAQGLQRRLASSLVEDPRSLWGLS
PYRD_ANAVT      ----------------------VRPLLFDLDPEWLHQQTMRSLSRTSTKWVQNILQKSLCEDSRNLFGLR
PYRD_RHIE6      ---------------------LARKGLFLFDPETAHGMSI----AALKSGLVPAC--QITPDPRTVAGLT
PYRD_ANASK      ------------------LWPALRSVLFQLDPERVHHLAHWXXXXXXXXXXXXXXXXXXXXXXXXCMGLD
PYRD_NOVAD      -------------------YSLLRPLIFRIPAEPAHRLTI------KALGLAQG-GTTLAPTPQRIAGLA
PYRD_ANASP      ----------------------VRPLLFDLDPEWLHQQTMRSLSRTSTKWVQNILQKSLCEDSRNLFGLR
PYRD_PARL1      ------------------LFPLARPLMSLMDPETAHGXXXXXXXXXXXXXXXXXDPVSLAID---LFGLH
PYRD_DEIDV      ---------------------VIKPALFRLDAEDAHHLTVNALALMSRLPPAAARRLSAPADSRTLWGHT
PYRD_RHIME      --------------MIGQLEHLARRGLFLFDPEAAHGLSI----KALKSGLVSCAAPA---DPRTVAGLV
PYRD_ROSCS      ------------------LYHLIRPLLFRLDAERAHDVVTAMFRATSRMPLLPRLISALYDDPALMVGLR
PYRD_RHIL3      ---------------------LARKGLFLFDPETAHGMSI----AALKSGLVPAC--QLTPDPRTVAGLT
PYRD_RHOSK      ---------------MNILERAALTALHRMDPEKAHSLSLSAL-RSGLVPLPGPVTSSLATD---VGGLV
PYRD_NOSP7      -----------------------------------------------------------------LFGLN
PYRD_TRIEI      --------------MLNIYRSVLFPIIFSADPEWAHHQVLNMLSFIDTHSDSQLV-NSIRTTEQNLWELN
PYRD_SINMW      --------------MIGGLEHLARRGLFLFDPEAAHGLSITALK-------TGLVPSCAAPDPRSVAGLA
PYRD_ARTCA      ------------------VYPTFFKLAFSMDAERAHTLGFKGIRLAHATGAGRVLRKLTAPAPSTAFGIT
PYRD_SYNJB      -------------------------------------------------------------DPRSLWGLT
PYRD_RHOS1      ---------------MNILERAALTALHRMDPEKAHSLSLSAL----RSGLVPLPGPVTSPRLATVGGLV
PYRD_DEIGD      ---------------------LLRPALFRLDPEDAHHLTLRALGLASAVPAWPSLVRRLTAPTQTLWGRT
PYRD_CYAP4      -------------------------------------------------------------------GLT
PYRD_SALAI      ---------------------VVRPTLFRLDAEAAHEFAVRRLAGLARMALAVLRARYGVSAPRTVFGLR
PYRD_RHORT      -----------------------------------------------------------ADDPVSLWGRR
PYRD_AGRAE      -----------------------RRALFAFDAEQAHGLSIAGL----KTGLVGSAPNDLALSVK-VAGLQ
PYRD_THET8      ------------------------------------------------------------EDPRLAFGVS
PYRD_SYNP6      -------------------------------------------------------------DPRLAMGLT
PYRD_SYNE7      -------------------------------------------------------------DPRLAMGLT
PYRD_NATPD      ------------------LYQLLKPALFQLDAETAH-----GLGHRVLDGIQGTLERIVADDPRLAFGQT
PYRD_MYCUA      ----------------------------------------------------------------TVFGVR
PYRD_DEIRA      ------------------MYQTVRPLLFRLDAEDAHHLTLRGLRLARTLTVPGTQGPGDAALRRTLWGQT
PYRD_XANP2      ------------------LYGVLKPLFRFMTPEQAHHLSI----RVLKSGLVPDLSGG-PDDPTRVWGLD
PYRD_THET2      ------------------------------------------------------------EDPRLAFGVS
PYRD_MYCMM      ----------------------------------------------------------------TVFGVR
PYRD_BRAJA      --------------MIRAFDALSLPVLRWLDPEDAHRLAIQGLRFLPPV-------KPRADDPKLAVGLN
PYRD_AGRRK      ----------------------------------------------------------VSNDPRLVAGLD
PYRD_BARBK      -----------------------RSALFMLDPEHAHNLAILWLK-------SGLNSHKRIVDKRLVAGLK
PYRD_ARATH      ---------------------VVNPFFALLDAEFAHKLAVSAAAR-------GWVPREKRPDPAIVWGRK
PYRD_RHILO      ---------------MSVLDRLGQKLLFAFDPETAHGLSI----AALRCGLPA--GTRAVRDIRSLCGLD
PYRD_HALSA      ------------------MYGLLKSALFGLPPETTHEITTSALRVAQRVGAHRAYAKQFTTDPRLAFGQT
PYRD_HALS3      ------------------MYGLLKSALFGLPPETTHEITTSALRVAQRVGAHRAYAKQFTTDPRLAFGQT
PYRD_ERYLH      ------------------LFSLIRPAIHALDPERAHRFSIEALKLAPLPHSR----HSDASLSVKVAGIR
PYRD_BRASB      --------------MIRAFDQLSLPLLRWLDAEDAHRLAIQGLKLLPAI-------KPRPDDAKLAVGLN
PYRD_SYNPX      -------------------------------------------------GLAGDLQRRDLRLEQVLFGCR
PYRD_MYCS2      ------------------MYRVLRRALFLAPAERVHVWVFA-LLRAXXXXXXXXXXXXXXXXXSTVFGVH
PYRD_KOCRD      ------------------LYPAFFKAAFSMDPELAHTLGFAGIKLAHRTGLGRVLSRVTAPDEGAVMGLT
PYRD_RHOPS      ------------------------PLLRLFDAEDAHRLAIQGLRLLPQV-------KPRPDDPKLAVGLN
PYRD_PROMM      ---------------------------------------------------------------QVLFGCR
PYRD_BARQU      -----------------------RFALFMLDPEHAHRLAIVGLK-------SGLNSYRKVVDRRTVAGLE
PYRD_SPHAL      ----------------DAAYALARPLVHATDGEAAHNLTLAALQRARHALTSPMLATELA-------GLR
PYRD_SALTO      ---------------------VVRPRLFRLDAETAHEFTXXXXXXXXXXXXXXXXXXXXVSAPRTVFGLR
PYRD_BARHE      -----------------------RSALFMLDPEHAHRLAI--------MGLKSGLNSKVVDNRLTIAGLK
PYRD_RHOS4      ---------------MNILERAALTALHRMDPEKAHSLSLSAL----RSGLVPLPGPVTSPRLATXXXXX
PYRD_ARTS2      ------------------VYPTFFRLAFSMDAERAHRIGFRAIRLAHSSGAGRVLAKFTAPAPSTAFGIT
PYRD_STRCO      ------------------MYKTFFKLVFSMDPERAHHLAFRWIRLAVRVPVAAALAPRHKELRTEALGLR
PYRD_RHOP5      -------------------------------------------------------------------GLN
PYRD_RHISN      ---------------------LARRGLFLLDPETAHGVSIKAL---KSGVVPSCAAPADTRLEQVIAGLN
PYRD_CYAP8      --------------LLKPFYPLVLTAAKS-NPEGAHLQLLNTLNTLERTHLSQLDQSFCVDDSRTLWGLT
PYRD_CYAA5      ---------------------------------------------------------------QNLWGLT
PYRD_CORGL      -----------------------------------------------------------------VFGVT
PYRD_SYNJA      -------------------------------------------------------------DPRLLWGLT
PYRD_RHOPT      ------------------------PLLRWLDPEDAHRLAIQGLKLWPPV-------KPRPDDSKLAVGLN
PYRD_RHOPA      ------------------------PLLRWLDPEDAHRLAIQGLKLWPPV-------KPRPDDSKLAVGLN
PYRD_CORGB      -----------------------------------------------------------------VFGVT
PYRD_RHOP2      ------------------------PLLRLLDAEDAHRLAIQGLRLLPQV-------KPRPDDSKLAVGLN
PYRD_NOCFA      ------------------MYALLLRVMFLVPPERIHHLXXXXXXXXXXXXPTRALVRRLADDPSTVFGVP
PYRD_MYCVP      ------------------MYAALRKAFFLVPPERIHTWVFAGLRAATTAEXXXXXXXXXPHDPSTVFGTR
PYRD_DROME      -------------------------------------------------------------------GRM
PYRD_CLAM3      ------------------MYPLLRTVLSRMDPEDAHHLASTAIALLPSSGFGWIARRLTAPDPSLALGLR
PYRD_MOUSE      ----------------------LMPALQRLDPESAHRL-------AVRVISLGLLPRATFQDSNMVLGHK
PYRD_RAT        -----------------------------------------------------------------VLGHK
PYRD_NOCSJ      ------------------------------DPERAHHGAFRAI-RAARPVLAS---RRTPGEQVTALGLT
PYRD_MYCSS      -------------------YHALRRVLFLISPERIHTWVFA-LLRAVRRALQGRLAPRDPVLASTVFGVR
PYRD_MYCSK      -------------------YHALRRVLFLISPERIHTWVFA-LLRAVRRALQGRLAPRDPVLASTVFGVR
PYRD_MYCSJ      -------------------YHALRRVLFLISPERIHTWVFA-LLRAVRRALQGRLAPRDPVLASTVFGVR
PYRD_CLAMS      ------------------MYPLLRTVLSRMDPEDAHHLASTAISLLPPSGLGWIARRLTAPDPSLALGLR
PYRD_ASHGO      --------------------PLVR--LVTPDAEDGHKLGIWFL----KYGLAPKLMFD-KDDPVLVFGKT
PYRD_CORST      ---------------------------------------------------------------QTVFGVD
PYRD_HUMAN      -----------------------------------------------------------------VLGHK
PYRD_CYAP7      -------------------YPLAFWSLQS-NPEQAHQYLIKLLNRIDRFRLSQIEASFCFQDPRLVQGLR
PYRD_METNO      --------------MLASLFPLARPVLHALDAETAHRLTIXXXXXXXXXXXXXXXXXXXV----SVLGRH
PYRD_BOVIN      -----------------------------------------------------------------VLGHK
PYRD_COREF      -----------------------------------------------------------------VFGVT
PYRD_METC4      --------------MIDALFPLARPLLHGLDAETAHDLTIRGXXXXXXXXXXXXXXXXAVE----MFGQS
PYRD_WIGBR      ------------------------------------------------------IKNKFPNNNISCMGLN
PYRD_PONAB      -----------------------------------------------------------------VLGHK
PYRD_STRGG      -----------------------------MDPERAHYAAFRWIRLAARIPVAAALAPRHKELRTEALGLR
PYRD_STRAW      ------------------MYKLFFRLVFKMDPEQAHYLAFRWIRLAARIPVAAALAPRFKELRTEAFGLR
PYRD_NITSB      -------------------YESIKKILFHFDPETAHHFILNRLQE-----------KFLVKDPQELFGKT
PYRD_CORDI      -------------------YALALKGMFTMSPERIHHIITRGMQLVQAISLRRAVGSILVNDPQEVFGVT
PYRD_HELPG      ------------------LYPLVKKYLFSLDAEDAHEKVCKILRTLSKSSFLCSLIHSQYKNPKLILGLN
PYRD_SYNY3      -----------------SLYPLILSVTKS-DPERGHQRLIQTLKKVDTMHRNGAVAMEQLEDPRTCWGLN
PYRD_MYCLE      ----------------------------------------------------------------TVFGVR
PYRD_HELPH      ------------------LYSLVKKYLFSLDAEDAHEKVCKILMLSSSPFLCNLIDSQWGKNPKLILGLH
PYRD_HALMA      -------------------YDIAKPFLFSLPAETANKSVHRLLETVDGTRVADVMADTVADERLAVFGHT
PYRD_SULDN      -------------------YQSIKPWLFKLEPEDAHMLAEAALRIPNVCQVAHFITNSILK--QELFGRT
PYRD_LEIXX      --------------------------LSRFDPERAHRLAFAAIRALPVIGLGSLLRRFTAPDPSLALGLR
PYRD_THEFY      -----------------------------------------------------------------VFGRE
PYRD_HELAH      ------------------LYSLFKKYLFRLDAEEVHEKVCKILKILSRSPIHAQFGYTNPKLENEILGLH
PYRD_CANGA      -----------------------------------------------------------------VFGTT
PYRD_SACKL      ------------------LCPILR--LATPDAENGHRAGIFCL----KWGLAPKLLFDEDDEVLNVFGTK
PYRD_MYCA9      -----------------------------------------------------------------VFGVH
PYRD_HELPJ      ------------------LYSLVKKYLFSLDAEIAHE-KVCQILRTLSSSPFLCRGYKNPKLENEILGLN
PYRD_SULNB      -------------------YDTVKKILFNFDPETAH--TLAGILRALPCCLHFITKQYFVTDPQEFFGRT
PYRD_RHOOB      ------------------MYHLLLRVMFRLPPERIHHLAFAAMRLVTRFSLRQLVGRVVVDDPNTVFGLD
PYRD_METI4      ----------------------LRPILFSLEPEYAHNLCLGLLSHPFYPFFHKLLASFQKDLPKELWGMQ
PYRD_MYCPA      ----------------------------------------------------------------TVFGVR
PYRD_HELPS      ------------------------------DAEDAHEKVCKILMLSSSPFLCGLIDSQWGKNPKLILGLH
PYRD_PLAF7      ----------------------------------------------------------------------
PYRD_MYCGI      ------------------MYGALRKALFLVPPERIHGLVFAGLRAATTPXXXXXXXXXAPHDPSTVFGVR
PYRD_RHOE4      ------------------MYQLLLSLMFRVPPERIHHIAFTAMKLVTRFALRWLVAKVVVDDPSQAFGLT
PYRD_MYCBT      ------------------MYPLVRRLLFLIPPEHAHKLVFAVLRGVAAVALRRLLGPTDPVLASTVFGVR
PYRD_MYCBP      ------------------MYPLVRRLLFLIPPEHAHKLVFAVLRGVAAVALRRLLGPTDPVLASTVFGVR
PYRD2_KLULA     ------------------LCPMLR--LVTPDAEDGHKLGIWFL----KNGLAPRLWFDNDDKVLNVFGKK
PYRD_MYCTU      ------------------MYPLVRRLLFLIPPEHAHKFXXXXXXXXXXXXXXXXXXXXXXTDPSTVFGVR
PYRD_MYCTA      ------------------MYPLVRRLLFLIPPEHAHKFXXXXXXXXXXXXXXXXXXXXXXTDPSTVFGVR
PYRD_MYCBO      ------------------MYPLVRRLLFLIPPEHAHKFXXXXXXXXXXXXXXXXXXXXXXTDPSTVFGVR
PYRD_KINRD      -----------------------RHLLTRVDPEVAHRWAFAGMRAASRVPVAPHVLRRVEPDPRLVLGID
PYRD_NAUPA      -----------------SFFNMVKPLIYKTDPELAHDLVDLAMRTARRCPLFPLVKANFVDDVQKIWDLE
PYRD2_KLUMA     -----------------------------------------------------------------VFGKT
PYRD_HELPY      ------------------LYSLVKKYLFSLDAEDAHEKVCKILMLSSSPFLCNLIDSQWGQNPKLILGLH
PYRD_SCHPO      ----------------------------------------------------------VADDPSLVWGKK
PYRD_CANAL      ------------------LCPLIRTFT---DAESGHKLGIFFM----KYGLSPRLLDDGKNDQSDVLGVK
PYRD_HELP2      ------------------------------DAEDAHEKVCKILMLSSSPFLCNLIDSQWGKNPKLILGLH
PYRD_METJA      -----------------------------------------------------------------ICGIE
PYRD_AQUAE      -----------------------------------------------------------------LFGIR
PYRD_PYRHO      -----------------------------------------------------------------LFGIR
PYRD_PYRAB      -----------------------------------------------------------------LFGIK
PYRD_SULSY      ----------------------------------------------------------------TLFGLE
PYRD_GEOSF      -----------------------------------------------------------------ISGIK
PYRD_GEOSM      -----------------------------------------------------------------VAGIK
PYRD_GEOSL      -----------------------------------------------------------------IAGIT
PYRD_GEOMG      -----------------------------------------------------------------IAGIK
PYRD_BRAHW      ----------------------------------------------------------------------
PYRD_GEOUR      -----------------------------------------------------------------VAGIK
PYRD_GEOBB      -----------------------------------------------------------------VAGIK
PYRD_DESRM      ----------------------------------------------------------------------
PYRD_BACSU      -------------------------------------------------------------------GLD
PYRD_PYRKO      -------------------------------------------------------------------GLE
PYRD_UNCMA      -------------------------------------------------------------------GLT
PYRD_PORGI      -------------------------------------------------------------------GLT
PYRD_DESAP      -----------------------------------------------------------------IAGLT
PYRDB_ENTFA     ----------------------------------------------------------------SIPGLT
PYRD_PELPD      -------------------------------------------------------------------GLE
PYRD_LACDA      ----------------------------------------------------------------------
PYRD_HELMI      -------------------------------------------------------------------GLT
PYRD_ANOFW      -------------------------------------------------------------------GLS
PYRD_THETN      --------------------------------------------------------------------IK
PYRD_PEDPA      ----------------------------------------------------------------TIAGVK
PYRD_LACAC      ----------------------------------------------------------------TLPGLD
PYRD_LACPL      -------------------------------------------------------------------GVT
PYRD_LACH4      ----------------------------------------------------------------------
PYRD_LACDB      ----------------------------------------------------------------------
PYRD_BACHD      -------------------------------------------------------------------GLS
PYRD_FUSNN      -----------------------------------------------------------------IPGLD
PYRD_THEAC      ----------------------------------------------------------MADLSTSVAGIR
PYRD_SOLUE      ----------------------------------------------------------------TICGIA
PYRD_BACV8      ----------------------------------------------------------MADLSVNIGDLK
PYRD_BACA2      -------------------------------------------------------------------GLQ
PYRD_SYNWW      -------------------------------------------------------------------GIK
PYRD_GEOKA      -------------------------------------------------------------------GLS
PYRD_BACTN      ----------------------------------------------------------MADLSVNIGELQ
PYRD_THEVO      ----------------------------------------------------------MSDISTTLAGIK
PYRD_LACSS      -------------------------------------------------------------------GLE
PYRD_BACP2      -------------------------------------------------------------------GLS
PYRD_MYCPE      -------------------------------------------------------------------GFE
PYRD_LACJO      ----------------------------------------------------------------------
PYRD_GEOTN      -------------------------------------------------------------------GLS
PYRD_CLOPH      ----------------------------------------------------------------TIAGVT
PYRD_LISMF      -----------------------------------------------------------------IPGLS
PYRD_LISMC      -----------------------------------------------------------------IPGLS
PYRD_BACCL      -------------------------------------------------------------------GLS
PYRD_AZOPC      --------------------------------------------------------------------LK
PYRD_THEP1      ----------------------------------------------------------------------
PYRD_THEMA      ----------------------------------------------------------------------
PYRD_PARD8      ----------------------------------------------------------------------
PYRD_BACCR      -------------------------------------------------------------------GLS
PYRD_BACC2      -------------------------------------------------------------------GLS
PYRD_LISW6      -----------------------------------------------------------------IPGLS
PYRD_LISMO      -----------------------------------------------------------------IPGLS
PYRD_LISIN      -----------------------------------------------------------------IPGLS
PYRD_BACC4      -------------------------------------------------------------------GLS
PYRD_PROAC      -------------------------------------------------------------------GLN
PYRD_LISMH      -----------------------------------------------------------------IPGLS
PYRD_GEOLS      --------------------------------------------------------------------LK
PYRD_BACAH      -------------------------------------------------------------------GLS
PYRD_BACSK      -------------------------------------------------------------------GLE
PYRD_BACCN      -------------------------------------------------------------------GLS
PYRD_BACWK      -------------------------------------------------------------------GLS
PYRD_BACHK      -------------------------------------------------------------------GLS
PYRD_BACCZ      -------------------------------------------------------------------GLS
PYRD_BACCQ      -------------------------------------------------------------------GLS
PYRD_BACC7      -------------------------------------------------------------------GLS
PYRD_BACC3      -------------------------------------------------------------------GLS
PYRD_BACC1      -------------------------------------------------------------------GLS
PYRD_BACC0      -------------------------------------------------------------------GLS
PYRD_BACAN      -------------------------------------------------------------------GLS
PYRD_BACAC      -------------------------------------------------------------------GLS
PYRD_BACAA      -------------------------------------------------------------------GLS
PYRD_BACFR      ----------------------------------------------------------MADLSVNIGKLQ
PYRD_BACFN      ----------------------------------------------------------MADLSVNIGKLQ
PYRD_DESMR      -------------------------------------------------------------------GMP
PYRD_STACT      -------------------------------------------------------------------GLD
PYRD_GEOSW      -------------------------------------------------------------------GLS
PYRD_EXIS2      -------------------------------------------------------------------GLN
PYRD_NATTJ      ----------------------------------------------------------MADLKVNFAGIP
PYRD_CALS8      -----------------------------------------------------------------IAGVK
PYRD_ANATD      -----------------------------------------------------------------IAGIK
PYRD_METMA      ----------------------------------------------------------------TLTGLK
PYRD_ALKMQ      -----------------------------------------------------------------IAGVE
PYRD_STRU0      -----------------------------------------------------------------IAGFN
PYRD_PETMO      ------------------------------------------------------------DTKVNIAGVE
PYRD_LACRJ      -------------------------------------------------------------------GLS
PYRD_LACRD      -------------------------------------------------------------------GLS
PYRDB_LACLA     ----------------------------------------------------------------------
PYRD_SULAC      -----------------------------------------------------------------VAGVN
PYRD_STRA5      ----------------------------------------------------------------------
PYRD_STRA3      ----------------------------------------------------------------------
PYRD_STRA1      ----------------------------------------------------------------------
PYRD_THEPX      -----------------------------------------------------------------VGGLK
PYRD_SACCA      ----------------------------------------------------------------------
PYRD_OCEIH      -------------------------------------------------------------------GLN
PYRD_PYRFU      -----------------------------------------------------------------LFGIT
PYRD_AERPE      ----------------------------------------------------------------SIAGLR
PYRD_SACPA      ----------------------------------------------------------------------
PYRD_METAC      -------------------------------------------------------------------GLE
PYRD_SACMI      ----------------------------------------------------------------------
PYRD_THEP3      -----------------------------------------------------------------VGGLK
PYRD_STRS7      ----------------------------------------------------------------------
PYRD_CLOD6      --------------------------------------------------------------------VE
PYRD_YEAST      ----------------------------------------------------------------------
PYRD_STRE4      ----------------------------------------------------------------------
PYRD_ALKOO      -----------------------------------------------------------------IAGIQ
PYRDB_LACLM     ----------------------------------------------------------------------
PYRD_STRP1      ----------------------------------------------------------------------
DPYD_DANRE      ----------------------------------------NTISATPRLPLFHCSIDTV-DISVEMCGIK
PYRD_METTH      ----------------------------------------------------------------SICNIE
PYRD_DESAD      -------------------------------------------------------------------GLK
DPYD_MOUSE      ----------------------------------------------------------------------
PYRD_STRPG      ----------------------------------------------------------------------
PYRD_ARCFU      -------------------------------------------------------------------GLR
PYRD_STRP8      ----------------------------------------------------------------------
PYRD_CARHZ      ----------------------------------------------------------------------
DPYD_CAEBR      ----------------------------------------------------------------------
DPYD_RAT        ----------------------------------------------------------------------
YEIA_ECOLI      ----------------------------------------------------------------------
DPYD_CAEEL      ----------------------------------------------------------------------
PYRD_STRR6      ----------------------------------------------------------------------
PYRD_STRPN      ----------------------------------------------------------------------
DPYD_PIG        ----------------------------------------------------------------------
DPYD_HUMAN      ----------------------------------------------------------------------
DPYD_BOVIN      ----------------------------------------------------------------------
DPYD_DICDI      ----------------------------------------------------------------------
DPYD_PONAB      ----------------------------------------------------------------------
DEOC_STACT      ----------------------------------------------------------------------
DEOC_THEGJ      ----------------------------------------------------------------------
MED14_COCIM     ----------------------------------------------------------------------
GGGPS_METTP     ----------------------------------------------------------------------
DEOC_ENTFA      ----------------------------------------------------------------------
PYRDA_ENTFA     ----------------------------------------------------------------------
PYRD1_KLULA     ----------------------------------------------------------------------
DEOC_STRZJ      ----------------------------------------------------------------------
DEOC_STRPJ      ----------------------------------------------------------------------
DEOC_STRP4      ----------------------------------------------------------------------
DEOC_PYRKO      ----------------------------------------------------------------------
DEOC_THETN      ----------------------------------------------------------------------
DEOC_STRZT      ----------------------------------------------------------------------
DEOC_GEOKA      ----------------------------------------------------------------------
DEOC_CALS8      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAF
PYRD_RALME      FPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAF
PYRD_RALEJ      FPNPVGLAAGLDKDGAYIDGLASFGFGFIEVGTVTPRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAF
PYRD_RALEH      FPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAF
PYRD_CUPTR      FPNPVGLAAGLDKDGAYIDGLAALGFGFIEVGTVTPRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAF
PYRD_RALSO      FPNPVGLAAGLDKDGAYIDALGALGFGFIEVGTVTPRAQPGNPRPRMFRLPAASALINRMGFNNGGVDAF
PYRD_HERAR      FPNPVGLAAGLDKDGAYIDGLATLGFGFIEVGTVTPHAQPGNPLPRMFRLPQANAIINRMGFNNGGVDAF
PYRD_JANMA      FPNPVGLAAGLDKDGAYIDGLATLGFGSIEVGTVTPRAQPGNPMPRMFRLPKANAIINRMGFNNGGADAF
PYRD_BURXL      FRNPVGLAAGLDKDGACIDGLAALGFGFIEVGTVTPRAQPGNPRPRMFRLPQANAVINRMGFNNAGVDQF
PYRD_BURTA      FRNPVXXXXXXXXXXXXXXXFAALGFGFIEVGTVTPRAQPGNPRPRMFRLPEAGAIINRMGFNNSGVDQF
PYRD_BORPA      LRNPVGLAAGLDKNGAHIDALGNLGFGFVEVGTVTPRAQPGNPKPRMFRLPRANALINRLGFNNQGLDAF
PYRD_BORBR      LRNPVGLAAGLDKNGAHIDALGNLGFGFVEVGTVTPRAQPGNPKPRMFRLPRANALINRLGFNNQGLDAF
PYRD_AZOSB      FPNRIGLAAGLDKNGEAIDGLARLGFGFIEIGTITPRPQPGNPRPRLFRLPEVRGIINRMGFNNHGVDTL
PYRD_BORPE      LRNPVGLAAGLDKNGAHIDALGNLGFGFVEVGTVTPRAQPGNPKPRMFRLPRANALINRLGFNNQGLDAF
PYRD_BURPS      FRNPVXXXXXXXXXXXXXXXFAALGFGFIEVGTVTPRAQPGNPRPRMFRLPEADAIINRMGFNNSGVDQF
PYRD_BURP1      FRNPVXXXXXXXXXXXXXXXFAALGFGFIEVGTVTPRAQPGNPRPRMFRLPEADAIINRMGFNNSGVDQF
PYRD_BURP0      FRNPVXXXXXXXXXXXXXXXFAALGFGFIEVGTVTPRAQPGNPRPRMFRLPEADAIINRMGFNNSGVDQF
PYRD_BURMS      FRNPVXXXXXXXXXXXXXXXFAALGFGFIEVGTVTPRAQPGNPRPRMFRLPEADAIINRMGFNNSGVDQF
PYRD_BURMA      FRNPVXXXXXXXXXXXXXXXFAALGFGFIEVGTVTPRAQPGNPRPRMFRLPEADAIINRMGFNNSGVDQF
PYRD_BURM9      FRNPVXXXXXXXXXXXXXXXFAALGFGFIEVGTVTPRAQPGNPRPRMFRLPEADAIINRMGFNNSGVDQF
PYRD_BURM7      FRNPVXXXXXXXXXXXXXXXFAALGFGFIEVGTVTPRAQPGNPRPRMFRLPEADAIINRMGFNNSGVDQF
PYRD_BURP6      FRNPVXXXXXXXXXXXXXXXFAALGFGFIEVGTVTPRAQPGNPRPRLFRLPEADAIINRMGFNNSGVDQF
PYRD_BORA1      LRNPVGLAAGLDKNGAFIDALGNLGFGFVEVGTVTPRAQSGNPKPRMFRLPKANALINRLGFNNQGLDAF
PYRD_METFK      FPNPVGLAAGLDKNGAYIDALAGLGFGFIEIGTITPRPQPGNPKPRMFRLPEAQGVINRFGFNNLGVDVL
PYRD_BURP8      FRNPVGLAAGLDKDGACIDGLAALGFGFIEVGTVTPRAQPGNPRPRMFRLPQADAVINRMGFNNAGVDQF
PYRD_BORPD      LDNPVGLAAGLDKNGAYIDALGNLGFGFVEVGTVTPRAQPGNPKPRMFRLPRAQALINRLGFNNQGLDAF
PYRD_THIDA      FPNAVGLAAGLDKDXXXXXXXXXXXXXXXEIGTVTPRPQPGNPKPRLFRLPAAEGIINRMGFNNLGVDNL
PYRD_POLSJ      FANRVGLAAGLDKNARCIDGLAAMGFGFVEVGTVTPKGQPGNPKPRMFRLPEANALINRLGFNNDGLDAF
PYRD_ACIAD      FPNPVGLAAGLDKNGAYIDALAGLGFGFIEIGTITPRPQSGNPKPRLFRIPEAKAIINRMGFNNEGVDQL
PYRD_AZOSE      FPNRIGLAAGLDKNGEAIDGLARLGFGFLEIGTITPRPQPGNPRPRMFRLPEVRAIINRMGFNNHGVDAL
PYRD_BURCM      FRNPVXXXXXXXXXXXXXXXXXSLGFGFIEVGTVTPRPQPGNPRPRMFRLPQADALINRMGFNNHGVDQF
PYRD_POLNS      FSNPVGLAAGLDKDGKYIDALAALGFGFLEIGTVTPRPQPGNPKPRMFRLPEAQAIINRMGFNNDGVEAC
PYRD_DELAS      FPNRVGMAAGLDKNARCIDALAAMGFGFVEVGTVTPRPQPGNPKPRMFRIPERNALINRLGFNNEGLDAF
PYRD_CHRVO      FPNPVGLAAGLDKNGAHIDALAALGFGFIEIGTVTPRPQDGNPKPRLFRLPEHEAIINRMGFNNHGVAAL
PYRD_METPP      FPNRIGLAAGLDKNGRCIDGFGAMGFGFIEVGTVTPKGQPGNPKPRIFRLPQAEALINRLGFNNDGLDAF
PYRD_NEIM0      LPNPVGLAAGLDKNGEYIDALGALGFGFIEIGTVTPNPQPGNPQPRLFRVPEYQGIINRMGFNNHGIDAM
PYRD_BURM1      FRNPVXXXXXXXXXXXXXXXXXXXXXXFIEVGTVTPRAQPGNPRPRMFRLPQAEALINRMGFNNHGVDQF
PYRD_NEIMF      LPNPVGLAAGLDKNGEYIDALGALGFGFIEIGTVTPNPQPGNPQPRLFRVPEYQGIINRMGFNNHGIDAM
PYRD_DIAST      FPNRVGLAAGLDKNARCIDALAAMGFGFVEVGTVTPRAQPGNPKPRMFRLPEARALINRLGFNNEGLDAF
PYRD_NEIMB      LPNPVGLAAGLDKNGEYIDALGALGFGFIEIGTVTPNPQPGNPQPRLFRVPEHQGIINRMGFNNHGIDTM
PYRD_NEIMA      LPNPVGLAAGLDKNGEYIDALGALGFGFIEIGTVTPKPQPGNPQPRLFRVPEHQGIINRMGFNNHGIDTM
PYRD_ACIBY      FPNPVGLAAGLDKNGAHIDALAGLGFGFIEIGTITPRPQSGNPKPRLFRIPEAKAIINRMGFNNDGVDKL
PYRD_ACIBT      FPNPVGLAAGLDKNGAHIDALAGLGFGFIEIGTITPRPQSGNPKPRLFRIPEAKAIINRMGFNNDGVDKL
PYRD_ACIBC      FPNPVGLAAGLDKNGAHIDALAGLGFGFIEIGTITPRPQSGNPKPRLFRIPEAKAIINRMGFNNDGVDKL
PYRD_ACIB5      FPNPVGLAAGLDKNGAHIDALAGLGFGFIEIGTITPRPQSGNPKPRLFRIPEAKAIINRMGFNNDGVDKL
PYRD_ACIB3      FPNPVGLAAGLDKNGAHIDALAGLGFGFIEIGTITPRPQSGNPKPRLFRIPEAKAIINRMGFNNDGVDKL
PYRD_NITMU      FPNPVGLAAGLDKNGEHIDALAALGFGFIEIGTVTPRPQPGNPKPRLFRLPQANSIINRMGFNNNGIEGL
PYRD_POLSQ      FPNPVGLAAGLDKDGKHIDSLAALGFGFLEIGTVTPRPQAGNPKPRMFRLPQAEAIINRMGFNNDGVEAC
PYRD_ACISJ      FPNRVGLAAGLDKNARCIDALAAMGFGFVEVGTVTPRAQPGNPKPRMFRLPEARALINRLGFNNEGLDAF
PYRD_LEPCP      FPNRIGLAAGLDKNGRCIDGLGAMGFGFIEVGTVTPLGQPGNPKPRMFRLPEKNALINRLGFNNEGLASF
PYRD_ACIAC      FPNRVGMAAGLDKNARCIDALGAMGFGFVEVGTVTPRAQPGNPKPRMFRLPEANALINRLGFNNEGLDAF
PYRD_POLNA      FSNRVGLAAGLDKNARCIDGLAAMGFGFVEVGTVTPKAQPGNPKPRMFRLPEANALINRLGFNNDGLDAF
PYRD_BURS3      FRNPVXXXXXXXXXXXXXXXXXXXXXXFIEVGTVTPRAQPGNPRPRMFRLPQAEALINRMGFNNHGVDQF
PYRD_NITEU      FPNPVGLAAGLDKNGTCISALASLGFGFIEVGTITPRPQVGNPRPRLFRIPQAEAIINRMGFNNVGVDKL
PYRD_PSYWF      FSNPVGLAAGLDKNGQYIDALAELGFGFIEVGTVTPRPQQGNEKPRLFRIKEADAIINRMGFNNLGVDRL
PYRD_PSYCK      FSNPVGLAAGLDKNGDYIDALAELGFGFIEVGTVTPKPQAGNDRPRLFRLKQADAIINRMGFNNEGVDYL
PYRD_BURCJ      FRNPVXXXXXXXXXXXXXXXXXXXXXXFIEVGTVTPRPQPGNPRPRMFRLPQAEALINRMGFNNHGVDQF
PYRD_BURCH      FRNPVXXXXXXXXXXXXXXXXXXXXXXFIEVGTVTPRPQPGNPRPRMFRLPQAEALINRMGFNNHGVDQF
PYRD_BURCA      FRNPVXXXXXXXXXXXXXXXXXXXXXXFIEVGTVTPRPQPGNPRPRMFRLPQAEALINRMGFNNHGVDQF
PYRD_PSYA2      FSNPVGLAAGLDKNGDYIDALAELGFGFIEVGTVTPKPQVGNDRPRLFRLKQADAIINRMGFNNEGVDYL
PYRD_PROMH      FKNPLGLAAGLDKNGDCIDALGAMGFGFIEVGTVTPRAQVGNDKPRLFRLVEAEGLINRMGFNNLGVDNL
PYRD_PHOPR      FKNPVGLAAGLDKNGECIDAFGAMGFGFVEVGTVTPRPQSGNEKPRLFRVLPAEGLINRFGFNNLGVDNL
PYRD_ERWT9      FKNPLGLAAGLDKNGECIDAFGAMGFGFIEIGTVTPRPQPGNDKPRMFRVVEAEGIINRMGFNNLGVDNL
PYRD_PSEFS      FPNPVGLAAGLDKNGAAIDGFAQLGFGFVEIGTVTPRPQPGNPKPRIFRLPEAEAIINRMGFNNLGVDHL
PYRD_VIBPA      FRNPVGLAAGLDKNGECIEAFDAMGFGFVEVGTVTPRPQPGNDKPRLFRLVEAEGIINRMGFNNLGVDHL
PYRD_PSEU2      FPNPVGLAAGLDKNGAAIDGFAQLGFGFVEIGTVTPRAQPGNPKPRIFRLPNAEAIINRMGFNNLGVDNL
PYRD_ERWCT      FKNPLGLAAGLDKDGECIDALGAMGFGFIEVGTVTPRPQSGNDKPRLFRVVEAEGLINRMGFNNKGVDYL
PYRD_PSE14      FPNPVGLAAGLDKNGAAIDGFAQLGFGFVEIGTVTPRPQPGNPKPRIFRLPHAEAIINRMGFNNLGVDNL
PYRD_VIBSL      FKNPVGLAAGLDKNGECIDAFGAMGFGFVEVGTVTPRPQAGNDKPRLFRLVEAEGIINRMGFNNLGVDNL
PYRD_SHEB9      FPNPVGLAAGMDKDGESIDAFHAMGFGHVEVGTVTPRPQPGNDLPRLFRLKPAKGIINRMGFNNKGVDNL
PYRD_SHEB8      FPNPVGLAAGMDKDGESIDAFHAMGFGHVEVGTVTPRPQPGNDLPRLFRLKPAKGIINRMGFNNKGVDNL
PYRD_VIBHB      FRNPVGLAAGLDKNGECIEAFDAMGFGFVEVGTVTPRPQPGNDKPRLFRLVEAEGIINRMGFNNLGVDHL
PYRD_SHESW      FPNPVGLAAGMDKDGESIDAFHAMGFGHIEVGTVTPRPQPGNDLPRLFRLKPAKGIINRMGFNNKGVDNL
PYRD_SHEPC      FPNPVGLAAGMDKDGESIDAFHAMGFGHIEVGTVTPRPQPGNDLPRLFRLKPAKGIINRMGFNNKGVDNL
PYRD_PSEPW      FANPVGLAAGLDKNGAAIDGFAQLGFGFVEIGTVTPRAQPGNPKPRLFRLPEATAIINRMGFNNLGVDHL
PYRD_PECCP      FKNPLGLAAGLDKDGECIDALGAMGFGFIEVGTVTPRPQSGNDKPRLFRVVEAEGLINRMGFNNKGVDSL
PYRD_SHEB2      FPNPVGLAAGMDKDGESIDAFHAMGFGHVEVGTVTPRPQPGNDLPRLFRLKPAKGIINRMGFNNKGVDNL
PYRD_VEREI      FPNRVGLAAGLDKNARCIDALGAMGFGFVEAGTVTPQAQPGNPRPRMFRLPEARALINRLGFNNAGLQAF
PYRD_SHEWM      FPNPVGLAAGMDKDGECIDGFHAMGFGHIEVGTVTPRPQPGNDLPRLFRLKPAKGIINRMGFNNKGVDNL
PYRD_SHESR      FPNPVGLAAGMDKDGESIDAFHAMGFGHVEVGTVTPRPQPGNDLPRLFRLKPAKAIINRMGFNNKGVDNL
PYRD_SHESM      FPNPVGLAAGMDKDGESIDAFHAMGFGHVEVGTVTPRPQPGNDLPRLFRLKPAKAIINRMGFNNKGVDNL
PYRD_SHEB5      FPNPVGLAAGMDKDGESIDAFHAMGFGHVEVGTVTPRPQPGNDLPRLFRLKPAKGIINRMGFNNKGVDNL
PYRD_PSEPK      FANPVGLAAGLDKNGAAIDGFAQLGFGFVEIGTVTPRPQPGNPKPRLFRLPEATAIINRMGFNNLGVDHL
PYRD_SHESA      FPNPVGLAAGMDKDGESIDAFHAMGFGHVEVGTVTPRPQPGNDLPRLFRLKPAKAIINRMGFNNKGVDNL
PYRD_CELJU      FPNPVGLAAGLDKNGDYFNALGALGFGFVEIGTITPRPQPGNAQPRLFRIPEAKAIINRMGFNNKGVDHL
PYRD_MARAV      FPNPVGLAAGLDKNADHIDALGALGFGFIEVGTVTPLAQPGNPKPRMFRLPEHQAIINRMGFNNEGLEHL
PYRD_SHEDO      FPNPVGLAAGLDKDGEAIDAFHAMGFGFVEVGTVTPKPQAGNDKPRLFRLTKAKAIINRMGFNNKGVDNL
PYRD_PSEMY      FANPVGLAAGLDKNGDAIDGFAQLGFGFVEIGTVTPRPQPGNPKPRLFRLPQAEAVINRMGFNNLGVDHL
PYRD_NEIG1      LPNPVGLAAGLDKNGEYIDALGALGFGFLEIGTVTRNPQPGNPQPRLFRVPEHQGIINRMGFNNHGIDAM
PYRD_AERHH      FANPVGLAAGLDKDGECIDAFGAMGFGFIEVGTVTPRPQSGNDKPRLFRVIPAEGIINRMGFNNKGVDHL
PYRD_PSESM      FPNPVGLAAGLDKNGAAIDGFAQLGFGFVEIGTVTPRPQPGNPKPRIFRLPNAEAIINRMGFNNLGVDNL
PYRD_PSEPF      FPNPVGLAAGLDKNGAAIDGFAQLGFGFVEIGTVTPRPQPGNPKPRIFRLPEAEAIINRMGFNNLGVDNL
PYRD_AERS4      FANPVGLAAGLDKDGECIDAFGAMGFGFIEVGTVTPKPQSGNDKPRLFRVIPAEGIINRMGFNNKGVDHL
PYRD_PSEPG      FANPVGLAAGLDKNGAAIDGFAQLGFGFVEIGTVTPRPQPGNPKPRLFRLPEATAIINRMGFNNLGVDHL
PYRD_ENTS8      FKNPLGLAAGLDKNGECIDALGALGFGSVEIGTVTPRPQPGNDKPRLFRLVEAEGLINRMGFNNLGVDNL
PYRD_ACTP2      FKNPIGLAAGADKNGEAIDGFGKLGFGFIEVGTVTPVAQDGNPKPRQFRILEAEGIINRNGFNNLGVDVL
PYRD_HAEPS      FKNPIGLAAGADKNGEAIDGFAKLGFGFIEVGTVTPVAQDGNPRPRQFRILEAEGIINRNGFNNLGVDVL
PYRD_KLEP7      FKNPLGLAAGLDKNGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRIFRLVDAEGLINRMGFNNHGVDNL
PYRD_KLEP3      FKNPLGLAAGLDKNGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRIFRLVDAEGLINRMGFNNHGVDNL
PYRD_ACTPJ      FKNPIGLAAGADKNGEAIDGFGKLGFGFIEVGTVTPVAQDGNPKPRQFRILEAEGIINRNGFNNLGVDVL
PYRD_ACTP7      FKNPIGLAAGADKNGEAIDGFGKLGFGFIEVGTVTPVAQDGNPKPRQFRILEAEGIINRNGFNNLGVDVL
PYRD_STRM5      FPNPVGLAAGLDKNGEHIDALFALGFGFVEIGTITPRPQAGNPQPRLFRLPAHNAIINRMGFNNAGVDAL
PYRD_PSEU5      FPNPVGLAAGLDKNGEAIRGLSQLGFGFIEVGTVTPRPQPGNPKPRIFRLPEAEAIINRMGFNNHGVDAL
PYRD_METCA      FPNPIGLAAGLDKNGDCIDGLAALGFGFLEIGTVTPRPQPGNPRPRLFRVPEAGALVNRMGFNNSGVAHL
PYRD_ACIBS      FPNPVGLAAGLDKNGAHIDALAGLGFGFIEIGTITPHPQSGNPKPRLFRIPEAKAIINRMGFNNDGVDKL
PYRD_ESCF3      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ENT38      FKNPLGLAAGLDKNGECIDALGAMGFGSIEVGTVTPRPQAGNDKPRLFRLVEAEGLINRMGFNNHGVDHL
PYRD_BAUCH      FKNPLGLAAGLDKNGECIDALGAMGFGFIEVGTVTPHAQIGNEKPRLFRLTKAYGLINRMGFNNKGVDNL
PYRD_COLP3      FPNPVGLAAGLDKNGECINAFDAMGFGFVEVGTVTPRPQPGNDKPRIFRLPEANAVINRMGFNNKGVDYL
PYRD_LEGPL      FPHQVGLAAGLDKNGEHLDALAKLGFSFIELGTVTPKGQTGNPKPRLFRIAEANAIINRMGFNNSGVDVL
PYRD_SODGM      FKNPLGLAAGLDKDGDCIDALGAMGFGFIEVGTVTPRAQPGNEKPRLFRLVKAGGLINRMGFNNHGVDNL
PYRD_VIBF1      FKNPVGLAAGLDKNGECIEAFGAMGFGFVEVGTVTPRPQSGNDKPRLFRLIEAEGIINRMGFNNLGVDNL
PYRD_VIBFM      FKNPVGLAAGLDKNGECIEAFGAMGFGFVEVGTVTPRPQSGNDKPRLFRLIEAEGIINRMGFNNLGVDNL
PYRD_SHESH      FPNPVGLAAGMDKDGECIDGFHAMGFGHIEVGTVTPRPQPGNDLPRLFRLKPAKAIINRMGFNNKGVDNL
PYRD_LEGPH      FPHQVGLAAGLDKNGEHLDALAKLGFSFIELGTVTPKGQAGNPKPRLFRIAEANAIINRMGFNNSGVDVL
PYRD_LEGPC      FPHQVGLAAGLDKNGEHLDALAKLGFSFIELGTVTPKGQAGNPKPRLFRIAEANAIINRMGFNNSGVDVL
PYRD_LEGPA      FPHQVGLAAGLDKNGEHLDALAKLGFSFIELGTVTPKGQAGNPKPRLFRIAEANAIINRMGFNNSGVDVL
PYRD_SALTY      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALSV      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALPK      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALPC      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALPB      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALPA      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALNS      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALHS      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALEP      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALDC      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALA4      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALAR      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALG2      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SALCH      FKNPLGLAAGLDKDGECIDALDAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SHEFN      FPNPVGLAAGLDKDGESIDAFHAMGFGHVEVGTVTPRPQAGNDQPRLFRLKPAKGIINRMGFNNKGVDNL
PYRD_PASMU      FKNPIGLAAGADKNGEAIEGFAAMGFGFIEVGTVTPLAQEGNPKPRQFRLPEAEGIINRNGFNNYGIDYL
PYRD_SALTI      FKNPLGLAAGLDKDGECIDALGAMGFGSLEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_PSEHT      LKNPVGLAAGLDKNAECITAFAQMGFGFVEVGTVTPRPQAGNDKPRMFRLPQSNAIINRMGFNNKGVDNL
PYRD_VIBVU      FRNPVGLAAGLDKNGECIEAFDAMGFGFVEVGTVTPRAQSGNDKPRLFRLVGAEGIINRMGFNNLGVDNL
PYRD_ALISL      FKNPIGLAAGLEKNGECIEAFGAMGFGFIEVGTVTPRPQAGNDKPRLFRLIEAEGIINRMGFNNLGVDNL
PYRD_SHEAM      FPNPVGLAAGLDKDGEAIDAFHAMGFGHVEVGTVTPRPQPGNDLPRLFRLKPAKGIINRMGFNNKGVDNL
PYRD_VIBVY      FRNPVGLAAGLDKNGECIEAFDAMGFGFVEIGTVTPRAQSGNDKPRLFRLVGAEGIINRMGFNNLGVDNL
PYRD_PSEE4      FANPVGLAAGLDKNGAAIDGFAQLGFGFVEIGTVTPRPQPGNPKPRLFRIPEATAIINRMGFNNLGVDNL
PYRD_HAMD5      FKNPLGLAAGLDKNGDCIDVLGAMGFGFIEVGTVTPLPQQGNQKPRLFRVTEAEALINRMGFNNLGVDYL
PYRD_HAEDU      FKNPIGLAAGADKNGEAIDGFAKLGFGFIEVGTVTPLAQDGNNKPRQFRILEAEGIINRNGFNNQGVDVL
PYRD_DECAR      FPNPVGLAAGLDKNGDHIDGLAKLGFGFIEIGTITPRPQDGNPKPRLFRIPEAQGIINRMGFNNAGVDKL
PYRD_NITEC      FPNPVGLAAGLDKNGAYISALARLGFGFIEVGTVTPRPQPGNPRPRLFRVPQAEAITNRMGFNNVGIDKL
PYRD_PHOLL      FKNPLGLAAGLDKDGDCIDAFGAMGFGFIEIGTVTPRAQAGNDKPRLFRIVEAEGLINRMGFNNLGVDNL
PYRD_MANSM      FKNPIGLAAGADKNGDAIDGFGAMGFGFIEVGTVTPLAQDGNAKPRQFRIVEAEGIVNRNGFNNYGVDYL
PYRD_STRMK      FPNPVGLAAGLDKNGEHIDALFALGFGFVEIGTITPRPQAGNPQPRLFRLPEHNAIINRMGFNNAGVDAL
PYRD_EDWI9      FKNPLGLAAGLDKDGECIDALGAMGFGSIEVGTVTPRPQPGNEKPRLFRIVEAEGLINRMGFNNLGVDNL
PYRD_CITK8      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_IDILO      FPNPVGLAAGLDKNAECIDAFSQMGFGFIEVGTVTPVAQPGNDKPRLFRLTEDEAIINRMGFNNDGVDEL
PYRD_COXBU      FPNPVGLAAGLDKNGEYMDELLGLGFGFIEVGAVTPKPQPGNSKPRIFRLPQARALINRMGFNNLGVDYL
PYRD_COXBR      FPNPVGLAAGLDKNGEYMDELLGLGFGFIEVGAVTPKPQPGNSKPRIFRLPQARALINRMGFNNLGVDYL
PYRD_COXBN      FPNPVGLAAGLDKNGEYMDELLGLGFGFIEVGAVTPKPQPGNSKPRIFRLPQARALINRMGFNNLGVDYL
PYRD_COXB2      FPNPVGLAAGLDKNGEYMDELLGLGFGFIEVGAVTPKPQPGNSKPRIFRLPQARALINRMGFNNLGVDYL
PYRD_COXB1      FPNPVGLAAGLDKNGEYMDELLGLGFGFIEVGAVTPKPQPGNSKPRIFRLPQARALINRMGFNNLGVDYL
PYRD_SHEON      FPNPVGLAAGMDKDGESIDAFHAMGFGHVEVGTVTPRPQPGNDLPRLFRLKPAKAIINRMGFNNKGVDNL
PYRD_RHOFD      FPNRVGLAAGLDKNARCIDGLGAMGFGFVEVGTVTPLAQPGNPRPRLFRLPQAQALINRFGFNNEGLASF
PYRD_YERE8      FKNPLGLAAGLDKDGECIDALGAMGFGFIEVGTVTPKPQSGNDKPRLFRIVEAEGLINRMGFNNHGVDNL
PYRD_SHIDS      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNFGVDNL
PYRD_SERP5      FKNPLGLAAGLDKDGECIDAFGAMGFGFVEVGTVTPRPQSGNDKPRLFRIVEAEGLINRMGFNNQGVDNL
PYRD_ECOSM      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECOLU      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECO7I      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SHIFL      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SHIF8      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_PSEA6      FKNPVGLAAGLDKNAECIDAFAAMGFGFIEVGTVTPKAQAGNDKPRMFRLPAGQAIINRMGFNNKGVDYL
PYRD_ECOUT      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECOL6      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECOL5      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECOK1      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECO81      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECO45      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECO27      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_YERPY      FKNPVGLAAGLDKDGECIDALGAMGFGFIEVGTVTPRPQVGNDKPRLFRIVEAEGLINRMGFNNHGVDNL
PYRD_YERPS      FKNPVGLAAGLDKDGECIDALGAMGFGFIEVGTVTPRPQVGNDKPRLFRIVEAEGLINRMGFNNHGVDNL
PYRD_YERPP      FKNPVGLAAGLDKDGECIDALGAMGFGFIEVGTVTPRPQVGNDKPRLFRIVEAEGLINRMGFNNHGVDNL
PYRD_YERPN      FKNPVGLAAGLDKDGECIDALGAMGFGFIEVGTVTPRPQVGNDKPRLFRIVEAEGLINRMGFNNHGVDNL
PYRD_YERPG      FKNPVGLAAGLDKDGECIDALGAMGFGFIEVGTVTPRPQVGNDKPRLFRIVEAEGLINRMGFNNHGVDNL
PYRD_YERPE      FKNPVGLAAGLDKDGECIDALGAMGFGFIEVGTVTPRPQVGNDKPRLFRIVEAEGLINRMGFNNHGVDNL
PYRD_YERPB      FKNPVGLAAGLDKDGECIDALGAMGFGFIEVGTVTPRPQVGNDKPRLFRIVEAEGLINRMGFNNHGVDNL
PYRD_YERPA      FKNPVGLAAGLDKDGECIDALGAMGFGFIEVGTVTPRPQVGNDKPRLFRIVEAEGLINRMGFNNHGVDNL
PYRD_YERP3      FKNPVGLAAGLDKDGECIDALGAMGFGFIEVGTVTPRPQVGNDKPRLFRIVEAEGLINRMGFNNHGVDNL
PYRD_XANAC      FPNPVGLGAGLDKNGEHIDALFALGFGFVEIGTVTPRAQEGNPKPRMFRLPEYQAVINRMGFNNLGVDAL
PYRD_SHISS      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SHIBS      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_SHIB3      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECOSE      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECOLI      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECOLC      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECOHS      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECODH      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECOBW      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECO8A      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECO5E      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECO57      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECO55      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_ECO24      FKNPLGLAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLGVDNL
PYRD_XANC5      FPNPVGLGAGLDKNGEHIDALFALGFGFVEIGTVTPRAQEGNPKPRMFRLPEYQAVINRMGFNNLGVDAL
PYRD_SACD2      FPNRVGLAAGLDKNGDFVNALGQLGFGFVEIGTITPLAQSGNPKPRLFRLPEHQAIINRMGFNNKGVDHL
PYRD_MARMS      FPNAVGLAAGLDKNADAFEALGALGFGFVEVGTVTPKGQAGNPKPRLFRLPEHEAIINRMGFNNKGVDHL
PYRD_SHELP      FPNPVGLAAGMDKDGECIDAFHAMGFGHVEVGTVTPRPQPGNDQPRLFRLKPAKAIINRMGFNNKGVDNL
PYRD_SHEPA      FPNPVGLAAGMDKEGECIDAFHAMGFGHIEVGTVTPRPQPGNEQPRCFRLKPAKAIINRMGFNNKGVDNL
PYRD_PSEAE      FPNPVGLAAGLDKNGDAIDGFGQLGFGFIEIGTVTPRPQPGNPRPRLFRLPQANAIINRMGFNNHGVDHL
PYRD_PSEA8      FPNPVGLAAGLDKNGDAIDGFGQLGFGFIEIGTVTPRPQPGNPRPRLFRLPQANAIINRMGFNNHGVDHL
PYRD_PSYIN      FPNSVGLAAGLDKNGECIDAFGAMGFGHIEVGTVTPVAQPGNESPRMFRVLESDGIINRMGFNNEGVENL
PYRD_PSEAB      FPNPVGLAAGLDKNGDAIDGFGQLGFGFIEIGTVTPRPQPGNPKPRLFRLPQANAIINRMGFNNHGVDHL
PYRD_PSEA7      FPNPVGLAAGLDKNGDAIDGFGQLGFGFIEIGTVTPRPQPGNPKPRLFRLPQASAIINRMGFNNHGVDHL
PYRD_HAEIG      FPNPIGLAAGADKNGDAIDGFGALGFGFLEVGTVTPVAQDGNAKPRQFRLIEAEXXXXXXXXXXXXXDYL
PYRD_SHEPW      FPNPVGLAAGMDKDGECIDAFHAMGFGHVEVGTVTPRPQPGNEQPRLFRLKPAKAIINRMGFNNKGVDSL
PYRD_PSEF5      FANPVGLAAGLDKNGAAIDGFAQLGFGFVEIGTVTPRPQPGNPKPRIFRLPQAEAIINRMGFNNLGVDNL
PYRD_HAEI8      FPNPIGLAAGADKNGDAIDGFGTLGFGFLEVGTVTPVAQDGNAKPRQFRLIEAEXXXXXXXXXXXXXDYL
PYRD_HAHCH      FPNAVGLAAGLDKNGDYIDGLSKLGFGFIEVGTVTPKPQDGNPPPRLFRLEERSAIINRMGFNNYGVDYM
PYRD_XYLFT      FPNPVGLAAGLDKNGTHIDALFALGFGFIEIGTTTPRPQAGNPKPRLFRLTQQQAVINRMGFNNLGVDAL
PYRD_XYLF2      FPNPVGLAAGLDKNGTHIDALFALGFGFIEIGTTTPRPQAGNPKPRLFRLTQQQAVINRMGFNNLGVDAL
PYRD_AZOVD      FPNPVGLAAGLDKNGDAIDGLAQLGFGFVEIGTVTPRPQPGNPRPRLFRLPQAEAIVNRMGFNNLGVDHL
PYRD_AKKM8      FPNRVGLAAGMDKEADTVSAFGQAGFGFVEVGTLTPRPQPGNEKPRLFRLIPQKAIINRMGFNNEGIAAG
PYRD_ACTSZ      FKNPIGLAAGADKNGEAIDGFGAMGFGFIEVGTVTPLAQDGNAKPRQFRIVEAEGIINRNGFNNYGIDHL
PYRD_XYLFM      FPNPVGLAAGLDKNGTHIDALFALGFGFIEIGTTTPRPQAGNPKPRLFRLTQQQAVINRMGFNNLGVDAL
PYRD_XANOR      FPNPVGLGAGLDKNGEHIDALLALGFGFVEIGTVTPRAQDGNPKPRMFRLPEYQAVINRMGFNNLGVDAL
PYRD_XANOP      FPNPVGLGAGLDKNGEHIDALLALGFGFVEIGTVTPRAQDGNPKPRMFRLPEYQAVINRMGFNNLGVDAL
PYRD_XANOM      FPNPVGLGAGLDKNGEHIDALLALGFGFVEIGTVTPRAQDGNPKPRMFRLPEYQAVINRMGFNNLGVDAL
PYRD_XYLFA      FPNPVGLAAGLDKNGTHIDALFALGFGFIEIGTTTPRPQPGNPKPRLFRLTQQQAVINRMGFNNLGVDAL
PYRD_XANCP      FPNPVGLGAGLDKNGEHIDALLALGFGFVEIGTVTPKPQEGNPKPRMFRLPEYQAVINRMGFNNLGVDVL
PYRD_XANCB      FPNPVGLGAGLDKNGEHIDALLALGFGFVEIGTVTPKPQEGNPKPRMFRLPEYQAVINRMGFNNLGVDVL
PYRD_XANC8      FPNPVGLGAGLDKNGEHIDALLALGFGFVEIGTVTPKPQEGNPKPRMFRLPEYQAVINRMGFNNLGVDVL
PYRD_TERTT      FPNAVGLAAGLDKNADYFNALGQLGFGSVEVGTVTPLPQPGNPQPRLFRLIEEEGIINRMGFNNKXXXXX
PYRD_SHEHH      FPNPVGLAAGMDKDGECIDAFHAMGFGHIEVGTVTPRPQPGNDKPRCFRLKPAKAIINRMGFNNKGVDNL
PYRD_FLALU      FPNPVGLAAGLDKNGEHIDALFALGFGYVEIGTVTPRPQAGNPQPRLFRVPEHLGVINRMGFNNAGVDAL
PYRD_ALHEH      FANPVGLAAGLDKNGEHLEALGHVGFGFIEVGTVTPRPQPGNPEPRLFRLPAHEAIINRMGFNNQGVDAL
PYRD_HAEIE      FPNPIGLAAGADKNGDAIDXXXXXXXXXXXXXTVTPVAQDGNAKPRQFRLIEAEXXXXXXXXXXXXXDYL
PYRD_HAEIN      FPNPIGLAAGADKNGDAIDXXXXXXXXXXXXXTVTPVAQDGNAKPRQFRLIEAEXXXXXXXXXXXXXDYL
PYRD_VIBCM      FKNPVGLAAGLDKNGECIEAFGAMGFGFVEVGTVTPRPQAGNDKPRLFRLVHAEGIINRMGFNNLGVDHL
PYRD_VIBCH      FKNPVGLAAGLDKNGECIEAFGAMGFGFVEVGTVTPRPQAGNDKPRLFRLVHAEGIINRMGFNNLGVDHL
PYRD_VIBC3      FKNPVGLAAGLDKNGECIEAFGAMGFGFVEVGTVTPRPQAGNDKPRLFRLVHAEGIINRMGFNNLGVDHL
PYRD_HALHL      FPNPVGLAAGFDKDGEYMDVXXXXXXXXXXXXTVTPRAQPGNPQPRVFRIPEHEALINRMGFNNQGAEPL
PYRD_GRAFK      FKNPVGLAAGFDKDAKLYNELSSLGFGFIEVGTVTPKPQPGNDKKRLFRLKEDSAIINRMGFNNEGVEAT
PYRD_DICNV      FPNRLGLAAGLDKNAVAISAFDRLGFGFIEVGTATPRPQSGNPKPRLFRLPEHQAIINCMGFNNDGVVAL
PYRD_FLAJ1      FKNPVGLAAGFDKDAKLYKELSDFGFGFIEIGTVTPVGQEGNPKKRLFRLKEDQAIINRMGFNNGGVLEA
PYRD_OCHA4      FPNPLGMAAGYDKNAEVPDALLKLGFGFTEIGTITPRPQSGNPRPRIFRLVEDRAVINRLGFNNEGHDAA
PYRD_GLOVI      FANPLGLAAGFDKNAEAVGAWEHLGFGFAEVGTVTRHAQPGNPRPRLFRLPADQAAINRMGFNNXXXXXX
PYRD_BRUME      FPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTLTPRPQSGNPRPRIFRLVDDKAVINRLGFNNEGHEAA
PYRD_BRUMB      FPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTLTPRPQSGNPRPRIFRLVDDKAVINRLGFNNEGHEAA
PYRD_BRUSU      FPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTLTPRPQSGNPRPRIFRLVDDKAVINRLGFNNEGHEAA
PYRD_BRUSI      FPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTLTPRPQSGNPRPRIFRLVDDKAVINRLGFNNEGHEAA
PYRD_BRUO2      FPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTLTPRPQSGNPRPRIFRLVDDKAVINRLGFNNEGHEAA
PYRD_BRUC2      FPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTLTPRPQSGNPRPRIFRLVDDKAVINRLGFNNEGHEAA
PYRD_ANADF      FDGPIGLAAGFDKGDASIAGLFALGFSHVEIGTITPRPQAGNEPPRLFRLVEHRALVNRMGFNNAGAEVC
PYRD_AGRT5      FPNPLGMAAGYDKNAEVPGPLLRLGFGFTEIGTVTPRAQSGNPKPRIFRLVEDEGVINRLGFNNEGHAAA
PYRD_BRUAB      FPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTLTPRPQSGNPRPRIFRLVDDKAVINRLGFNNEGHEAA
PYRD_BRUA2      FPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTLTPRPQSGNPRPRIFRLVDDKAVINRLGFNNEGHEAA
PYRD_BRUA1      FPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTLTPRPQSGNPRPRIFRLVDDKAVINRLGFNNEGHEAA
PYRD_BUCAI      FDNKLGTAAGIDKNGEYIDALSKLGFGFIEVGTVTPLPQVGNPKPRMFRIVSMEGIINRMGFNNLGIDNL
PYRD_ROSS1      FANPVGVAAGFDKRADLVDGLALLGFGHIEVGTVTPRPQPGNPRPRLFRLPEDTALINRLGFNSPGM--X
PYRD_FLAPJ      FKNPVGLAAGFDKDAKLYKELSNFGFGFIEIGTLTPKGQEGNPKKRLFRLQEDSAIINRMGFNNGGVLEA
PYRD_AZOC5      FPNPVGLAAGFDKDAEIIDPLLSLGFGFVEAGSVTPRPQPGNPKPRLFRLDEDEGVINRFGFNSQGLAPF
PYRD_MESSB      FPNPIGMAAGYDKNAEIPDALLNLGFGFAECGTVTPKPQEGNPRPRIFRLTRDRAVINRLGFNNEGHAQA
PYRD_AGRVS      FPNPLGMAAGYDKNAEVPDELLGLGFGFAEVGTLTPKPQGGNPKPRIFRLVRDEAVINRLGFNNQGHEXX
PYRD_BART1      FKNFIGLAAGFDKNAEVVDEIFRLGFGFTEIGTVTPKPQIGNPKPRLFRLKEDEAIINRMGFNNDGHQVV
PYRD_CHLSY      FPNPVGLAAGMDKDGVAIPAWAALGFGFVEVGTVTHHPQPGNPRPRLFRLPEQEALINRMGFNNQG--XX
PYRD_CHLAA      FPNPVGLAAGMDKDGVAIPAWAALGFGFVEVGTVTHHPQPGNPRPRLFRLPEQEALINRMGFNNQG--XX
PYRD_RHIEC      FENPLGMAAGYDKNAEVPEALLKLGFGFTEIGTVTPKPQSGNPRPRIFRLVEDEAVINRLGFNNEGHEAA
PYRD_BRASO      FPNPVGMAAGFDKNAEVPDALLRLGFGFVEIGSVTPRPQSGNPRPRLFRLERDEAVINRMGFNNDGAEIV
PYRD_ANADE      FDGPMGLAAGFDKGDVALPGLFGLGFSHVEIGTITPRPQPGNDRPRLFRLPEHRALLNRMGFNNEGMEXX
PYRD_THEEB      FPNPIGLAAGFDKNGVARSVWSAFGFGFAELGTVTWHPQPGNPRPRLFRLGSDRAVINRMGFNNAGAEAM
PYRD_BUCAP      FNNKIGLAAGMDKNGDYIDSLSKIGFGFIEVGTVTPLPQYGNPKPRIFRVPSIEGIINRMGFNNLGIDYL
PYRD_RHILW      FENPLGMAAGYDKNAEVPEALLKLGFGFTEIGTVTPKPQAGNPRPRIFRLVEDEAVINRLGFNNEGHEAA
PYRD_ANAD2      FDGPVGLAAGFDKGDVALPGLFGLGFSHVEIGTITPRPQPGNDRPRLFRLPEHRALLNRMGFNNEGMEXX
PYRD_MYXXD      FAHPVALAAGLDKDAEAVDGLFACGFSAVEIGTLTPRPQPGNPSPRLFRLPEHRALINRMGFNNHGATQA
PYRD_ACIF5      FANPVGLAAGYDKDARATAALPALGFGFIEIGTVTPRPQPGNPRPRVFRYPAQQAVINRMGFPGEG--XX
PYRD_ACIF2      FANPVGLAAGYDKDARATAALPALGFGFIEIGTVTPRPQPGNPRPRVFRYPAQQAVINRMGFPGEG--XX
PYRD_ACAM1      FANPIGLAAGFDKDGVATNIWPRFGFGFAEVGTVTFHAQPGNPQPRLFRLPEDQAALNRMGFNNQGAAAM
PYRD_ANAVT      FPNPVGLAAGFDKDGVAARIWSSLGFGFAELGTVTFVAQPGNPPPRLFRLPLDQAALNRMGFNNHGA---
PYRD_RHIE6      FENPLGMAAGYDKNAEVPEALLRLGFGFTEIGTVTPRPQSGNPRPRIFRLVEDEAVINRLGFNNEGHEAA
PYRD_ANASK      FDGPVGLAAGFDKGDVALPGLFGLGFSHVEIGTITPRPQPGNDRPRLFRLPEHRALLNRMGFNNEGMEXX
PYRD_NOVAD      FPNPVGMAPGFDKNAEVPDAMLGLGFGFVEVGTVTPRPQEGNPKPRLFRLVEDRAVINRMGFNNEGAQAV
PYRD_ANASP      FPNPVGLAAGFDKDGVAARIWSSLGFGFAELGTVTFVGQPGNPPPRLFRLPLDQAALNRMGFNNHGA---
PYRD_PARL1      FENPLGIAAGFDKNGEVPDAMLAMGMGFAEVGTVTPLPQPGNPRPRVFRLPVHRAVINRLGFNNQGHXXX
PYRD_DEIDV      YASPVGLAAGLDKNGVAVPAFSALGFGFVEVGTVTPQPQPGNDRPRLFRLPPDEALINRMGFNNAGAAAL
PYRD_RHIME      FSNPIGMAAGYDKNAEVPEALLKIGFGFTEIGTVTPRPQAGNDKPRLFRLVEDEAVINRLGFNNEGHGAA
PYRD_ROSCS      FASPLGVAAGFDKRADLVDALALLGFSHVEVGTVTPRPQPGNPGPRLFRLPEDMALINRLGFNSHGMVAV
PYRD_RHIL3      FENPLGMAAGYDKNAEVPEALLKLGFGFTEIGTVTPKPQSGNPRPRIFRLVEDEGVINRLGFNNEGHDXX
PYRD_RHOSK      LPNPVGLAAGYDKNAVALAALMRAGFGFLEVGAATPRPQPGNPQPRLFRLTEDRAAINRFGFNNDGAATI
PYRD_NOSP7      FPNPVGLAAGFDKDGVAAGIWSNLGFGFAELGTVTFHAQPGNPRPRLFRLPLDKAALNRMGFNNLGAAAM
PYRD_TRIEI      FKNPVGLAPGYDKDGQAINMWPQLGFGFAELGTVTFHQQPGNAQPRLFRLPKDKAVLNRMGFNNKGAAAL
PYRD_SINMW      FPNPVGMAAGYDKNAEVPEALLKIGFGFTEIGTVTPRPQPGNDKPRLFRLIEDEAVINRLGFNNEGHGAA
PYRD_ARTCA      FPSPFGLAAGFDKEGHGIEALTELGFGHVEVGTITGQAQPGNEQPRLFRLIEDRAVINRMGFNNDGAAAV
PYRD_SYNJB      FPNPLGLAAGFDKDGLALGVWPSLGFGFVEVGTITPQPQPGNPKPRLFQLPQDRAALNRMGFNNXXXXXX
PYRD_RHOS1      LPNPVGLAAGYDKNAVALAALMRAGFGFLEVGAATPRPQPGNPQPRLFRLTEDRAAINRFGFNNDGAATI
PYRD_DEIGD      FSSPLGLAAGLDKNGEAVPAFGALGFGFVEVGTVTPRAQPGNARPRLFRLPSDEALINRMGFNNXXXXXX
PYRD_CYAP4      FPNPIGLAAGLDKDGVAAGLWGSFGFGFAEVGTVTYHPQPGNPRPRLFRLPADRAGINRMGFNNRGXXXX
PYRD_SALAI      FPNPVGLAAGMDKDGLALPAWPALGFGFVEVGTVTAHPQPGNPRPRLFRLPDSGAVVNRMGFNN-XXXXX
PYRD_RHORT      FANPLGLAAGFDKNGEVADALFDLGFGFVEVGTVTPRPQAGNPRPRLFRLTQDRAVINRMGFNNQGMEAM
PYRD_AGRAE      FPNPLGMAAGYDKNAEVPDALLKLGFGFTEIGTITPRPQSGNPRPRIFRLVDDKAVINRLGFNNEGHDAA
PYRD_THET8      FPNPLGLAAGMDKDARALGAWWALGFGFAEVGTLTPRPQVGNPKPRLFRLVEDRALINRMGFNNRGAEEA
PYRD_SYNP6      FATPVGLAAGFDKDGIAAPLWSDLGFGFAELGTVTALAQPGNPRPRLFRIPQDLAAFNRMGFNNASAEAL
PYRD_SYNE7      FATPVGLAAGFDKDGIAAPLWSDLGFGFAELGTVTALAQPGNPRPRLFRIPQDLAAFNRMGFNNASAEAL
PYRD_NATPD      FPNPVGVAAGFDKNAEIPDALGALGFGHVEVGGVTAEPQAGNPRPRMFRLAEDRALINRMGFNNDGADIV
PYRD_MYCUA      FPGPLGLAAGFDKDGTGLDTWAAMGFGYAEVGTVTAHPQPGNPAPRLFRLPEDRALLNRMGFNNHGAGAL
PYRD_DEIRA      FESPLGLAAGLDKNAQAVPAFTAFGFGFVEVGTVTPLAQSGNERPRLFRLPEDEALINRMGFNNGGTAAM
PYRD_XANP2      FPNPVGLAAGFDKHCEVADALFRFGFGFVEAGTVTPRPQPGNPLPRLFRLDEDEAVINRFGFNSEGLAPF
PYRD_THET2      FPNPLGLAAGMDKDARALGAWWALGFGFAEVGTLTPRPQVGNPKPRLFRLVEDRALINRMGFNNRGAEEA
PYRD_MYCMM      FPGPLGLAAGFDKDGTGLDTWAAMGFGYAEVGTVTAHPQPGNPAPRLFRLPEDRALLNRMGFNNHGAGAL
PYRD_BRAJA      FPNPIGMAAGFDKSAEVPDALLRLGFGFVEIGSVTPKPQSGNPRPRLFRLERDEAVINRMGFNNDGAD--
PYRD_AGRRK      FANPLGMAAGYDKNAEVPEALLKLGFGFTEIGTVTPKPQPGNPRPRIFRLVEDEGVINRLGFNNEGHEAA
PYRD_BARBK      FENFMGLAAGFDKNAEVVDAVFRLGFGFTEVGTVTPKPQAGNAKPRLFRLKEDEAIINRMGFNNDGHQIV
PYRD_ARATH      FSNPIGLAAGFDKNAEATEGLLGMGFGFVEVGSVTPVPQEGNPKPRIFRLSQEGAIINRCGFNSEGIVVV
PYRD_RHILO      FPNPLGMAAGYDKDAEVPDALLGLGFGFAEVGTVTPLPQAGNPKPRIFRLTADEAVINRLGFNNEGHAAA
PYRD_HALSA      FPNPVGMAAGFDKNAEIPRALAGLGFGHIEVGAVTAERQPGNDRPRLFRLPDDNALVNRMGFNNEGADTV
PYRD_HALS3      FPNPVGMAAGFDKNAEIPRALAGLGFGHIEVGAVTAERQPGNDRPRLFRLPDDNALVNRMGFNNEGADTV
PYRD_ERYLH      FPNPVGVAAGYDKDAEVPDAXXXXXXXXVEVGSITPRPQEGNPKPRLFRLSRDRAVINRMGFNNAGADVA
PYRD_BRASB      FPNPVGMAAGFDKNAEVPDALLRLGFGFVEIGSVTPRPQSGNPRPRLFRLERDEAVVNRMGFNNDGAEIV
PYRD_SYNPX      FPNPVGLAAGFDKNGVAAGLWDRFGFGFAEVGTVTWHGQPGNPRPRLFRLAQEQAALNRMGFNNDGAQAL
PYRD_MYCS2      FPGPLGLAAGFDKNGRGLAAWGALGFGYAEVGTVTAQPQPGNPAPRLFRLPDDHALLNRMGFNNEGAGAL
PYRD_KOCRD      FPSPFGLAAGFDKGATGTHALTQLGFGHVEIGTVTGQAQPGNPRPRLFRLVRDRAVINRMGFNNDGXXXX
PYRD_RHOPS      FPNPVGIAAGFDKNAEAPDALMRLGFGFVEIGTVTPKPQAGNPRPRLFRLERDEAVINRMGFNNDGSEAV
PYRD_PROMM      FLNPVGLAAGFDKNGVAASIWDRFGFGFAELGTVTWHGQTGNPRPRLFRLAAEQAALNRMGFNNNGAEVM
PYRD_BARQU      FENFVGLAAGFDKNAEVVEAIFHLGFGFTEIGTVTPKPQVGNPKPRLFRLREDEAIINRMGFNNNGHHIV
PYRD_SPHAL      FPNPVGLAPGFDKDARVAHAMPHFGFGFVEVGTLTPLPQEGNPRPRLFRLVEDRAIINRMGFNNGGQVAA
PYRD_SALTO      FPNPVGLAAGMDKNGVALPAWPALGFGFVEVGTVTAHPQPGNPRPRLFRLPDSRAVVNRMGFNN-XXXXX
PYRD_BARHE      FENFIGLAAGFDKNAEVVNDVFHLGFGFTEIGTVTPRPQVGNPKPRLFRLRKDEAIINRMGFNNDGRQIV
PYRD_RHOS4      XXXXXXXAAGYDKNAVALAALMRAGFGFLEVGAATPRPQPGNPQPRLFRLTEDRAAINRFGFNNDGAATI
PYRD_ARTS2      FPSPFGLAAGFDKEGHGIEALTELGFGHVEVGTITGQAQPGNEKPRLFRLVEDKAVINRMGFNNDGATAV
PYRD_STRCO      MHGPFGLAAGFDKNAVAIDGMAMLGFDHVEIGTVTGEPQPGNPKKRLFRLVADRALINRMGFNNDGSLAV
PYRD_RHOP5      FSNPVGIAAGFDKNAEAPDALLRMGFGFVEIGTVTPKPQSGNPRPRLFRLERDEAVINRMGFNNDGGE--
PYRD_RHISN      FPNPLGMAAGYDKNAEVPEALLRLGFGFTEIGTVTPRPQAGNDKPRIFRLVEDEAVINRLGFNNDGHGAA
PYRD_CYAP8      FNNPVGLAAGCDKEGIAAGIWSHLGFGFAELGAVTLHPQPGNPRPRLFRLPHDKAVLNRLGANNQGAEIM
PYRD_CYAA5      FKTPVGLAAGCDKDGLAAGIWDHFGFGFAEIGAVTLHAQPGNPKPRLFRLPQDKAALNRLGANNQGAQKV
PYRD_CORGL      FPRPLGLAAGFDKNASMADAWGAVGFGYAELGTVTASPQPGNPTPRLFRLPADKAILNRMGFNNLGAAEV
PYRD_SYNJA      FPNPIGLAAGFDKDGLAVGVWPSLGFGFVEVGTVTPGPQPGNPKPRLFQLPQDRAALNHMGFNNQGXXXX
PYRD_RHOPT      FSNPVGIAAGFDKNAEAPDALLRLGFGFVEVGTVTPKPQAGNPRPRLFRLERDEAVINRMGFNNEGAEAV
PYRD_RHOPA      FSNPVGIAAGFDKNAEAPDALLRLGFGFVEVGTVTPKPQAGNPRPRLFRLERDEAVINRMGFNNEGAE--
PYRD_CORGB      FPRPLGLAAGFDKNASMADAWGAVGFGYAELGTVTASPQPGNPTPRLFRLPADKAILNRMGFNNLGAAEV
PYRD_RHOP2      FPNPVGIAAGFDKNAEAPDALLRLGFGFVEIGTVTPKPQAGNPRPRLFRLERDEAIINRMGFNNDGAEAV
PYRD_NOCFA      FRAPLGLAAGFDKNAEGVDVWGPFGWGFAEIGTVTAQAQPGNPAPRLFRLPADRALINRMGFNNHGA---
PYRD_MYCVP      FPGPLGLAAGFDKDGIGVHAWGALGFGYAEVGTVTAQAQPGNPAPRLFRLPADRALLNRMGFNNHGAGAL
PYRD_DROME      LSNPIGIAAGFDKNAEAVDGLQDLGFGFIEVGTVTPAAQEGNPKPRVFRLTEDKAIINRYGFNSDGHQAV
PYRD_CLAM3      FPSPFGVAAGFDKDAQAVLGLGQLGFGHVEVGTVTAEAQPGNPRPRLFRLIEDRAVINRMGFNNGGXXXX
PYRD_MOUSE      FRNPVGIAAGFDKHGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSAV
PYRD_RAT        FRNPVGIAAGFDKNGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVX
PYRD_NOCSJ      FPNVLGLAAGFDKNAVGIDALAALGFGHVEIGTVTGEPQPGNPKPRLFRLPEDRAIVNRMGFNNDGAEVV
PYRD_MYCSS      FPGPLGLAAGFDKDGRGLHTWPALGFGYAEVGTVTAHPQPGNPEPRLFRLPEDRALLNRMGFNNDGA---
PYRD_MYCSK      FPGPLGLAAGFDKDGRGLHTWPALGFGYAEVGTVTAHPQPGNPEPRLFRLPEDRALLNRMGFNNDGA---
PYRD_MYCSJ      FPGPLGLAAGFDKDGRGLHTWPALGFGYAEVGTVTAHPQPGNPEPRLFRLPEDRALLNRMGFNNDGA---
PYRD_CLAMS      FPSPFGVAAGFDKDARAVLGLGQLGFGHVEVGTVTAEAQPGNPRPRLFRLIEDRAVINRMGFNNGGXXXX
PYRD_ASHGO      MSNPIGCAAGLDKDGEAIDGIAQSGFGYVEIGTVTPLAQPGNPKPRFFRLPMDEAVINRYGFNSSGHKKV
PYRD_CORST      FPAPLGLAAGFDKNAEAIDSWGAIGFGYAEMGTVTPKSQPGNPTPRLFRLPEDKAILNRMGFNNKGALVV
PYRD_HUMAN      FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
PYRD_CYAP7      FNNPLGLAAGFDKDGLGAGIWGSFGFGLAELGAVTHHPQPGNPRPRLFRLPLDKAGLNRMGANNQGATIL
PYRD_METNO      FPNPVGLAAGFDKGAEVPDALLSLXXXXXXXXXXXPRPQPGNPRPRVFRLTGDRAVINRFGLNSEXXXXX
PYRD_BOVIN      FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPEPQEGNPRPRVFRLPEDQAIINRYGFNSHGLSVX
PYRD_COREF      FPRPLGLAAGFDKNATAADTWTALGFGYAELGTVTASPQAGNPTPRLFRLPADRAILNRMGFNNAGAADV
PYRD_METC4      FPNPVGLAAGFDKGARVADALLGLXXXXXXXXXXXXXXXXXXXXXXXFRLPRDRAVINRFGLNSEGLDAV
PYRD_WIGBR      FKNILGLAAGLDKNGDYIKLFSDIGFGFIELGTVTLKPQHGEKKPRLFCFPNVYGIINRMGFXXXXXXXX
PYRD_PONAB      FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
PYRD_STRGG      MHGPFGLAAGFDKNAIAIDGMAMLGFDHVEIGTVTGEPQPGNPKKRLFRLVADRALINRMGFNNEGSXXX
PYRD_STRAW      MHGPFGLAAGFDKNAVAVDGMSMLGFDHVEIGTVTGEPQPGNPKKRLFRLVPDRALINRMGFNNEGSXXX
PYRD_NITSB      FCNPLGIAAGFDKNATMTKTLHALGFGYVEIGTVTPKPQSGNPKPRLFRYIKQEAIQNAMGFNNDGAEVI
PYRD_CORDI      FPQPLGLAAGFDKNGEAPDVWAAFGFGYAELGTVTASPQPGNPTPRLFRLPADKAILNRMGFNNLGAAEV
PYRD_HELPG      FPNPLGLAAGFDKNASMLRALIAFGFGYLEAGTLTNEAQVGNERPRLFRHIEEESLQNAMGFNNYGAVLG
PYRD_SYNY3      FPNVLGLSAGCDKEGEAAAVWPALGFGFAELGAVTKYAQPGNDRPRLFRLPQDQAVLNRLGANNEGAVAM
PYRD_MYCLE      FPGPLGLAAGFDKDGMGLLAWGALGFGYAEVGTVTAYPQPGNPAPRMFRLPADRALLNRMGFNNNGAGAL
PYRD_HELPH      FPNPLGLAAGFDKNASMLRALTAFGFGYLEAGTLTNEAQMGNERPRLFRHIEEESLQNAMGFNNYGAVLG
PYRD_HALMA      FDNPVGVAAGFDKNATIPETLASLGFGFAEVGGVTAEPQAGNARPRMFRLKADEAIINRMGLNNDGIGER
PYRD_SULDN      FFNPIGLGAGFDKNATMIRAMQILGFGFTEIGTITPKAQAGNPKPRMFRHIEEQSIQNAMGFNNEGLLSA
PYRD_LEIXX      FDSPFGIAAGFDKDGEGVIGLGALGFGHVEVGTITARPQPGNDKPRLFRLLPDRAVINRMGFNNHXXXXX
PYRD_THEFY      FPGPLGLAAGFDKNARGVAALTALGFSHVEIGTVTGQPQPGNPRPRLFRLVADRAIVNRMGFNNEGSQAV
PYRD_HELAH      FPNPLGLAAGFDKNASMIRALTAFGFGYLEAGTLTNTAQSGNEKPRLFRHIEEESLQNAMGFNNYGAVLG
PYRD_CANGA      MTNPIGCAAGLDKDAEAIDGIMPTGFGYMEVGSVTPVAQPGNPRPRFFRLPADDAVINRYGFNSSGHDVV
PYRD_SACKL      MTNPIGCAAGLDKDAEAIDGIMQGGFGYMEIGSVTPLPQPGNPKPRFFRLPQDDAVINRYGFNSSGHDAV
PYRD_MYCA9      FPAPLGLAAGFDKDGEGLKVWGPLGFGYAEVGTVTAIAQPGNPKPRLFRLPADRGLLNRMGFNNHGXXXX
PYRD_HELPJ      FPNPLGLAAGFDKNASMLRALIAFGFGYLEAGTLTNIAQSGNEKPRLFRHIEEESLQNAMGFNNYGAILG
PYRD_SULNB      FKNPVGLGAGFDKNGQYITSMPALGFGFTEIGTVTPKPQPGNPKPRLFRLLEDRSIQNAMGFNNRGMGYM
PYRD_RHOOB      FPAPLGLAAGFDKDATGVDAWGPLGFGFAEVGTVTAQAQPGNPAPRLFRLPADRALINRMGFXXXXXXXX
PYRD_METI4      FPNPVGLAAGFDKNGVGLRAWESFGFGFVEIGTVTPLPQEGNPAPRLCRLPKEGALWNSLGFPSQGAQRV
PYRD_MYCPA      FPGPLGLAAGFDKDGLGLHAWGALGFGYAEIGTVTAGPQPGNPAPRLFRLPADRALLNRMGFNNXXXXXX
PYRD_HELPS      FPNPLGLAAGFDKNISMLRALIAFGFGYLEAGTLTNEAQVGNERPRLFRHIEEESLQNAMGFNNHG--AI
PYRD_PLAF7      FINPFGVAAGFDKNGVCIDSILKLGFSFIEIGTITPRGQTGNAKPRIFRDVESRSIINSCGFNNMGCDKV
PYRD_MYCGI      FPGPLGLAAGFDKDGLGVHTWGALGFGYAELGTVTAQAQPGNPPPRMFRLPADRALLNRMGFNNHGXXXX
PYRD_RHOE4      FPAPLGLAAGFDKDATGVDAWGPLGFGFAEVGTVTAQAQPGNPAPRLFRLPADRALINRMGFNNHGAGHA
PYRD_MYCBT      FPAPLGLAAGFDKDGTALSSWGAMGFGYAEIGTVTAHPQPGNPAPXXXXXXXXXXXXXXMGFNNHGXXXX
PYRD_MYCBP      FPAPLGLAAGFDKDGTALSSWGAMGFGYAEIGTVTAHPQPGNPAPXXXXXXXXXXXXXXMGFNNHGXXXX
PYRD2_KLULA     LTNPIGCAAGLDKNGDAIDGILSGGFGYIEIGSVTPLPQPGNPRPRFFRLPLDDAVINRYGFNSSGHDTV
PYRD_MYCTU      FPAPLGLAAGFDKDGTALSSWGAMGFGYAEIGTVTAHPQPGNPAPXXXXXXXXXXXXXXMGFNNHGXXXX
PYRD_MYCTA      FPAPLGLAAGFDKDGTALSSWGAMGFGYAEIGTVTAHPQPGNPAPXXXXXXXXXXXXXXMGFNNHGXXXX
PYRD_MYCBO      FPAPLGLAAGFDKDGTALSSWGAMGFGYAEIGTVTAHPQPGNPAPXXXXXXXXXXXXXXMGFNNHGXXXX
PYRD_KINRD      FPTPLGLAAGFDKNATGISALGNFGFSCVEIGTVTARPQPGNPKPRLHRLVADRAVVNRMGFNNAGAEXX
PYRD_NAUPA      FKNPVGVAAGFDKHATMVYGWPALGFGWGEIGAVTPKPQPGNEKPRAWRHIEYEAVQNAYGFNNEGVEVI
PYRD2_KLUMA     LTNPVGCAAGLDKDGEAIDGIFAGGFGYVEIGSVTPLPQPGNPKPRFFRLPMDEAVINRYGFNSSGHDSV
PYRD_HELPY      FPNPLGLAAGFDKNASMLRALMAFGFGYLEAGTLTNEAQVGNERPRLFRHIEEESLQNAMGFNNYGAILG
PYRD_SCHPO      FCNPIGLAAGFDKQADAISGLLNFGFSYLEIGSVTPKPQPGNPKPRYFRLKPDLSVINRYGFNSIGHDAI
PYRD_CANAL      LKNPIGLAAGLDKDGEAIESLFNCGFSYVEIGSITPEPQPGNPQPRFFRLPKDDAVINRYGFNSSGHFNV
PYRD_HELP2      FPNPLGLAAGFDKNASMLRALIAFGFGYLEAGTLTNEAQMGNERPRLFRHIEEESLQNAMGFNNHGAVLG
PYRD_METJA      FKNPVFLASGIGETGSALKRIAKGGAGAVTTKSIGLNPNPGHKNPTIVEV--YGGFLNAMGLPNPGVDEY
PYRD_AQUAE      FKNPVWVASGTFGYGVE----AAEIYDISKLGAVVTKGRLGNETPRIVETPCG--MLNSIGLQNPGVEKF
PYRD_PYRHO      FENPLILASGVDMTPELLRRAHNEGAGGVVTKSIGKEPRKGYDNPTIVELPYG--LINAMGLPNPGWEAF
PYRD_PYRAB      FKNPLILASGVDMTPELLRRAHREGAGGVVTKSIGMEPRKGYENPTIVELPYG--LINAMGLPNPGWEAF
PYRD_SULSY      FKNPVWTASGTFSYGLEVAKIYDLSLGAIVVKGLSLKPRKGNMPERIVETPAG--MLNSIGLQNPGVDYF
PYRD_GEOSF      LRNPVMTASGTFGYGKFSDYLDLEKIGAIITKGLSLRPKAGNPTPRIVETP--GGMLNAIGLQNVGIDAF
PYRD_GEOSM      MRNPVMTASGTFGYGAFADYLDLESIGAMISKGLSLKPKAGNPTPRIVETP--GGMLNAIGLQNVGIDAF
PYRD_GEOSL      LRNPVMTASGTEEFSEYVN-LEAIGAIITKGLSLKPKA--GNPTPRI--VETTGGMLNAIGLQNVGIDAF
PYRD_GEOMG      LRNPVMTASGTEEFAAYVN-LEKIGAIITKGLSLKPKA--GNPTPRIQET--TGGMLNAIGLQNVGIDAF
PYRD_BRAHW      --------------------------GAVNLKGITLNKKDGNKGTRIAETPSG--MINCIGLENPGIEYF
PYRD_GEOUR      LRNPVMTASGTFGYGKFADYLDLEKIGAIITKGLSIRPKAGNPTPRIVETP--GGMLNAIGLQNVGIDAF
PYRD_GEOBB      MRNPVMTASGTFGYGAYLD-LECIGAMISKGLSLKPKA--GNPTPRIVETP--GGMLNAIGLQNVGIDAF
PYRD_DESRM      --NPVTTASGTFGYGQYVD-LNQLGAIVVKGTTLEPRE--GNPTPRLVETPSG--ILNSIGLQNSGVDYL
PYRD_BACSU      LKNPIIPASGFGKEFSRFYDLSCLGAIMIKATTKEPRF--GNPTPRVAET--GAGMLNAIGLQNPGLDSV
PYRD_PYRKO      FENPLILASGIDKVPEQWIRAHEEGAGGVVTKSIGIEPRKGYDNPTIVELPYG--LINAMGLPNPGWKGF
PYRD_UNCMA      LKNPTILAAGLGTTGASLKRIASMGAGAVVTKSIGTEPKPGHHNPSMIRL--EEGYINAMGLPNPSFGEF
PYRD_PORGI      IKNPVMTASGTYGYGTYKDFIDIDRLGAIVVKGTTLHHREGNAYPRMAETPSG--MLNAVGLQNKGVHYF
PYRD_DESAP      LKNPVLTASGTVGFGEYAPYLDLAGLGALVVKTVTLKPRAGNPPPRITETPAG--VINAVGLQNPGVEAL
PYRDB_ENTFA     LKNPIIPASGCFGFGEYANYYDLDQLGSIMIKATTPQARYGNPTPRVAETP--SGMLNAIGLQNPGLEVV
PYRD_PELPD      LRNPVMTASGTFGYGRYVD-LEKIG-AFVTKG-LSLKPRPGNPTPRIVETP--GGMLNAIGLQNVGIEAF
PYRD_LACDA      ---------GLDLKNPVMPASGTFGFGDVPIKTTTPHATTGNPQPQIAILE--DGVLNSVGLTNPGVDQV
PYRD_HELMI      MKNPVTTASGTFGFGLFID-LSRLGAIVVKGTTLEPRE--GNPTPRMAETPAG--MLNAIGLQNPGVEAF
PYRD_ANOFW      LKNPIMPASGFGREYAKFYDLSVLGAMMIKATTLEARF--GNPTPRVAETPSG--MLNAIGLQNPGVDYV
PYRD_THETN      LKNPVITASGTFGFGRYSEYIDLNKLGAIVVKGLTVKPREGNPPPRLFET--ASGILNSIGLQNPGVDAF
PYRD_PEDPA      LKSPVMNASGTAAYGQQMADLNELGAFVIKSTTMEPRA--GHPWPTT--AATTGGWLNAVGLKNPGIEHV
PYRD_LACAC      LKNPVMPASGTFGFG---DVPAAKKFDLNDLGTTTPKATSGNPQPQIAVLD--DGVLNSVGLTNPGVDQV
PYRD_LACPL      FKNPVMPASGTAAYGQQMADLSALGGLVIKSTTAEPKA--GNPRPTTAETTAG--WLNAIGLKNPGID--
PYRD_LACH4      ---------GLDLKNPVMPASGTFGFGDVPIKTTTPHATTGNPQPQIAILE--DGVLNSVGLTNPGVDQV
PYRD_LACDB      ---------GLDLKNPVMPASGTFGFGDVPIKTTTPHATTGNPQPQIAILE--DGVLNSVGLTNPGVDQV
PYRD_BACHD      MKNPIMPASGFGKEFAGFYDLNHLGAIAIKATTVEPRF--GNPTPRVAETHSG--MLNAIGLQNPGLNNV
PYRD_FUSNN      LKNPIMPASGCFAFGIYAELYDISKLGAIMIKAATKEARFGNPTPRV--AETSSGMLNAIGLQNPGVDEI
PYRD_THEAC      LENPLMLASGLDENGYTMLDVMNNGAAAVVTKSIGMEERNGYSAPVI--VEYGDSLINAVGLSNPGIDNF
PYRD_SOLUE      LKNPVLAASGTFAYGVEFEKLVALG-GFVVKG-LSREPIEGNPPPRVFE--SEAGMINSVGLQNIGVRAF
PYRD_BACV8      LCNPVMTASGTFGYGKFEDFVDLEKIGGIIVKGTTLHHREGNPYPRMAETPMG--MLNAVGLQNKGVDYF
PYRD_BACA2      LKNPIIPASGCFGFGKEYAGFYDLSLGGIMIKATTNEARFGNPTPRVAET--SAGMLNAIGLQNPGLEHV
PYRD_SYNWW      LKNPVAVASGTFGYGLYADFIEPEKIGAVIVKGTTLHPRPGNPGPRIYETPAG--MLNAIGLENPGIEVF
PYRD_GEOKA      LKNPIMPASGFGREYARFYDLSVLGAIMIKATTKEPRF--GNPTPRVAETP--GGMLNAIGLQNPGLDKV
PYRD_BACTN      MKNPVMTASGTFGYGEFSDFIDIARIGGIIVKGTTLHKREGNPYPRMAETPSG--MLNAVGLQNKGVDYF
PYRD_THEVO      LVNPFMVASGLDENGYTMKELLERGAAAVVTKSIGISERDGYPTPVI--VEYGDSLINAVGLSNPGIENF
PYRD_LACSS      LKNPIMPASGCQEYGRYYD-LNLLGAFIIKAATKEPRL--GNATPRVAETPSG--MLNAIGLQNPGIEAI
PYRD_BACP2      LKNPIIPASGFGREFASLYDLSVLGSIMIKATTLEPRF--GNPTPRVAET--GAGMLNAIGLQNPGLKGV
PYRD_MYCPE      LKNPIMPASGCFGFGKEFSELYDLSLGAIIIKAATKNEKFGNPTPRVAET--SSGMLNAIGLQNPGVDHI
PYRD_LACJO      ---------GLDLKNPIMPASGTFGFGDVPIKTTTPHSTTGNPQPQIAVLNTG--VLNSVGLTNPGVDAV
PYRD_GEOTN      LKNPIMPASGFGREYAQFYDLSVLGAIMIKATTKEPRF--GNSTPRVAETPSG--MLNAIGLQNPGLDKV
PYRD_CLOPH      FKNPVTTASGTFGSGMYSEFVDLNRLGAITTKGVSSVPWPGNPVPRIAET--YGGMLNAIGLQNPGVDMF
PYRD_LISMF      LKNPIMPASGCFGFGQYSKYYDLNELGAIMAKAVTPEPRLGNPTPRVAET--ASGMLNAIGLQNPGLEHV
PYRD_LISMC      LKNPIMPASGCFGFGQYSKYYDLNELGAIMAKAVTPEPRLGNPTPRVAET--ASGMLNAIGLQNPGLEHV
PYRD_BACCL      LKNPIMPASGFGREYARFYDLSVLGAIMIKATTKEPRF--GNPTPRVAETP--GGMLNAIGLQNPGLDKV
PYRD_AZOPC      FKNPVLAASGTFGYGIYSDFVDLSKIGGIFTKGITLYHREGNDYPRMAET--SSGMLNAVGLQNRGVTYF
PYRD_THEP1      ---PLVLLSGPAGFGEYLKLMDHRYVGGVLLKTVTLHPKEGNPTPRM-----ADSVINRIGLENPGIHAF
PYRD_THEMA      ---PLVLLSGPAGFGEYLKLMDHRYVGGVLLKTVTLHPKEGNPTPRM-----ADSVINRIGLENPGIHAF
PYRD_PARD8      --NPVMTASGTFGYGIYADFMDISRLGGIFVKGTTIQPREGNDYPRMAETPSG--MLNAVGLQNKGADYF
PYRD_BACCR      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLDKV
PYRD_BACC2      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLDKV
PYRD_LISW6      LKNPIMPASGCFGFGQYSKYYDLNKLGAIMAKAVTPEPRLGNPTPRVAET--ASGMLNAIGLQNPGLEHV
PYRD_LISMO      LKNPIMPASGCFGFGQYSKYYDLNELGAIMAKAVTPEPRLGNPTPRVAET--ASGMLNAIGLQNPGLEHV
PYRD_LISIN      LKNPIMPASGCFGFGQYSKYYDLNELGAIMAKAVTPEPRLGNPTPRVAET--ASGMLNAIGLQNPGLEHV
PYRD_BACC4      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLDKV
PYRD_PROAC      LKNPIMPASGCFGFGAYYD-LSVLGSIMVKATTLEPRR--GNPVIRVAETP--GGMLNAIGLQNPGLDVV
PYRD_LISMH      LKNPIMPASGCFGFGQYSKYYDLNELGAIMAKAVTPEPRLGNPTPRVAET--ASGMLNAIGLQNPGLEHV
PYRD_GEOLS      LRNPVMTASGTEEFSQYVD-LEKIG-AFVTKGSLKPRA--GNPTPRIVETP--GGMLNAIGLQNVGIDAF
PYRD_BACAH      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACSK      MKNPVMPASGCFGFGKYGQFFDLNQLGAIAIKATTKEARFGNETPRVAETKAG--MLNAIGLQNPGLQGV
PYRD_BACCN      LKNPIIPASGFGREYAQFYDLNVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACWK      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACHK      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACCZ      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACCQ      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACC7      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACC3      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACC1      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACC0      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACAN      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACAC      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACAA      LKNPIIPASGFGREYAQFYDLSVLGSIMIKATTEQPRY--GNPTPRVAETP--GGMLNAIGLQNPGLEKV
PYRD_BACFR      MKNPVMTASGTFGYGEFADFIDITRIGGIIVKGTTLHKREGNPYPRMAETPSG--MLNAVGLQNKGVEYF
PYRD_BACFN      MKNPVMTASGTFGYGEFADFIDITRIGGIIVKGTTLHKREGNPYPRMAETPSG--MLNAVGLQNKGVEYF
PYRD_DESMR      VKNPVMTASGTFGYGAPYGDLRSLGGIVVKGLSLAPRL--GNPMPRIAETPCG--MLNAIGLQNCGVEKF
PYRD_STACT      LKNPVMPASGCFAFGAEFSQFYDLSLGAIMIKAATKEARYGNETPRVAETDSG--MINAIGLQNPGVHHI
PYRD_GEOSW      LKNPIMPASGFGREYAQFYDLSKLGAIMIKATTKEPRF--GNPTPRVAETP--GGMLNAIGLQNPGLQKV
PYRD_EXIS2      LKNPIIPASGCFGFGEEFAKLYDLSLGGIMIKAATGEERYGNPTPRVAE--SGMGMLNAIGLQNPGVEGI
PYRD_NATTJ      MKNPVASASGTFGFGEYQSVISPHELGALVVKGLTLSPKRGNQGTRLHET--ASGLLNSIGLENPGIDNF
PYRD_CALS8      LKNPVIAASGTFGFGREYSKLIDISFGAICTKGITLKKRNGNPQPRLCEV--YGGIINSVGLENPGVEAF
PYRD_ANATD      LKNPVIAASGTFGFGREYSKLIDISFGAICTKGITLKKRIGNPQPRLCEVYAG--IINSVGLENPGVEAF
PYRD_METMA      LKNPTILAAGLGTTGASLCRVAREGAGAVVTKSIGPAPKTGHPNPSMIELDCG--FLNAMGLPNPSYPGF
PYRD_ALKMQ      LKNPVMTASGTFGSGRYGEYVDLNQLGAVVVKGVANEPWKGNPSPRIAET--YGGMLNSVGLQNPGVDEF
PYRD_STRU0      FDNCLMNAAGMSKEELLEIETSAAGSFVTKTGTL--EAREGNPEPRYAPTPLGS--INSMGLPNMGYDYY
PYRD_PETMO      FKNPVIAASG------------TFGFGFLEYFPISXREREGNKGVRIHET--IGGIMNSIGLQNPGIDAF
PYRD_LACRJ      LKNPIIAASGTGQEAAKKYNLNHLGSLVLKSTTLYPRQ--GNPRPRVCET--SAGWLNANGLQNVGITAA
PYRD_LACRD      LKNPIIAASGTGQEAAKKYNLNHLGSLVLKSTTLYPRQ--GNPRPRVCET--SAGWLNANGLQNVGITAA
PYRDB_LACLA     ---------GLDLKNPIIPASGCFGFGMVKATTLHPRF--GNPTPRVAET--ASGMLNAIGLQNPGLEVI
PYRD_SULAC      FEDPIVIASGIPPTKEYMQNVCEK----YEPSAITSKTLTYSPRSPTFVKISDNCYLNAIGLGNPGIQ-I
PYRD_STRA5      --------------------------------TGTLEAREGNPQPRYADTDWGS--INSMGLPNKGIDYY
PYRD_STRA3      --------------------------------TGTLEAREGNPQPRYADTDWGS--INSMGLPNKGIDYY
PYRD_STRA1      --------------------------------TGTLEAREGNPQPRYADTDWGS--INSMGLPNKGIDYY
PYRD_THEPX      LKNPVMTASGTREYGEYID---LNQLGAIVVKGLTVKPKEGNPPPRVYETPCG--MLNSVGLQNSGVDAF
PYRD_SACCA      YENPLMNASGVHMTTKELDELAASRAGAFITKSSTTLERAGNPEPRYVSVPLGS--INSMGLPNQGIDYY
PYRD_OCEIH      LKNPIMPASGFGKEYSEYYDLSLLGGVMMKAATQFERL--GNPTPRVAET--SAGMLNAIGLQNPGVQQI
PYRD_PYRFU      FENPLILASGVDMTPELLRRAHKEGAGGVVTKSIGIEPRKGYDNPTVVEVPCG--LINAMGLPNPGWKAF
PYRD_AERPE      LQRPVGNASGIPREARLVE---EGGGGFFVAKSVTYQPRKGYPQPHLY--PVAGGIVNAVGLANPGFREA
PYRD_SACPA      -----------------LDELANSKAGAFITKSATTLEREGNPKPRYISVPLGS--INSMGLPNEGIDSY
PYRD_METAC      LKNPTILAAGLGTTGASLCRVAREGAGAVVTKSIGPAPKTGHSNPSMIKLDCG--FLNAMGLPNPSYPGF
PYRD_SACMI      -----------------LDELADSKAGAFITKSATTLEREGNPKPRYISVPLGS--INSMGLPNEGIDYY
PYRD_THEP3      LKNPVMTASGTREYGEYID---LNQLGAIVVKGLTVNPKEGNPPPRVYETP--CGMLNSVGLQNPGINAF
PYRD_STRS7      -----------------------------KTGTLAPRQ--GNPEPRY--ADTALGSINSMGLPNHGYQYY
PYRD_CLOD6      FKNPVIMASGTFGFGKYNEIYDIQKLGGISSKGLTLNKKPGNNGMRVHET--SSGMMNSVGLENPGVQGF
PYRD_YEAST      -----------------LDELANSKAGAFITKSATTLEREGNPEPRYISVPLGS--INSMGLPNEGIDSY
PYRD_STRE4      -----------------------------KTGTLAPRQ--GNPEPRY--ADTALGSINSMGLPNHGYQYY
PYRD_ALKOO      LKNPVMTASGTFGSGRYSEFVDLNQLGAVVVKGVANEPWSGNPTPRIAET--YGGMLNSVGLQNPGVEAF
PYRDB_LACLM     ---------GLDLKNPIIPASGCFGFGMVKATTLHPRF--GNPTPRVAET--ASGMLNAIGLQNPGLEVI
PYRD_STRP1      --------------------------------TGTLEVRPGNPEPRYADTRLGS--INSMGLPNNGFRYY
DPYD_DANRE      FPNPFGLAAPPTTSAAMIRRAFEQGWGFALTKTVSPRIVRGTTSGHIFGPGQGSFLNIEL----------
PYRD_METTH      LRNPTILAAGMGSMASSLNRIYRGGAGAVVTKSFSLRPNPGYRNPTTVEV--TGGVINAIGLSNPGVEAF
PYRD_DESAD      LKNPILTASGTFGFGLEFQRYGDLSLGGIVVKGLSLKPREGNPMPRIAETPCG--MLNAIGIQNPGVEEF
DPYD_MOUSE      ----------------------------------------------------------------------
PYRD_STRPG      --------------------------------TGTLEVRPGNPEPRYADTRLGS--INSMGLPNNGFRYY
PYRD_ARCFU      MKNPLMLASGIMGSKVHSLNLIARDAGAVVTKSVGVEEREGYRNPTVVNWKCG--LINAVGLASPAAKDF
PYRD_STRP8      --------------------------------TGTLEVRPGNPEPRYADTRLGS--INSMGLPNNGFRYY
PYRD_CARHZ      --NPVMPASGTFGFGLFKDIFDLKNLGALVVKTITKNPRLGNRPPRVYEV--SCGMINSIGLANPGWDYF
DPYD_CAEBR      ----------------------------------------------------------------------
DPYD_RAT        ----------------------------------------------------------------------
YEIA_ECOLI      ----------------------------------------------------------------------
DPYD_CAEEL      ----------------------------------------------------------------------
PYRD_STRR6      --------------------------------TATLDFRQGNPEPRYQDVPLGS--INSMGLPNNGXXXX
PYRD_STRPN      --------------------------------TATLDFRQGNPEPRYQDVPLGS--INSMGLPNNGXXXX
DPYD_PIG        ----------------------------------------------------------------------
DPYD_HUMAN      ----------------------------------------------------------------------
DPYD_BOVIN      ----------------------------------------------------------------------
DPYD_DICDI      ----------------------------------------------------------------------
DPYD_PONAB      ----------------------------------------------------------------------
DEOC_STACT      ----------------------------------------------------------------------
DEOC_THEGJ      ----------------------------------------------------------------------
MED14_COCIM     ----------------------------------------------------------------------
GGGPS_METTP     ----------------------------------------------------------------------
DEOC_ENTFA      ----------------------------------------------------------------------
PYRDA_ENTFA     -----------------MDELAASQAGAFVAKTATPNPRQGNEEPRYFDTPLGS--INSMGLPNLGIDYY
PYRD1_KLULA     -----------------LDDMARSSSGAFITKSATSMERDGNPEPRYVSVPLGS--INSMGLPNKGIDYY
DEOC_STRZJ      ----------------------------------------------------------------------
DEOC_STRPJ      ----------------------------------------------------------------------
DEOC_STRP4      ----------------------------------------------------------------------
DEOC_PYRKO      ----------------------------------------------------------------------
DEOC_THETN      ----------------------------------------------------------------------
DEOC_STRZT      ----------------------------------------------------------------------
DEOC_GEOKA      ----------------------------------------------------------------------
DEOC_CALS8      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IRNVQASRWKAEGGVLGLNIGKNADTPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASEL
PYRD_RALME      IRNVQASRWKAEGGVLGLNIGKNADTPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASEL
PYRD_RALEJ      IANVKASRWKAEGGVLGLNIGKNADTPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASEL
PYRD_RALEH      VANVRASRWKAEGGVLGLNIGKNADTPIERANDDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASEL
PYRD_CUPTR      VANVRASRWKAEGGVLGLNIGKNADTPIERANDDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGAXXX
PYRD_RALSO      IRNVQASKWREAGGVLGLNIGKNADTPIERAVDDYLHCLERVYPYASYVTVNISSPNTKNLRQLQGASEL
PYRD_HERAR      VSNVQASRYQNKEGILGLNIGKNADTPIERAVDDYLICLEKVYPYASYVTVNISSPNTKNLRQLQGASEL
PYRD_JANMA      VANVRSSKYQNKEGVLGLNIGKNADTPIERAVDDYLICLEKVYPYASYVTVNISSPNTKNLRQLQGASEL
PYRD_BURXL      VKNVQAARYR---GILGLNIGKNADTPIERAAEDYLYCLDRVYPFASYVTVNISSPNTKNLRXXXXXXXX
PYRD_BURTA      VKNVQAARYR---GVLGLNIGKNADTPIERAADDYLYCLERVYPFASYVTINISSPNTKNLRXXXXXXXX
PYRD_BORPA      IANVQRSQWRSQGGILGLNIGKNADTPIERAAEDYLISLAGVYPHADYVTVNISSPNTKNLRALQGGDEL
PYRD_BORBR      IANVQRSQWRSQGGILGLNIGKNADTPIERAAEDYLIGLAGVYPHADYVTVNISSPNTKNLRALQGGDEL
PYRD_AZOSB      VANVKAARFK---GVLGINIGKNFDTPIENAADDYLACLDKVYPLASYVTVNISSPNTKNLRQLQGESEL
PYRD_BORPE      IANVQRSQWRSQGRILGLNIGKNADTPIERAAEDYLIGLAGVYPHADYVTVNISSPNTKNLRALQGGDEL
PYRD_BURPS      VKNVQAARYR---GVLGLNIGKNADTPIERAADDYLYCLERVYPFASYVTINISSPNTKNLRQXXXXXXX
PYRD_BURP1      VKNVQAARYR---GVLGLNIGKNADTPIERAADDYLYCLERVYPFASYVTINISSPNTKNLRQXXXXXXX
PYRD_BURP0      VKNVQAARYR---GVLGLNIGKNADTPIERAADDYLYCLERVYPFASYVTINISSPNTKNLRQXXXXXXX
PYRD_BURMS      VKNVQAARYR---GVLGLNIGKNADTPIERAADDYLYCLERVYPFASYVTINISSPNTKNLRQXXXXXXX
PYRD_BURMA      VKNVQAARYR---GVLGLNIGKNADTPIERAADDYLYCLERVYPFASYVTINISSPNTKNLRQXXXXXXX
PYRD_BURM9      VKNVQAARYR---GVLGLNIGKNADTPIERAADDYLYCLERVYPFASYVTIN