[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08260.1

[Show Plain Result]


## Summary of Sequence Search
    1::305
   17::247     8e-76  55%  291 aa  CYSW_ECOLI RecName: Full=Sulfate transport system permease protein
   17::247     8e-76  55%  291 aa  CYSW_ECOL6 RecName: Full=Sulfate transport system permease protein
   32::282     2e-71  51%  286 aa  CYSW_SYNE7 RecName: Full=Sulfate transport system permease protein
   37::240     3e-69  57%  276 aa  CYSW_SYNY3 RecName: Full=Sulfate transport system permease protein
   28::231     6e-40  37%  284 aa  CYST_NEPOL RecName: Full=Probable sulfate transport system permease
   26::235     3e-38  36%  288 aa  CYST_ZYGCR RecName: Full=Probable sulfate transport system permease
   47::235     5e-37  39%  269 aa  CYST_MESVI RecName: Full=Probable sulfate transport system permease
   30::252     2e-36  35%  286 aa  CYST_CHLAT RecName: Full=Probable sulfate transport system permease
    2::204     4e-35  38%  255 aa  CYST_PROWI RecName: Full=Probable sulfate transport system permease
   47::241     6e-35  37%  277 aa  CYST_SALTY RecName: Full=Sulfate transport system permease protein
   39::235     4e-34  35%  288 aa  CYST_ANTFO RecName: Full=Probable sulfate transport system permease
   25::235     5e-34  33%  288 aa  CYST_MARPO RecName: Full=Probable sulfate transport system permease
   37::215     6e-34  40%  266 aa  CYST_CHLVU RecName: Full=Probable sulfate transport system permease
   47::241     2e-33  35%  277 aa  CYST_ECOLI RecName: Full=Sulfate transport system permease protein
   43::217     2e-30  35%  270 aa  CYST_HELSJ RecName: Full=Probable sulfate transport system permease
   55::225     1e-28  35%  278 aa  CYST_SYNE7 RecName: Full=Sulfate transport system permease protein
   53::232     1e-27  31%  286 aa  CYST_SYNY3 RecName: Full=Sulfate transport system permease protein
   20::249     8e-21  30%  286 aa  NIFC_CLOPA RecName: Full=Probable transport system permease protein
    3::178     4e-20  32%  229 aa  MODB_HAEIN RecName: Full=Molybdenum transport system permease
   36::207     9e-20  30%  261 aa  WTPB_ARCFU RecName: Full=Molybdate/tungstate transport system
    2::224     2e-19  29%  264 aa  MODB_MYCTU RecName: Full=Molybdenum transport system permease
    2::224     2e-19  29%  264 aa  MODB_MYCBO RecName: Full=Molybdenum transport system permease
   44::212     7e-19  33%  249 aa  WTPB_PYRFU RecName: Full=Molybdate/tungstate transport system
    6::212     2e-16  30%  248 aa  WTPB_PYRHO RecName: Full=Molybdate/tungstate transport system
   37::199     3e-16  35%  227 aa  YVGM_BACSU RecName: Full=Putative molybdenum transport system
    5::198     3e-16  29%  247 aa  WTPB_PYRKO RecName: Full=Molybdate/tungstate transport system
    6::212     8e-16  29%  248 aa  WTPB_PYRAB RecName: Full=Molybdate/tungstate transport system
   38::185     4e-15  29%  228 aa  MODB_RHOCA RecName: Full=Molybdenum transport system permease
   28::182     4e-15  30%  229 aa  MODB_ECOLI RecName: Full=Molybdenum transport system permease
   28::182     4e-15  30%  229 aa  MODB_ECO57 RecName: Full=Molybdenum transport system permease
   33::200     8e-15  26%  249 aa  WTPB_METJA RecName: Full=Molybdate/tungstate transport system
    1::220     9e-14  30%  275 aa  POTB_SHIFL RecName: Full=Spermidine/putrescine transport system
    1::220     9e-14  30%  275 aa  POTB_ECOLI RecName: Full=Spermidine/putrescine transport system
   11::230     1e-13  30%  287 aa  POTB_SALTY RecName: Full=Spermidine/putrescine transport system
   11::230     1e-13  30%  287 aa  POTB_SALTI RecName: Full=Spermidine/putrescine transport system
   32::254     3e-13  28%  286 aa  PHNU_SALCH RecName: Full=Putative 2-aminoethylphosphonate transport
   32::288     5e-13  26%  289 aa  PHNU_SALPA RecName: Full=Putative 2-aminoethylphosphonate transport
   32::254     8e-13  27%  286 aa  PHNU_SALTY RecName: Full=Putative 2-aminoethylphosphonate transport
   51::288     3e-11  25%  289 aa  PHNU_SALTI RecName: Full=Putative 2-aminoethylphosphonate transport
   96::185     6e-11  36%  226 aa  MODB_AZOVI RecName: Full=Molybdenum transport system permease
   32::224     2e-10  28%  309 aa  Y4OQ_RHISN RecName: Full=Probable ABC transporter permease protein
  425::624     4e-10  29%  687 aa  FBPB_ACTPL RecName: Full=Ferric transport system permease protein
   30::259     1e-09  28%  324 aa  PSTC_XYLFT RecName: Full=Phosphate transport system permease
   30::259     2e-09  28%  324 aa  PSTC_XYLFA RecName: Full=Phosphate transport system permease
   86::264     4e-09  26%  317 aa  POTH_ECOLI RecName: Full=Putrescine transport system permease
   41::237     2e-08  22%  536 aa  THIP_ECOLI RecName: Full=Thiamine transport system permease protein
   14::213     3e-08  29%  263 aa  PHNV_SALTI RecName: Full=Putative 2-aminoethylphosphonate transport
  114::304     3e-08  24%  632 aa  FBPB1_HAEIN RecName: Full=Putative ferric transport system permease
   13::204     8e-08  23%  293 aa  UGPA_AGRT5 RecName: Full=sn-glycerol-3-phosphate transport system
  177::254     8e-08  35%  320 aa  PSTC_PASMU RecName: Full=Phosphate transport system permease
   14::213     1e-07  28%  265 aa  PHNV_SALPA RecName: Full=Putative 2-aminoethylphosphonate transport
   27::196     1e-07  21%  506 aa  FBPB2_HAEIN RecName: Full=Fe(3+)-transport system permease protein
   41::216     2e-07  31%  293 aa  YCJO_SHIFL RecName: Full=Inner membrane ABC transporter permease
   41::216     2e-07  31%  293 aa  YCJO_ECOLI RecName: Full=Inner membrane ABC transporter permease
   63::233     4e-07  22%  284 aa  POTC_MYCGE RecName: Full=Spermidine/putrescine transport system
    7::231     4e-07  23%  286 aa  POTB_HAEIN RecName: Full=Spermidine/putrescine transport system
   21::204     1e-06  23%  294 aa  YQGI_BACSU RecName: Full=Probable ABC transporter permease protein
  173::258     1e-06  33%  315 aa  PSTC_HAEIN RecName: Full=Phosphate transport system permease
   81::269     3e-06  28%  327 aa  PSTC_RHILO RecName: Full=Phosphate transport system permease
   82::253     3e-06  38%  315 aa  PSTC_METJA RecName: Full=Probable phosphate transport system
   13::204     4e-06  24%  293 aa  UGPA_RHIME RecName: Full=sn-glycerol-3-phosphate transport system
   75::256     5e-06  26%  313 aa  YDCU_ECOLI RecName: Full=Inner membrane ABC transporter permease
  183::251     5e-06  28%  319 aa  PSTC_SHIFL RecName: Full=Phosphate transport system permease
  183::251     5e-06  28%  319 aa  PSTC_ECOLI RecName: Full=Phosphate transport system permease
  183::251     5e-06  28%  319 aa  PSTC_ECO57 RecName: Full=Phosphate transport system permease
  114::329     7e-06  22%  418 aa  GANP_BACSU RecName: Full=Putative arabinogalactan oligomer
   54::209     1e-05  25%  292 aa  AMYD_THETU RecName: Full=Probable starch degradation products
  122::250     2e-05  30%  309 aa  YQGH_BACSU RecName: Full=Probable ABC transporter permease protein
   89::249     2e-05  26%  289 aa  Y3749_BRUSU RecName: Full=Probable ABC transporter permease protein
   20::154     3e-05  32%  538 aa  THIP_HAEIN RecName: Full=Thiamine transport system permease protein
   14::213     3e-05  27%  265 aa  PHNV_SALTY RecName: Full=Putative 2-aminoethylphosphonate transport
   14::213     3e-05  27%  265 aa  PHNV_SALCH RecName: Full=Putative 2-aminoethylphosphonate transport
   89::248     5e-05  26%  289 aa  Y2990_BRUA2 RecName: Full=Probable ABC transporter permease protein
   89::248     5e-05  26%  289 aa  Y2783_BRUAB RecName: Full=Probable ABC transporter permease protein
  287::429     5e-05  26%  523 aa  MALF_VIBVY RecName: Full=Maltose transport system permease protein
  287::429     5e-05  26%  523 aa  MALF_VIBVU RecName: Full=Maltose transport system permease protein
   89::224     6e-05  28%  295 aa  PSTA_YERPE RecName: Full=Phosphate transport system permease
  193::344     6e-05  27%  435 aa  MALC_STRR6 RecName: Full=Maltodextrin transport system permease
  193::344     6e-05  27%  435 aa  MALC_STRPN RecName: Full=Maltodextrin transport system permease
   19::209     8e-05  27%  280 aa  PSTA_PASMU RecName: Full=Phosphate transport system permease
  294::436     8e-05  24%  530 aa  MALF_YERPE RecName: Full=Maltose transport system permease protein
  184::240     1e-04  35%  304 aa  PSTA_MYCLE RecName: Full=Phosphate transport system permease
   48::235     1e-04  21%  286 aa  POTC_MYCPN RecName: Full=Spermidine/putrescine transport system
   42::214     1e-04  20%  527 aa  FBPB_SERMA RecName: Full=Fe(3+)-transport system permease protein
   32::262     1e-04  27%  309 aa  YESP_BACSU RecName: Full=Probable ABC transporter permease protein
   63::194     1e-04  22%  295 aa  LPLC_BACSU RecName: Full=Protein lplC;
   95::216     2e-04  34%  303 aa  MALG_YERPE RecName: Full=Maltose transport system permease protein
   42::215     2e-04  26%  291 aa  Y1038_PYRHO RecName: Full=Probable ABC transporter permease protein
   88::209     2e-04  34%  296 aa  MALG_PHOLL RecName: Full=Maltose transport system permease protein
   33::232     4e-04  26%  316 aa  ARAP_BACHD RecName: Full=L-arabinose transport system permease
   21::212     5e-04  27%  282 aa  PSTA_HAEIN RecName: Full=Phosphate transport system permease
   99::224     5e-04  28%  296 aa  PSTA_ECOLI RecName: Full=Phosphate transport system permease
  188::240     5e-04  34%  304 aa  PSTA1_MYCTU RecName: Full=Phosphate transport system permease
  183::257     7e-04  39%  324 aa  PSTC2_MYCTU RecName: Full=Phosphate transport system permease
  183::257     7e-04  39%  324 aa  PSTC2_MYCBO RecName: Full=Phosphate transport system permease
   53::236     7e-04  28%  290 aa  MSMF_STRMU RecName: Full=Multiple sugar-binding transport system
   88::244     7e-04  26%  296 aa  MALG_VIBPA RecName: Full=Maltose transport system permease protein
  165::220     9e-04  38%  264 aa  YDCV_SHIFL RecName: Full=Inner membrane ABC transporter permease
  165::220     9e-04  38%  264 aa  YDCV_ECOLI RecName: Full=Inner membrane ABC transporter permease
   22::82      9e-04  33%  119 aa  Y1475_HAEIN RecName: Full=Putative uncharacterized protein HI1475;
    1::305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxHVQAAQFPHDATGESRWVRYGLITVAVLFLGLFLFIPLASVFYEALRKGVD
CYSW_ECOLI      -----------------------------------WGKWFLIGIGMLVSAFILLVPMIYIFVQAFSKGLM
CYSW_ECOL6      -----------------------------------WGKWFLIGIGMLVSAFILLVPMIYIFVQAFSKGLM
CYSW_SYNE7      -----------------------------------------------YVGLIIIIPAANVAVQAFSEGLS
CYSW_SYNY3      -------------------------------------------------------------YEAFHKGVE
CYST_NEPOL      -------------------------------------------LTLMYMLVSLILPIGALLQKSSQESVS
CYST_ZYGCR      --------------------------------------FEFLLIAALHYGLILFLPVTALLLRTKEQSWY
CYST_MESVI      ----------------------------------------------------------------------
CYST_CHLAT      -----------------------------------------LTLSYLFF--MLILPVIALLSRASDELFK
CYST_PROWI      ------------------------------------------------LGNHLFLPLFALFSLILKNSWK
CYST_SALTY      ----------------------------------------------------------------------
CYST_ANTFO      --------------------------------------------------LVLALPIFILLYKAKKQPCS
CYST_MARPO      -------------------------------------KFELVLACALHYGTFILLPIFFLLYKTKQQPWN
CYST_CHLVU      ------------------------------------------------------------WHEVLRKA--
CYST_ECOLI      ----------------------------------------------------------------------
CYST_HELSJ      ----------------------------------------------------------------------
CYST_SYNE7      ----------------------------------------------------------------------
CYST_SYNY3      -------------------------------------------------------------------GLE
NIFC_CLOPA      -------------------------------GESRFSFLEKI-LAPLFLALIYFVMLIFPIISMIRSGGS
MODB_HAEIN      ----------------------------------------------------------------------
WTPB_ARCFU      ---------------------------------------------------------------------D
MODB_MYCTU      ---------------------------HPPTDLPRWVYLPAIAGIV-----FVAMPLVAI---AIRVDWP
MODB_MYCBO      ---------------------------HPPTDLPRWVYLPAIAGIV-----FVAMPLVAI---AIRVDWP
WTPB_PYRFU      ----------------------------------------------------------------------
WTPB_PYRHO      --------------------------------------YALYFFAALFLVVYIVLPIVTIF---AKQALD
YVGM_BACSU      ----------------------------------------------------------------------
WTPB_PYRKO      --------------------------------------YTLYLFAALFLIAYIAVPIAVIFLKQA-SDVE
WTPB_PYRAB      --------------------------------------YTLYLFAALFLIVYIALPIIVIF---TKQALD
MODB_RHOCA      ----------------------------------------------------------------------
MODB_ECOLI      ----------------------------------------------------------------------
MODB_ECO57      ----------------------------------------------------------------------
WTPB_METJA      ----------------------------------------------------------------------
POTB_SHIFL      ----------------------------------------MIVTIVGWLVLFVFLPNLMIIFVKMVFTLD
POTB_ECOLI      ----------------------------------------MIVTIVGWLVLFVFLPNLMIIFVKMVFTLD
POTB_SALTY      ----------------------------------------VIVTIVGWLVLFVFLPNLMIIFVKMVFTLD
POTB_SALTI      ----------------------------------------VIVTIVGWLVLFVFLPNLMIIFVKMVFTLD
PHNU_SALCH      -----------------------------------------------------FWPLSLIVEQALRGGLE
PHNU_SALPA      -----------------------------------------------------FWPLSLIVEQALRGGLE
PHNU_SALTY      -----------------------------------------------------FWPLSLIVEQALRGGLE
PHNU_SALTI      -------------------------------------------------------------------GLE
MODB_AZOVI      ----------------------------------------------------------------------
Y4OQ_RHISN      --------------------------------------------AAAIMLLVLGVPLVYSFYYSLTGGLL
FBPB_ACTPL      -----------------------------------------IIVMLGFWVVFNFALYGSIFYGSVNWGVD
PSTC_XYLFT      ----------------------------------------LLTAAVAFVLIALVSAALSMLWQALQQGVS
PSTC_XYLFA      ----------------------------------------LLTAAVAFVLIALVSAALSMLWQALQQGVS
POTH_ECOLI      ----------------------------------------------------------------------
THIP_ECOLI      ---------------------------------------------------------------------D
PHNV_SALTI      -----------------------------------------VVASVLFI-VFFFLPLAVILMSSLSQRWN
FBPB1_HAEIN     ----------------------------------------------------------SMFYDGDTFAPQ
UGPA_AGRT5      --------------------------------------YLLVAPQIILTVIFFFWPASQALYQSTMRGLA
PSTC_PASMU      ----------------------------------------------------------------------
PHNV_SALPA      -----------------------------------------VVASVLFI-VFFFLPLAVILMSSLSQQWN
FBPB2_HAEIN     -----------------------------------------------------------VILRATEVGLT
YCJO_SHIFL      ---------------------------------------------------FLRLPL-NPNIESTFVGVS
YCJO_ECOLI      ---------------------------------------------------FLRLPL-NPNIESTFVGVS
POTC_MYCGE      ----------------------------------------------------------------------
POTB_HAEIN      -------------------------------------KFQKITVAIIFSWLIFFVLIPNLLVLAVRDGSN
YQGI_BACSU      -------------------------------------------IAAILVGLFSYIIINGVSQLSFQF-IT
PSTC_HAEIN      ----------------------------------------------------------------------
PSTC_RHILO      ----------------------------------------------------------------------
PSTC_METJA      ----------------------------------------------------------------------
UGPA_RHIME      --------------------------------------YLLVAPQIVLTIVFFFWPASQALYQSVIRGFA
YDCU_ECOLI      ----------------------------------------------------------------------
PSTC_SHIFL      ----------------------------------------------------------------------
PSTC_ECOLI      ----------------------------------------------------------------------
PSTC_ECO57      ----------------------------------------------------------------------
GANP_BACSU      -------------------HIISEGYPYVVSGPSLFILIFAVIFPILFSFALAFTPAKLIDWVGFQTFAN
AMYD_THETU      -------------------------------------------------------------------GLK
YQGH_BACSU      ----------------------------------------------------------------------
Y3749_BRUSU     ----------------------------------------------------------------------
THIP_HAEIN      -------------------------------------------VVISFIILFYGGALSSIFALG---GEL
PHNV_SALTY      -----------------------------------------VVASVLFI-VFFFLPLAVILMSSLSQQWN
PHNV_SALCH      -----------------------------------------VVASVLFI-VFFFLPLAVILMSSLSQQWN
Y2990_BRUA2     ----------------------------------------------------------------------
Y2783_BRUAB     ----------------------------------------------------------------------
MALF_VIBVY      ----------------------------------------------------------------------
MALF_VIBVU      ----------------------------------------------------------------------
PSTA_YERPE      ----------------------------------------------------------------------
MALC_STRR6      ----------------------------------------------------------------------
MALC_STRPN      ----------------------------------------------------------------------
PSTA_PASMU      -----------------------------------------LSFLAVFFGLFW---LCWILFTLITKGIE
MALF_YERPE      ----------------------------------------------------------------------
PSTA_MYCLE      ----------------------------------------------------------------------
POTC_MYCPN      ------------------------------------------------------------FGNVLNPNPD
FBPB_SERMA      -------------------------------------------------------PLGFVIGVAFETGWQ
YESP_BACSU      ---------------------------------------GFLCFTVIPMGASLFLSFTSLFTAPKWIGLD
LPLC_BACSU      --------------------------------------------------------------------LD
MALG_YERPE      ----------------------------------------------------------------------
Y1038_PYRHO     -------------------------------------------------------------------GLE
MALG_PHOLL      ----------------------------------------------------------------------
ARAP_BACHD      ------------------------------------VPYVLISPFILSFIVLSFYPTVQAIVMSFQRVLP
PSTA_HAEIN      ---------------------------------------GLSYISVI-IGLFW---LCWILFTLITKGID
PSTA_ECOLI      ----------------------------------------------------------------------
PSTA1_MYCTU     ----------------------------------------------------------------------
PSTC2_MYCTU     ----------------------------------------------------------------------
PSTC2_MYCBO     ----------------------------------------------------------------------
MSMF_STRMU      -------------------------------------------------------------------GIN
MALG_VIBPA      ----------------------------------------------------------------------
YDCV_SHIFL      ----------------------------------------------------------------------
YDCV_ECOLI      ----------------------------------------------------------------------
Y1475_HAEIN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TYLAALTEPDAVSAIKLTLTVAAIAVPLNVVFGVAAAWAIAKFDFRGKNLLITLIDLPFSVSPVISGLIY
CYSW_ECOLI      PVLQNLADPDMLHAIWLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLVY
CYSW_ECOL6      PVLQNLADPDMLHAIWLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLVY
CYSW_SYNE7      GFIKNLGDRNLQEAIRLTLLMGVISVPLNTLFGLAAAFAIARKQFPGKSLLLSVIDLPFSISPVVAGLMI
CYSW_SYNY3      PFIQAMGDRNFQSALQLTVVMALISVPLNTVFGLCAAWVLARNQFPGRALFLSVLDLPFSISPVVAGLMI
CYST_NEPOL      EFVSIATAPVAMSAYAVTLSSALIAALLNGVFGLLIAWVLVRYEFPGRRLLDAAVDLPFALPTSVAGLTL
CYST_ZYGCR      TIFQAVTEPVVLSAYKVTFLTAALAAVINAFLGLILAWILVRYRFPGKNFLDAAVDLPFALPTSVGGLTL
CYST_MESVI      -------EPAAIYAYSITLSMALIASIVNGIFGIFIAWILVRYNFPGKRIVDAAIDLPFALPTSVAGLTL
CYST_CHLAT      DFWQIAAEPVAISTYVVTLMTALFATLINGFFGVIIAWVLVRYNFPGKRIIDAAIDLPFALPTSVAGLTL
CYST_PROWI      DILEKAVDPIAICAYGFTIKMALIAALFNSIFGFLITWVITRYEFKGKKFIDAAVDLPFALPTSVAGLTL
CYST_SALTY      -YWDVVTNPQVVAAYKVTLLAAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPFALPTAVAGLTL
CYST_ANTFO      ILLKVTTEPIILSAYATTFSTAFLAITINALFGLIIAWILVKYEFTGKETLDAIVDLPFALPASVGGLTL
CYST_MARPO      ILLQTALEPVVLSAYGFTFLTALLATIINAIFGLILAWVLVRYEFPGKKLLDATVDLPFALPTSVGGLTL
CYST_CHLVU      ------TDPIAVSAYLLTVQMAFYAALVNSIFGFIITWVLTRYQFWGREFLDAAVDLPFALPTSVAGLTL
CYST_ECOLI      -YWEVITNPQVVAAYKVTLLSAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPFALPTAVAGLTL
CYST_HELSJ      --LEKATDPIAVAAYTLTIKMALYTAIINTIFGFIIAWVLTRYNFSGKRIMDAIVDLPLALPTSVAGLAL
CYST_SYNE7      ------TQPVAVAAYEVTFGLSLAAAALNGVFGVIIAWVLTRYDFPGKKLFDSFIDLPFALPTAVAGLTL
CYST_SYNY3      GFWQIATTPIAISTYNVTFITALAAGLVNGVMGTLVAWVLVRCQFPGKKIVDAMVDLPFALPTSVAGLVL
NIFC_CLOPA      HIIQTLYDQDNIKTIILSFVTSLIALIFTFIIGTPTAFCI---NFVRNKVLSKILDIPVVLPPAVAGIAL
MODB_HAEIN      -----------ISAINLSLSVAVSSMLWSLPLAIFVAWLLARKNFYGKSLITXXXXXXXXXXXXXXXXXX
WTPB_ARCFU      EFLKAASDPAVWKVVLTTYYAALISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIAL
MODB_MYCTU      RFWALITTPSSQTALLLSVKTAAASTVLCVLLGVPMALVLARSRGRXXXXXXXXXXXXXXXXXXXXXXXX
MODB_MYCBO      RFWALITTPSSQTALLLSVKTAAASTVLCVLLGVPMALVLARSRGRXXXXXXXXXXXXXXXXXXXXXXXX
WTPB_PYRFU      -----LVDPLVIESIRNSLFTATVSTLLGILFGVPLGYVLARKEFKGKNFVQALIDTPIVIPHSVVGIML
WTPB_PYRHO      FEMLVKTDPLVLEALRNSXXXXXXXXXISLFFGVPLGYILARKDFRGKNFVQAIIDVPVVIPHSVVGIML
YVGM_BACSU      ---------------------------------LAGAW-MSRASFFGKTALETCFMLPLVLPPTVVGFIL
WTPB_PYRKO      MLVKTLHDPYVIEAIRNSXXXXXXXXXXXXXFGVPLGYVLARKDFPGKSAVQALVDVPIVIPHSVVGIML
WTPB_PYRAB      FRMLVKTDPLVIEALRNSXXXXXXXXXISLLFGVPLGYVLARKDFRGKSLVQAIIDVPIVIPHSVVGIML
MODB_RHOCA      -------------------------------------WWLSRGGGLWKEIVATLVSLPIVLPPTVLGFYL
MODB_ECOLI      -------------------------------FGIFFAWLLVRCTFPGKAXXXXXXXXXXXXXXXXXXXXX
MODB_ECO57      -------------------------------FGIFFAWLLVRCTFPGKAXXXXXXXXXXXXXXXXXXXXX
WTPB_METJA      --LNQLLDKEVIEAFKTTLLAGAVATLIALIFGIPTGYILARYDFKFKSFVEAVLDLPMAIPHSVXXXXX
POTB_SHIFL      NY-TRLLDPLYFEVLLHSLNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRGLIF
POTB_ECOLI      NY-TRLLDPLYFEVLLHSLNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRGLIF
POTB_SALTY      NY-ARLLDPLYFEVLLHSLNMALIATLSCLVLGYPFAWFLAKLPEKIRPLLLFLLIVPFWTNSLIRGLIF
POTB_SALTI      NY-ARLLDPLYFEVLLHSLNMALIATLSCLVLGYPFAWFLAKLPEKIRPLLLFLLIVPFWTNSLIRGLIF
PHNU_SALCH      TFRHVVDSKRFVGALLNTLQIAFFATAGCLLLGSAMSLILVFIPFPGSELIGRVVDTFIALPTFLITLAF
PHNU_SALPA      TFRQVVDSKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLITLAF
PHNU_SALTY      TFRQVVDSKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLITLAF
PHNU_SALTI      TFRQVVDSKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLITLAF
MODB_AZOVI      ----------------------------------------------------------------------
Y4OQ_RHISN      NYTDVLRSSEFWAAIRVTLIYAVVAVSLECALGILFA-VLLNLEFFGRGLFRSLMLIPMVITPAVVGIFW
FBPB_ACTPL      YTLTGLSDGAWPSLIN-TMIYAGIAAPLTALFGLLIAYIVVRKDFQGKKTLEFLTMLCFAVPGTVAGVSY
PSTC_XYLFT      FFYSTEWNPGALTPIYGTIVTALIAMLIAMPVSLGIAFFLTEVAPRWLRTPITAIELLAGIPSIIYGMLF
PSTC_XYLFA      FFYSTEWNPGALTPIYGTIVTALIAMLIAVPVSFGIAFFLTEVAPRWLRRPVTAIELLAGIPSIIYGMLF
POTH_ECOLI      -FLQLTDDPLYFDAYLQSLQVAAISTFCCLLIGYPLAWAVAHSKPSTRNILLLLVILPSWTSFLIRVYAW
THIP_ECOLI      DWVAVWQDSYLWHVVRFSFWQAFLSALLSVIPAIFLARALYRRRFPGRLALLRLCAMTL-ILPVLVAVFG
PHNV_SALTI      GILPSALHGAAWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGI
FBPB1_HAEIN     QVMRILTQSYIVRVITNSLFLSGFVGIVSTVFGLAFALYTTRIARRTAFIGKIFSILPIVTPPFVVGLGV
UGPA_AGRT5      NFSAVLSDESYLNSLKVTVIFSVLTALVSMGLALLLATAADRV-VRGKGFYRTMMIMPYAVAPAVAGMLW
PSTC_PASMU      ----------------------------------------------------------------------
PHNV_SALPA      GILPSALHGAAWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGI
FBPB2_HAEIN     RSVELLFRPRMAELLSNTMLLMVCVTIGAISLGTFCAFLLERYRFFGKAFFEVAMTLPLCIPAFVSGFTW
YCJO_SHIFL      NYVRILSDPGFWHSLWMTVWYTALVVAGSTVLGLAVAMFFNR-EFRLRKTARSLVILSY-VTPSIS-LVF
YCJO_ECOLI      NYVRILSDPGFWHSLWMTVWYTALVVAGSTVLGLAVAMFFNR-EFRLRKTARSLVILSY-VTPSIS-LVF
POTC_MYCGE      -----LGETDFATPLINSIIIGVITVLVSVPIAVISAFALLRTRNALKKTIFGITNFSLATPDIITAISL
POTB_HAEIN      FYAFPITNPLYAQVVWNSLSMSGIATIICLLIGYPFAFMMSKIHPKYRXXXXXXXXXXXWTNSLIRIYGM
YQGI_BACSU      TKSSAIAAGGGIDQLFNSFYILFITMLITIPLGVGGGVFMAEYAPNNKDFIRTCIEVLSSLPSIVIGMFG
PSTC_HAEIN      ----------------------------------------------------------------------
PSTC_RHILO      ----------ALAPIYGTVITSAIAILIAVPLGIGIAIFLTELCPRPLRRPIGMVELLAGIPSIIYGILF
PSTC_METJA      -----------------TATIAVIALPLSICY------AIFVNDYAPKRLKYPLI----VISDIMAGLPT
UGPA_RHIME      NFSAVLSEANYLNSLKVTVIFSXXXXXXXXXXXXXXXXXXDRV-VRGKTFYRTLLIWPYAVAPAVAGMLW
YDCU_ECOLI      --IRALFNPANYDIILRTLTMAVAVTIASAILAFPMAWYMARYTSKMKAFFYIAVMLPMWASYIVKAYAW
PSTC_SHIFL      ----------------------------------------------------------------------
PSTC_ECOLI      ----------------------------------------------------------------------
PSTC_ECO57      ----------------------------------------------------------------------
GANP_BACSU      IFTVDIWRSTFFDVLAWTVVWTLAASTLQVTLGIFLAIIVNQKDLRFKRFFRTILILPWAVPGFVTILIF
AMYD_THETU      NFMTLRDDAEFWNSIIFTAKFAVACIVIINVVGLSLAMLVTRKIF-ARNFMRTAFYLPNLIGGLILGFIW
YQGH_BACSU      ----------------------------------------------GKKVLQPVIELLVGIPSVVYGFIF
Y3749_BRUSU     ---------------------------------------ILNMDFYGRSVARVIIMLPWAVSLTMTAIVW
THIP_HAEIN      QWRAWFTDDYLQHLILFSFGQALLSTVLSIFFGLLLARALFYKPFLGKKWLLKLMSLTFVLPAVIFGLIG
PHNV_SALTY      GILPSALHGAAWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGI
PHNV_SALCH      GILPSALHGAAWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGI
Y2990_BRUA2     ---------------------------------------ILNMDFYGRSVARVIIMLPWAVSLTMTAIFW
Y2783_BRUAB     ---------------------------------------ILNMDFYGRSVARVIIMLPWAVSLTMTAIFW
MALF_VIBVY      -----------ISIFIWTVVFSILTVLLTLMIGLVLASVVQWEELKGRAIYRVLLILPYAVPAFISILIF
MALF_VIBVU      -----------ISIFIWTVVFSILTVLLTLMIGLVLASVVQWEELKGRAIYRVLLILPYAVPAFISILIF
PSTA_YERPE      ----------------LILWATVIGTPLGIMAGIYLA------EYGRKSWLAEVTDILLSAPSIVVGLVY
MALC_STRR6      ------------SVLSWTIIWALAASTLQIVIGIFTAIIANQPFIKGKRIFGVIFLLPWAVPAFITILTF
MALC_STRPN      ------------SVLSWTIIWALAASTLQIVIGIFTAIIANQPFIKGKRIFGVIFLLPWAVPAFITILTF
PSTA_PASMU      LFLEKTPGPNAIIGSTLMITVSTL---IGTPIGILAGTYLAEYGRYSQLTKVTLNDVLLSAPSIVIGLFI
MALF_YERPE      -----------ISIFIWTILFSVMSVTFTVAVGMVLACVVQWDSLKGKAIYRVMLILPYAVPSFISILIF
PSTA_MYCLE      ----------------------------------------------------------------------
POTC_MYCPN      AKSAYLRLGEADFAIPLSVIIGLITVIVSIPIAIMTAFALLRSRQWLNKTVFGIANFSLATPDIITGISL
FBPB_SERMA      TVKALVFRPRVAEXXXXXXXXXXXXXPICAVLGVALAWLTERTTLPGRRLWXXXXXXXXXXXXFVQSYAW
YESP_BACSU      NFKEMFTGDEKYQSLKVTFTYVLAGVPLRLGFALFIA-VILNNAAKGTAIYRTLFYLPSIIGGSVAAIMW
LPLC_BACSU      AYKYVFSTPTFLRSMGVSIFITVVGTAVQLFFTFTMAYPLAKRHVKGRNLLLNLV-------------IF
MALG_YERPE      -----------------SIKIALITAMGIVALSTTCAYAFARMRFRGKSALLKGM-LIFQMFPAVLSLVA
Y1038_PYRHO     NYKNVLLSPDIVNALIHNIVWIAIHLPTTIFLGLGFALLLRKKEVKGSSIIKSIIFLGMVIPMVVGGLII
MALG_PHOLL      -----------------SVKVAFITAVGIVTLSTTCAYAFARMHFRGKSTLLKGM-LIFQMFPAVLSLVA
ARAP_BACHD      SEVSRILNPTFFTALQNTTTTVVILVSIPMLFAVLLNSKVVKF----RILFRTALFLPALTSVIVAGMVF
PSTA_HAEIN      LFTQSTPAPNELNALIGSFFIVGAGTLIGTPIGVLAGTYLAEYGRYSRFAQITLNDILLSAPSIIIGLVY
PSTA_ECOLI      --------------------------PLGIMAGIYLA------EYGRKSWLAEVIDILLSAPSIVVGLVY
PSTA1_MYCTU     ----------------------------------------------------------------------
PSTC2_MYCTU     ----------------------------------------------------------------------
PSTC2_MYCBO     ----------------------------------------------------------------------
MSMF_STRMU      NYKILMTDGKFMKAIGFTLVLTLXXXXXXXXXXXXXXRAL-NAKIKGK----TFFRAWFFFPAVLSGLTV
MALG_VIBPA      -----------------SVKVGGISAILIVALSTTSAYAFARMKFKGKNTILKAMMIFQMFPXXXXXXXX
YDCV_SHIFL      ----------------------------------------------------------------------
YDCV_ECOLI      ----------------------------------------------------------------------
Y1475_HAEIN     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VLMFGAQGWFGPWLEAHDIKIMFAVPGIVLATIFVTFPFVARELIPLMQAQGSEEEEAAIVLGASGWQTF
CYSW_ECOLI      LLFYGSNGPLGGWLDEHNLQIMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAAILLGASGWQMF
CYSW_ECOL6      LLFYGSNGPLGGWLDEHNLQIMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAAILLGASGWQMF
CYSW_SYNE7      VLLYGRNGWLGPLLESNDIKIIFAWPGMALATIFVSMPFVAREVIPNLEEIGTDAEEAASTLGANGWQTF
CYSW_SYNY3      VLLYGKNGWIGSWFASWDIQIIFSVPGMAIATIFVTLPFVAREVIPVLEELGPEQEEAARTLGAKDWQIF
CYST_NEPOL      ATVYSDQGWIGTWLSSLNIQVAFTRLGVMLAMLFVSFPFVVRTLQPVLQDMERELEEAAWSLGASPFNTF
CYST_ZYGCR      MTVYSDKGWMGPICSWLGIKIAFSRLGVLIAMMFVSLPFIVRTIQPVLQSMEEETEEAAWCIGASPWTTF
CYST_MESVI      ATVYSEKGWIGHFLQSLSIKVVFTKLGVGVAMIFVSFPFVVRTLQPVLQDIEKELEEAAWSLGASSWTTF
CYST_CHLAT      ATVYSDQGWIGHLFESIGIKVAFTRVGVAVAMIFVSFPFVVRTLQPVLVEIDQELEEAAWSLGASTWRTF
CYST_PROWI      ATVYGNQGWVGRFLKMGNLQIIYTKFGVLLAMIFVSFPFVIRSLQPVLQGLDHGLEEAAWCLGASSFQTF
CYST_SALTY      ASLFSVNGFYGQFLAQFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVLEELGPEYEEAAQTLGATRLQSF
CYST_ANTFO      MTVYSDRGWMGPICSGLGLKIVFSRLGVPMATIFVSLPFVVRTIQPVLQDVEEELEEAAWCIGASPWTTF
CYST_MARPO      MTVFNDKGWIKPICSWLNIKIVFNPIGVLLAMIFVSLPFVVRTIQPVLQNMEEDLEEAAWCLGASPWTTF
CYST_CHLVU      ATVYGDQGWIGSLFNLFGFQIVFTKIGVLLAMIFVSFPFVIRTLQPVLQEMEKSLEEAAWSLGASSWETF
CYST_ECOLI      ASLFSVNGFYGEWLAKFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVXXXXXXXXXXXXXTLGATRWQSF
CYST_HELSJ      STVFGRNGLFGHILDFYNYEIIYTKRGILLAMIFVSFPFSVRAIQPILKEINKEEEEAAWSLGSGPLETF
CYST_SYNE7      ATVYSDKGWIGQFIAPFGVQIAFTRWGVLLAMVFISLPFVVRTXXXXXXXXXXXXXXXXXXXXXXXXXTF
CYST_SYNY3      ATLYSQTGWVGRFFAPFGIQIAFSRLGVFVAMVFISLPFIVRTLQPVLQXXXXXXXXXXWSLGATEFQTF
NIFC_CLOPA      LLAFGKNGVVGNFLSNHGINVIFTSTAVIIAQFFVSSALYVRVLRDSVKSVPIELFEVSYVLGAGKIETI
MODB_HAEIN      XXAMGRNGFIGKYLQWFGLSFGFSWKGAVLSSAVVAFPLVVRAIRLSLENIDIKLEQAAQTLGASAWRVF
WTPB_ARCFU      LVVFGSSGLIGSF---SPLKFVDALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVF
MODB_MYCTU      XYAFGRLGLIGRYLEAAGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEVVAATLGARPGTVW
MODB_MYCBO      XYAFGRLGLIGRYLEAAGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEVVAATLGARPGTVW
WTPB_PYRFU      LVTFSD-------------AILDNYKGIVAVMLFVSSPFIVNSARDGFLSVDEKLEYVARTLGASGLRTF
WTPB_PYRHO      LVTFSNA-------------ILDSYKGIIAAMLFVSAPFAINSARDGFLAVDEKLEHVARTLGASRIRTF
YVGM_BACSU      IVIFGKHSFIGQAIEW-----IFQQP--VIFTWWXXXXXXXXXXFPLMYQSAKDIQGAAMVDGASRWKVF
WTPB_PYRKO      LVTFSNS-------------ILDSYKGIVAAMLFVSAPFTINAARDGFLAVDEKLEAVARTLGASRWRAF
WTPB_PYRAB      LVTFSNA-------------ILDSYKGIIAAMLFVSAPFAINSARDGFLAVDEKLEHVARTLGASKLRTF
MODB_RHOCA      LIAMGPNS---PLTDLLGFKLSFTFAGLVVGSVIYSLPFVVNPIRNAFVAMGPRPMEVAATLRASPLDAF
MODB_ECOLI      XXSMGRRGFIGERLDWFGITFAFSWRGAVLAAAVMSFPLMVRAIRLALEGVDVKLEQAARTLGAGRWRVF
MODB_ECO57      XXSMGRRGFIGERLDWFGITFAFSWRGAVLAAAVMSFPLMVRAIRLALEGVDVKLEQAARTLGAGRWRVF
WTPB_METJA      XXXXXXXXXXN-FIGRYVVDNFW---GIVTVYLFVGIPFMVNSIRDGFLSVDEEIEYVSRTLGASKIRTF
POTB_SHIFL      LSTKGYLNEFLLWLGVIDIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKLQTF
POTB_ECOLI      LSTKGYLNEFLLWLGVIDIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKLQTF
POTB_SALTY      LSTKGYLNEFLLWLGVIDIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKMQTF
POTB_SALTI      LSTKGYLNEFLLWLGVIDIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKMQTF
PHNU_SALCH      TFIYGSAGLLNGTLELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVI
PHNU_SALPA      TFIYGSAGLLNGALELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVI
PHNU_SALTY      TFIYGSAGLLNGTLELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVI
PHNU_SALTI      TFIYGSAGLLNGALELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVI
MODB_AZOVI      ----------------------------VVASVFYSLPFVVQPLQNAFEAIGERPLEVASTLRAGPWDTF
Y4OQ_RHISN      KLLYEQDGTLGPWLS-----LTVALASVIIVDVWQSTPFFTLIILAGLQSLDRDTVSAAQADGANALQVF
FBPB_ACTPL      ILAFNDAPMYXXXXXXXXXXSM----------VMRDLPIGMRAAIAGLGQLDKSLDEASLSLKGSSLKTI
PSTC_XYLFT      VLVPVMTDYITPFLNDHIIGTLFQGPPLGIGTLTAGFPFISSMMREVFLTVPTQLKESAYALGSTKWEVS
PSTC_XYLFA      VLVPVMTDYITPFLNDHIIGTLFQGPPLGIGTLSAGFPFISSIMREVFLTVPTQLKESAYALGSTKWEVS
POTH_ECOLI      MGILGVLNNFLLWLGVIDLTILHTNLAVYIGIVYAYVPFMVLPIYTALIRIDYSLVEAALDLGARPLKTF
THIP_ECOLI      ILVYGRQGWLATLCQSLGLEWTFSLQGILLAHVFFNLPMASRLLLQALENIPGEQRQLAAQLGMRSWHFF
PHNV_SALTI      LVAFSQ----GP-LQMNGTLWIVLTAHFVLISAF-TFSNVSTGLARI----SADIENVASSLGASPWYRL
FBPB1_HAEIN     TLMLGRSGYVTEFLSTNSHNWLYGFNGIAIAQILAFAPISFMILDGALKSVHPSIEEASYTLRANRYQTF
UGPA_AGRT5      LFMFNAMGTLSYILRRNGIMWDPLLDGVVAAAAWKQISYNFLFFVAGLQAIPKSLLEAASIDGARGSRRF
PSTC_PASMU      --------------------------GLVLAIMII--PFIAAVMRDVFTIVPAILKESAYGLGSTTWEVM
PHNV_SALPA      LVAFSQ----GP-LQMNGTLWIVLTAHFVLISAF-TFSNVSTGLARI----SADIENVASSLGASPWYRL
FBPB2_HAEIN     ISL------------TFRVEVFWGTIGIMTLS---SFPLAYLPVSAILKRLDRSLEEVSLSLGKSPVYTF
YCJO_SHIFL      AWKYMFNNGYGDLLHLYEAPLWFDNPGVVLFAIWRYFPYAFISFLAILQTIDKSLYEAAEMDGANAWQRF
YCJO_ECOLI      AWKYMFNNGYGDLLHLYEAPLWFDNPGVVLFAIWRYFPYAFISFLAILQTIDKSLYEAAEMDGANAWQRF
POTC_MYCGE      VLLFA-----NTWLSFNQQLGFFT---IITSHISFSVPYALILIYPKIQKLNPNLILASQDLGYSPLKTF
POTB_HAEIN      KVFLGVKGILNTMLISAPIRILNTEIAVIIGLVYLLLPFMILPLYSAIEKLDNRLLEAARDLGANTFQRF
YQGI_BACSU      LLMFNLTGWG------------YTIIGGALALTVFNLPVMVRVTEDAIRSVPKDLKEASLALGVSRWHTV
PSTC_HAEIN      --------------------------GLVLAIMII--PFIASVMRDVFSIVPPMLKEGAYGLGATTWEVV
PSTC_RHILO      VLAPFLQTTVQPLIISHGINGLFAGPGIGLLTAIMILPFITSITKDVFDTVPSVLKESAYGIGCTTWEVT
PSTC_METJA      II-YGIWGAFVPLLRDHIMKFLYEIPGILLG-IMVT-PFAAAIIREAYAMIPSVYKEGLVALGATRYETT
UGPA_RHIME      LFMFNAMGTFAYMLRRNGLNGNHAMILIVVAAAWKQISYNFLFFVAGLQAIPKSLIEAAAIDGARGTRRF
YDCU_ECOLI      TLLLAKDGWFLQHLGLEPLLTAFAVGGNTLSTLYIWLPFMILPVQAALERLPPSLLQASADLGARPRQTF
PSTC_SHIFL      -------------------------------------PYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVI
PSTC_ECOLI      -------------------------------------PYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVI
PSTC_ECO57      -------------------------------------PYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVI
GANP_BACSU      AGLFNDS--FGAM--NHDILAFFGIDALILMQGWLGFPYIFLVSTGVLQSIPDDLYEAATIDGASVFSKL
AMYD_THETU      NFIFVDVGWLGGWLSTTNTGFW----GLVIVTSWQMIGYVMVIYIAYIESIPTDLIEASKIDGANSWQQF
YQGH_BACSU      IAQFKSSG------TGHSL-----LAGTIVLSVMI-LPTITSISADAMASLPKSLREGSYALGATRWQTI
Y3749_BRUSU     RALNGESGMLNSALHGLDTNIQWAFPMQILVGILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQF
THIP_HAEIN      I--YGSSGWFGMSWQGH----IYGLSGILIAHLFFNIP--------------------------------
PHNV_SALTY      LVAFSQ----GP-LQMNGTLWIVLTAHFVLISAF-TFSNVSTGLARI----SADIENVASSLGASPWYRL
PHNV_SALCH      LVAFSQ----GP-LQMNGTLWIVLTAHFVLISAF-TFSNVSTGLARI----SADIENVASSLGASPWYRL
Y2990_BRUA2     RALNGESGMLNSALHGLDTNIQWAFPMQILVGILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQF
Y2783_BRUAB     RALNGESGMLNSALHGLDTNIQWAFPMQILVGILVTVPFTTTIFLGGLSSIPDDLYEASSLEGASLWQQF
MALF_VIBVY      KGLFNSPSWFSDPIMAKSM--------VLIVNTWLGFPYMMILCMGLLKAIPEDLYEASAIDGANFVQNF
MALF_VIBVU      KGLFNSPSWFSDPIMAKSM--------VLIVNTWLGFPYMMILCMGLLKAIPEDLYEASAIDGANFVQNF
PSTA_YERPE      TIVVAKMEHFSGWAG-------------VIALALLQVPIVIRTTENMLKLVPDSLREAAYALGTPKWRMI
MALC_STRR6      SNMFNDSAKFLPFLDGALIPWKTDPTWTKIALIMMQFPYIYVLTLGILQSIPNDLYEAAYIDGANAWQKF
MALC_STRPN      SNMFNDSAKFLPFLDGALIPWKTDPTWTKIALIMMQFPYIYVLTLGILQSIPNDLYEAAYIDGANAWQKF
PSTA_PASMU      YAIYVSQGWAGAF-----------------ALAIIIIPVVVRTTDNMLNLVPNNLREAAASLGCPQWRVI
MALF_YERPE      KGLFNQSAWFSDPITAKSM--------ILIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNF
PSTA_MYCLE      -----------------------------------------------------ELREACYALGIPKWKTI
POTC_MYCPN      VLLFA-----NTWLSFNQ---QLGXXXXXXXXXXXXVPYALVLIYPKMQKLNRNLILASQDLGYSPIATF
FBPB_SERMA      ISL---------------VPSMHGLGAGVFISVLAYFPFIYLPAAAVLRRLDPGIEDVATSLGSRPPAVF
YESP_BACSU      RNIFGNDGVINALLVGIDQKILYQNPTSALWTLILVWQFGSSMLIFLAGLKNSSYLEAASVDGANRVQRF
LPLC_BACSU      SMLFSG-GMIPTYLVVKSLGLLDTYWALILPMAINPFNLII--IKNFFQQLPRELEESAKIDGCSEIGVF
MALG_YERPE      LYLFDRIGQYMPFLNTHGGVIFAYMGGIALHTIKGYFETIDNSL-----------EEAAALDGATPWQAF
Y1038_PYRHO     RFLFGVIPAFFKLIGIEKLAITWAYPQTALFSVILGSIWIWTGFSMLMYSAGKDYYEAALIDGANKFQIF
MALG_PHOLL      LYLFDRLGEYVPFLNTHGGVIFAYLGGIALHVWTIKGYFETID--------GSLEEAAALD-GATPWQAF
ARAP_BACHD      RLMFSESNWIG--LESVEWRYN-AWSGMFLMVVLASWRWMGINILYFLAALQNELYEAADIDGANVVQKF
PSTA_HAEIN      SLYVSKIEHFSGWXXXXXXXXXX-------------IPIVVRTTDNMLLLVPNNLREAAAALGCSQWQVI
PSTA_ECOLI      TIVVAQMEHFSGWAG-------------VIALALLQVPIVIRTTENMLKLVPYSLREAAYALGTPKWKMI
PSTA1_MYCTU     -----------------------------------------------------ELREASYALGVPKWKTI
PSTC2_MYCTU     --------------------------GIVLSVMILPITSISREVFPLIQI------EAALALGATKWEVV
PSTC2_MYCBO     --------------------------GIVLSVMILPITSISREVFPLIQI------EAALALGATKWEVV
MSMF_STRMU      SLIFKQVFNYGLPAVGSALGIKFTANGAVIASIFVLWQGVAMPIILFLQSIPSEIVEAAAIDGADSKQTF
MALG_VIBPA      XXXFDKLGQYIPFLNTHGGLIFAYLGGIALHVWTIKGYF---------ESIDSSLEEAAALDGATPWQAF
YDCV_SHIFL      --------------------------------------------------------EASMDLGANGWQTF
YDCV_ECOLI      --------------------------------------------------------EASMDLGANGWQTF
Y1475_HAEIN     ---------------------------------------------------------ASYTLELSPFKTL


                         .         .         .         +         .         .         .:280
query           WHVTLPNIRWGLLYGVILCNARAMGEFGAVSVVSGHIRGLTNTMPLHVEILYNEYNXXXXXXXXXXXXXX
CYSW_ECOLI      RRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIELLEQDYN--------------
CYSW_ECOL6      RRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIELLEQDYN--------------
CYSW_SYNE7      WRVTLPSIKWSMLYGVVLTTARALGEFGAVSVVSGSITGKTQTLPLFVEEAYKQYQTTLSYTAALLLGGI
CYSW_SYNY3      WRVTLPNIRWGLLYGVLLTNARAMGEFGAVAVVSGSILGKTSTLPIFVEQEYKNY---------------
CYST_NEPOL      LRVLCPPLMPAMMTGIALAFSRAVGEYGSVVIVSGNI---------------------------------
CYST_ZYGCR      WNVLFPPMISPLLTGTALGFSRAIGEYGSIVLVASNI---------------------------------
CYST_MESVI      WKVIFPSLIPSLLTGIALAFSRAVGEYGSVVIIASNIPFKDLTAPVLIFQKLEQYD--------------
CYST_CHLAT      WRVIFPPLTPAIVTGVALAFSRAIGEYGSVVIVASNIPFKDLTAPVLIFQRLEQYD--------------
CYST_PROWI      LRVIFPTLVPALVTGFTLSFSRALGEFGSVVMISSNL---------------------------------
CYST_SALTY      RKVVLPELSPALIAGVALSFTRSLGEFGAVIFIAGNIAWKTEVTSLMIFVRLQEFD--------------
CYST_ANTFO      CQIXXXXXXXXXXXGTALGFSRAIGEYGSIVLIACNI---------------------------------
CYST_MARPO      WHIXXXXXXXXXXXXXXXXXXRALGEYGSIVLIASNI---------------------------------
CYST_CHLVU      RKVILPTLWPALFTGFTLSFSRALGEFGSIVMISSNL---------------------------------
CYST_ECOLI      CKVVLPELSPALVAGVALSFTRSLGEFGAVIFIAGNIAWKTEVTSLMIFVRLQEFD--------------
CYST_HELSJ      KRFIFPIILPAILNGFTLTFSRSLSEFGSIVMVAGNL---------------------------------
CYST_SYNE7      WRVILPPILPGVLAGVAQGFSRAVGEFGSVVIISGNL---------------------------------
CYST_SYNY3      WRVIFPPLIPPILTGIALGFSRAVGEYGSVVLIASNI---------------------------------
NIFC_CLOPA      IKIMIPMLKKSIVSGLILAWIRSLGEFGATLMFAGNIIGKTRTIPLQI----------------------
MODB_HAEIN      FTITLPLSLPGVLAGLVLGFARSLGEFGATITFVSNIAGETQTIPL------------------------
WTPB_ARCFU      FTVSLPLSVRHIVAGAIMSWARGISEFGAVVVIA------------------------------------
MODB_MYCTU      WRVTXXXXXXXXXXXXXXAFARSLGEFGATLTFAGSRQGVTRTLPLEI----------------------
MODB_MYCBO      WRVTXXXXXXXXXXXXXXAFARSLGEFGATLTFAGSRQGVTRTLPLEI----------------------
WTPB_PYRFU      FSVTLPNAIHSIASGAIMAWARAISEVGAILIVAYY--------PKTAQVLIMEY---------------
WTPB_PYRHO      FSISLPMALPSIASGGIMAWARSMSEVGAILIVAYY--------PKTAQILVMEY---------------
YVGM_BACSU      IHISVPLAYPSLLTGSILSLARALGEFGATLMFAGNIPGVTQTLPTAIYVALDSGN--------------
WTPB_PYRKO      LSISLPMAFPSIASGAIMTWARAISEVGAILIVA------------------------------------
WTPB_PYRAB      FSISLPIALPSIASGAIMAWARGISEVGAILIVAYY--------PKTAQVLVMEY---------------
MODB_RHOCA      FTVALPQAAPGLITGAILGFAHTVGEFGVVLMIGGGIPGRTKVLSVTI----------------------
MODB_ECOLI      FTITLPLTLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRTIP-------------------------
MODB_ECO57      FTITLPLTLPGIIVGTVLAFARSLGEFGATITFVSNIPGETRTIP-------------------------
WTPB_METJA      FEISLPLIKNNIISGIILSFARGISEVGAILIIA------------------------------------
POTB_SHIFL      IRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGG-----------------------------------
POTB_ECOLI      IRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGG-----------------------------------
POTB_SALTY      IRIIIPLTMPGIVAGCLLVMLPAMGLFYVSDLMGG-----------------------------------
POTB_SALTI      IRIIIPLTMPGIVAGCLLVMLPAMGLFYVSDLMGG-----------------------------------
PHNU_SALCH      GQVIFPAALPALMAGGSLCLLLTTNEFGIVLFIGA--KGV-NTLPMMVAILESDY---------------
PHNU_SALPA      GQVIFPAALPALMAGGSLCLLLTTNEFGIVLFIGA--KGV-NTLPMMVAILESDYT-----VACMIALIN
PHNU_SALTY      GQVIFPAALPALMAGGSLCLLLTTNEFGIVLFIGA--KGV-NTLPMMVAILESDY---------------
PHNU_SALTI      GQVIFPAALPALMASGSLCLLLTTNEFGIVLFIGA--KGV-NTLPMMVAILESDYT-----VACMIALIN
MODB_AZOVI      FTVVVPLARPGFITAAILGFAHTVGEFGVVLMIGGNIPEKTRTVAVQI----------------------
Y4OQ_RHISN      RYLTLPHL--------------------------------------------------------------
FBPB_ACTPL      WFIVFPLLKPALLSALVTSFVRAMTTVSAI----------------------------------------
PSTC_XYLFT      WNIVLPYTRSAVIGGMFLGLGRALGETMAVAFVIGN----------------------------------
PSTC_XYLFA      WNIVLPYTRSAVIGGMFLGLGRALGETMAVAFVIGN----------------------------------
POTH_ECOLI      FTVIVPLTKGGIIAGSMLVFIPAVGEFVIPELLGG-----------------------------------
THIP_ECOLI      RFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQATTIELAIYQALSYD-----------------
PHNV_SALTI      RHVTLPLLMPWMVSELALSLSLSMGELGATVMI-------------------------------------
FBPB1_HAEIN     YQIIFPLLRPALANSFLIVFIQSLADFSNPLVLGG-----------------------------------
UGPA_AGRT5      WTI-------------------------------------------------------------------
PSTC_PASMU      WKVVLPYTKTGVVGGIMLGLGRALGETMAVTFVIGN----------------------------------
PHNV_SALPA      RHVTLPLLMPWMVXXXXXXXXXXMGELGATVMI-------------------------------------
FBPB2_HAEIN     WYAISPQLKPAIGSSILLIALHMLVEFGAVSILN------------------------------------
YCJO_SHIFL      RIVTLPAI--------------------------------------------------------------
YCJO_ECOLI      RIVTLPAI--------------------------------------------------------------
POTC_MYCGE      FHITLPYLMPSIFSAVLVVFATSFDDYVITSLVQGSVKTIATEL--------------------------
POTB_HAEIN      FRVILPLTMPGIIAGCLLVLLPAMGMFYVADLLGG-----------------------------------
YQGI_BACSU      KTVLIPSAIPSIITGAILASGRVFGE--------------------------------------------
PSTC_HAEIN      RQVIVPHTRIGLVGSVMLGLGRALGETMAITFIIGNSFQLPNSL--------------------------
PSTC_RHILO      RRVVIPYTRIGIMGGVMLALGRALGETMAVTFVIGNAHRISTSL--------------------------
PSTC_METJA      -KVLIKYIRPAIISGLILAFGRALGETVAVSLVIGNSFNLT-----------------------------
UGPA_RHIME      WTI-------------------------------------------------------------------
YDCU_ECOLI      RYVVLPLAIPGIAAGSIFTFSLTLGDF-------------------------------------------
PSTC_SHIFL      WRIVLPFTKNGVIGGIMLGLGRALGETMAVTFIIGN----------------------------------
PSTC_ECOLI      WRIVLPFTKNGVIGGIMLGLGRALGETMAVTFIIGN----------------------------------
PSTC_ECO57      WRIVLPFTKNGVIGGIMLGLGRALGETMAVTFIIGN----------------------------------
GANP_BACSU      RYITLPMV--------------------------------------------------------------
AMYD_THETU      RNVVFPLI--------------------------------------------------------------
YQGH_BACSU      RKVLVPAAFPTLMTAVVLGMARAFGEALAVQMVIGNTRVL------------------------------
Y3749_BRUSU     REITFPLLKPFVNIAIVLNTIYVFNSFPIIWVMTQ--GGPANSTDILVTHLY------------------
THIP_HAEIN      ----------------------------------------------------------------------
PHNV_SALTY      RHVTXXXXXXXXXXXXXXXXXXXXGELGATMMI-------------------------------------
PHNV_SALCH      RHVTXXXXXXXXXXXXXXXXXXXXGELGATMMI-------------------------------------
Y2990_BRUA2     REITFPLLKPFVNIAIVLNTIYVFNSFPIIWVMTGRPANSTDILVTHL----------------------
Y2783_BRUAB     REITFPLLKPFVNIAIVLNTIYVFNSFPIIWVMTGRPANSTDILVTHL----------------------
MALF_VIBVY      TRVTLP----------------------------------------------------------------
MALF_VIBVU      TRVTLP----------------------------------------------------------------
PSTA_YERPE      SAITLKASVSGILTGILLAIARIAGE--------------------------------------------
MALC_STRR6      RNITFPMI--------------------------------------------------------------
MALC_STRPN      RNITFPMI--------------------------------------------------------------
PSTA_PASMU      TMICYRSARAGILTGVLLSIARISGE--------------------------------------------
MALF_YERPE      FRITFP----------------------------------------------------------------
PSTA_MYCLE      VRIVFPIATPGIISGVLLSIARVIGETAPVLVLVGYSRSI------------------------------
POTC_MYCPN      FHITLPYLLPSILSAILVVFATSFDDYVITSLVQGSVKTVASEL--------------------------
FBPB_SERMA      FRVVLPQLKLAVCGGSLLIALHLLAEYGLYAMI-------------------------------------
YESP_BACSU      FKITLPILTPIIFFNLVMQTISAFMTFTPAYIISKGEGG-----PLDGTLLYSLY---------------
LPLC_BACSU      WRIALP----------------------------------------------------------------
MALG_YERPE      RLVLLP----------------------------------------------------------------
Y1038_PYRHO     RFVIWPLLR-------------------------------------------------------------
MALG_PHOLL      RMVLLP----------------------------------------------------------------
ARAP_BACHD      FYVTLPFLK-------------------------------------------------------------
PSTA_HAEIN      MMICYRAAKSGILTGVLLAVARISGE--------------------------------------------
PSTA_ECOLI      SAITLKASVSGIMTGILLAIARIAGE--------------------------------------------
PSTA1_MYCTU     VRIVAPIAMPGIVSGILLSIARVVGETAPVLVLVGY----------------------------------
PSTC2_MYCTU     RMTVLPYGRSGVVAASMLGLGRALGETVAVLVI-------------------------------------
PSTC2_MYCBO     RMTVLPYGRSGVVAASMLGLGRALGETVAVLVI-------------------------------------
MSMF_STRMU      WSVELPYLLPSISMVFIMALKAGLTAFDQIFALTG-----------------------------------
MALG_VIBPA      RLVLLPLSVPILAVVFILSFIMVIGEVPVASLLLSDVDSYT-----------------------------
YDCV_SHIFL      RYVVLPNXXXXXXXXXXXXXXXXXDEIIVTTFTAGHER----TLPL------------------------
YDCV_ECOLI      RYVVLPNXXXXXXXXXXXXXXXXXDEIIVTTFTAGHER----TLPL------------------------
Y1475_HAEIN     IKIEIPMCWKPLVCASVLAWSRAIGEFGATLMLAGATRFKTETLPMAV----------------------


                         .         *         .         .         .         .         +:350
query           XXXXXGIKTLVEIRASREQLEGQPx
CYSW_ECOLI      -------------------------
CYSW_ECOL6      -------------------------
CYSW_SYNE7      SLVTLVLKALLEARTGRQ-------
CYSW_SYNY3      -------------------------
CYST_NEPOL      -------------------------
CYST_ZYGCR      -------------------------
CYST_MESVI      -------------------------
CYST_CHLAT      -------------------------
CYST_PROWI      -------------------------
CYST_SALTY      -------------------------
CYST_ANTFO      -------------------------
CYST_MARPO      -------------------------
CYST_CHLVU      -------------------------
CYST_ECOLI      -------------------------
CYST_HELSJ      -------------------------
CYST_SYNE7      -------------------------
CYST_SYNY3      -------------------------
NIFC_CLOPA      -------------------------
MODB_HAEIN      -------------------------
WTPB_ARCFU      -------------------------
MODB_MYCTU      -------------------------
MODB_MYCBO      -------------------------
WTPB_PYRFU      -------------------------
WTPB_PYRHO      -------------------------
YVGM_BACSU      -------------------------
WTPB_PYRKO      -------------------------
WTPB_PYRAB      -------------------------
MODB_RHOCA      -------------------------
MODB_ECOLI      -------------------------
MODB_ECO57      -------------------------
WTPB_METJA      -------------------------
POTB_SHIFL      -------------------------
POTB_ECOLI      -------------------------
POTB_SALTY      -------------------------
POTB_SALTI      -------------------------
PHNU_SALCH      -------------------------
PHNU_SALPA      IVLSLGLFSLYRLAASRTGVRSQP-
PHNU_SALTY      -------------------------
PHNU_SALTI      IVLSLGLFSLYRLAASRTGVRSQP-
MODB_AZOVI      -------------------------
Y4OQ_RHISN      -------------------------
FBPB_ACTPL      -------------------------
PSTC_XYLFT      -------------------------
PSTC_XYLFA      -------------------------
POTH_ECOLI      -------------------------
THIP_ECOLI      -------------------------
PHNV_SALTI      -------------------------
FBPB1_HAEIN     -------------------------
UGPA_AGRT5      -------------------------
PSTC_PASMU      -------------------------
PHNV_SALPA      -------------------------
FBPB2_HAEIN     -------------------------
YCJO_SHIFL      -------------------------
YCJO_ECOLI      -------------------------
POTC_MYCGE      -------------------------
POTB_HAEIN      -------------------------
YQGI_BACSU      -------------------------
PSTC_HAEIN      -------------------------
PSTC_RHILO      -------------------------
PSTC_METJA      -------------------------
UGPA_RHIME      -------------------------
YDCU_ECOLI      -------------------------
PSTC_SHIFL      -------------------------
PSTC_ECOLI      -------------------------
PSTC_ECO57      -------------------------
GANP_BACSU      -------------------------
AMYD_THETU      -------------------------
YQGH_BACSU      -------------------------
Y3749_BRUSU     -------------------------
THIP_HAEIN      -------------------------
PHNV_SALTY      -------------------------
PHNV_SALCH      -------------------------
Y2990_BRUA2     -------------------------
Y2783_BRUAB     -------------------------
MALF_VIBVY      -------------------------
MALF_VIBVU      -------------------------
PSTA_YERPE      -------------------------
MALC_STRR6      -------------------------
MALC_STRPN      -------------------------
PSTA_PASMU      -------------------------
MALF_YERPE      -------------------------
PSTA_MYCLE      -------------------------
POTC_MYCPN      -------------------------
FBPB_SERMA      -------------------------
YESP_BACSU      -------------------------
LPLC_BACSU      -------------------------
MALG_YERPE      -------------------------
Y1038_PYRHO     -------------------------
MALG_PHOLL      -------------------------
ARAP_BACHD      -------------------------
PSTA_HAEIN      -------------------------
PSTA_ECOLI      -------------------------
PSTA1_MYCTU     -------------------------
PSTC2_MYCTU     -------------------------
PSTC2_MYCBO     -------------------------
MSMF_STRMU      -------------------------
MALG_VIBPA      -------------------------
YDCV_SHIFL      -------------------------
YDCV_ECOLI      -------------------------
Y1475_HAEIN     -------------------------