[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08451.1

[Show Plain Result]


## Summary of Sequence Search
    1::139
  142::255     4e-11  32%  505 aa  FIXL_RHIME RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
  184::310     6e-10  30%  735 aa  Y3085_AZOC5 RecName: Full=Uncharacterized protein AZC_3085;
  628::740     4e-09  40% 1130 aa  PHYB_SOLTU RecName: Full=Phytochrome B;
  140::257     4e-09  25%  504 aa  FIXL_AZOC5 RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
   18::126     4e-09  29%  799 aa  DOS_ECOLI RecName: Full=Heme-regulated cyclic di-GMP, cyclic AMP
  630::742     6e-08  40% 1132 aa  PHYB_TOBAC RecName: Full=Phytochrome B;
  618::735     3e-07  24% 1123 aa  PHYA_SOLTU RecName: Full=Phytochrome A;
  668::780     5e-07  35% 1171 aa  PHYB_ORYSJ RecName: Full=Phytochrome B;
  668::780     5e-07  35% 1171 aa  PHYB_ORYSI RecName: Full=Phytochrome B;
  675::787     6e-07  35% 1178 aa  PHYB_SORBI RecName: Full=Phytochrome B;
  621::738     6e-07  22% 1128 aa  PHYA_ORYSJ RecName: Full=Phytochrome A;
  621::738     6e-07  22% 1128 aa  PHYA_ORYSI RecName: Full=Phytochrome A;
  663::775     8e-07  39% 1164 aa  PHYD_ARATH RecName: Full=Phytochrome D;
  659::773     8e-07  34% 1172 aa  PHYB_ARATH RecName: Full=Phytochrome B;
  621::738     1e-06  30% 1137 aa  PHYC_ORYSJ RecName: Full=Phytochrome C;
  621::738     1e-06  30% 1137 aa  PHYC_ORYSI RecName: Full=Phytochrome C;
  629::741     1e-06  36% 1131 aa  PHYB1_SOLLC RecName: Full=Phytochrome B1;
   14::128     1e-06  33%  417 aa  BDLA_PSEAE RecName: Full=Biofilm dispersion protein bdlA;AltName:
  630::747     2e-06  27% 1136 aa  PHY_PICAB RecName: Full=Phytochrome;
  619::736     2e-06  23% 1122 aa  PHYA_ARATH RecName: Full=Phytochrome A;AltName: Full=Protein FAR
  618::735     2e-06  24% 1124 aa  PHYA1_TOBAC RecName: Full=Phytochrome A1;
  267::383     2e-06  29%  608 aa  ATOS_ECOLI RecName: Full=Signal transduction histidine-protein
  619::736     2e-06  22% 1129 aa  PHYA4_AVESA RecName: Full=Phytochrome A type 4;         Short=AP4;
  666::717     2e-06  38% 1035 aa  PDHS_BRUSU RecName: Full=Cell-division control histidine kinase
  666::717     2e-06  38% 1035 aa  PDHS_BRUSI RecName: Full=Cell-division control histidine kinase
  666::717     2e-06  38% 1035 aa  PDHS_BRUO2 RecName: Full=Cell-division control histidine kinase
  666::717     2e-06  38% 1035 aa  PDHS_BRUME RecName: Full=Cell-division control histidine kinase
  666::717     2e-06  38% 1035 aa  PDHS_BRUC2 RecName: Full=Cell-division control histidine kinase
  666::717     2e-06  38% 1035 aa  PDHS_BRUAB RecName: Full=Cell-division control histidine kinase
  666::717     2e-06  38% 1035 aa  PDHS_BRUA2 RecName: Full=Cell-division control histidine kinase
  666::717     2e-06  38% 1035 aa  PDHS_BRUA1 RecName: Full=Cell-division control histidine kinase
  617::734     3e-06  25% 1124 aa  PHYA_CUCPE RecName: Full=Phytochrome A;
   16::90      4e-06  27% 1505 aa  Y8013_DICDI RecName: Full=Probable serine/threonine-protein
  621::738     7e-06  21% 1131 aa  PHYA_SORBI RecName: Full=Phytochrome a;
  619::736     7e-06  21% 1129 aa  PHYA3_AVESA RecName: Full=Phytochrome A type 3;         Short=AP3;
  621::738     7e-06  21% 1131 aa  PHYA1_MAIZE RecName: Full=Phytochrome A;
  686::737     7e-06  37% 1055 aa  PDHS_OCHA4 RecName: Full=Cell-division control histidine kinase
  148::229     9e-06  29%  505 aa  FIXL_BRAJA RecName: Full=Sensor protein fixL;         EC=2.7.13.3;
  619::675     1e-05  36% 1135 aa  PHYC_SORBI RecName: Full=Phytochrome C;
  653::761     1e-05  36% 1156 aa  PHYB_SOYBN RecName: Full=Phytochrome B;
  618::735     2e-05  23% 1124 aa  PHYA_PEA RecName: Full=Phytochrome A;
  121::223     2e-05  29%  692 aa  YQIR_BACSU RecName: Full=Putative sigma L-dependent transcriptional
  618::735     2e-05  25% 1134 aa  PHY1_SELMA RecName: Full=Phytochrome 1;
  627::742     4e-05  25% 1131 aa  PHY_PINSY RecName: Full=Phytochrome;
   23::150     5e-05  24%  267 aa  RCOM1_BURXL RecName: Full=Heme-containing CO-sensing
  618::735     5e-05  23% 1124 aa  PHYA_LATSA RecName: Full=Phytochrome type A;
   82::195     5e-05  28%  428 aa  KINC_BACSU RecName: Full=Sporulation kinase C;         EC=2.7.13.3;
  181::293     8e-05  26%  682 aa  TCSA_EMENI RecName: Full=Two-component system protein A;       
  601::722     8e-05  22% 1111 aa  PHYC_ARATH RecName: Full=Phytochrome C;
  612::725     1e-04  25% 1118 aa  PHY_ADICA RecName: Full=Phytochrome 1;
  601::654     1e-04  38% 1112 aa  PHYE_ARATH RecName: Full=Phytochrome E;
  619::740     1e-04  28% 1124 aa  PHY_MOUSC RecName: Full=Phytochrome;
  623::742     1e-04  25% 1129 aa  PHYA_PETCR RecName: Full=Phytochrome A;
  607::665     2e-04  32% 1132 aa  PHY1_PHYPA RecName: Full=Phytochrome 1;
  618::670     4e-04  28% 1125 aa  PHYA_POPTM RecName: Full=Phytochrome A;
  266::382     5e-04  25%  611 aa  YYCG_BACSU RecName: Full=Sensor histidine kinase yycG;       
  354::386     5e-04  53% 1323 aa  PASK_HUMAN RecName: Full=PAS domain-containing
  237::281     5e-04  42% 1109 aa  DHKF_DICDI RecName: Full=Hybrid signal transduction histidine
  639::742     7e-04  25% 1131 aa  PHYA_SOYBN RecName: Full=Phytochrome A;
  352::384     7e-04  53% 1383 aa  PASK_MOUSE RecName: Full=PAS domain-containing
    1::139

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTISTNTAAQILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAA
FIXL_RHIME      ----------ILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRY
Y3085_AZOC5     --VSEAARRAMLDTSIDAVIVADEAGAIVEFNHAAEAIFGHTREGVIGRPMETIIPAHYIDRHRQGFMRH
PHYB_SOLTU      -----------LIETATAPIFADVEGRINGWNAKVAELTGVSVEEAMGKSLDLVYKESQETAEYNALRGE
FIXL_AZOC5      --------SSILDTVPDAMIVIDERGIMQSFSITAERLFGYSPSEVIGRNVSMLMPNPHRDQHDLYLSRY
DOS_ECOLI       -----------LEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHN
PHYB_TOBAC      -----------LIETATAPIFADVEGRINGWNAKVAELTDLSVEEAMGKSLDLVHKESQETAEKLLFNAL
PHYA_SOLTU      ----TAEMVRLIETASVPIFAVDVDGQVNGWNTKVAELTGLPVDEAIGKHLLTLVEDSSVDTVNKMLELA
PHYB_ORYSJ      -----------LIETATVPIFADTDGCINGWNAKVAELTGLSVEEAMGKSLDLIFKESEETVN-KLLSRA
PHYB_ORYSI      -----------LIETATVPIFADTDGCINGWNAKVAELTGLSVEEAMGKSLDLIFKESEETVN-KLLSRA
PHYB_SORBI      -----------LIETATVPIFADTDGCINGWNAKIAELTGLSVEEAMGKSLDLIFKESEEIVE-KLLSRA
PHYA_ORYSJ      ----TSEMVRLMETATVPILAVDSNGLVNGWNQKVAELTGLRVDEAIGRHILTVVEESSVPVVQRMLYLA
PHYA_ORYSI      ----TSEMVRLMETATVPILAVDSNGLVNGWNQKVAELTGLRVDEAIGRHILTVVEESSVPVVQRMLYLA
PHYD_ARATH      -----------LIETATVPIFADIDGCINGWNAKIAELTGLSVEDAMGKSLELIYKERLLSCALKG----
PHYB_ARATH      -----------LIETATVPIFADAGGCINGWNAKIAELTGLSVEEAMGKSLDLIYKEN-EATVNKLLSRA
PHYC_ORYSJ      ----TNEMVRLIETATAPILAVDITGSINGWNNKAAELTGLPVMEAIGKPLDLVIDDSVEVV--KQILNS
PHYC_ORYSI      ----TNEMVRLIETATAPILAVDITGSINGWNNKAAELTGLPVMEAIGKPLDLVIDDSVEVV--KQILNS
PHYB1_SOLLC     -----------LIETATAPIFGDVNGRINGWNEKVVELTGLSAEEAKGKSLDLLYKESQESAELRGVEGK
BDLA_PSEAE      ----------------------DPDGNITDANENFLTLLGYRRDEILGKHRQLCDGAYAQSEDYRRFWER
PHY_PICAB       ----TNEMVRLIETATVPILAIDSNGLVNGWNTKAAELTGLLADEVIGRPLDLVQHDSVEIVK-KMLYLA
PHYA_ARATH      ----TSEMVRLIETATVPILAVDSDGLVNGWNTKIAELTGLSVDEAIGKHFLTLVEDSSVEIVKRMLENA
PHYA1_TOBAC     ----TAEMVRLIETASVPIFAVDVDGQLNGWNTKIAELTGLPVDEAIGNHLLTLVEDSSVDTVSKMLELA
ATOS_ECOLI      ----------IIENAADGVIAIDRQGDVTTMNPAAEVITGYQRHELVGQPYSMLFD------NTQFYSPV
PHYA4_AVESA     ----TSEMVRLMETATVPILAVDGNGLVNGWNQKAAELTGLRVDDAIGRHILTLVEESSVPVVQRMLYLA
PDHS_BRUSU      ----------ILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFSMLFAIESQRA--------
PDHS_BRUSI      ----------ILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFSMLFAIESQRA--------
PDHS_BRUO2      ----------ILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFSMLFAIESQRA--------
PDHS_BRUME      ----------ILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFSMLFAIESQRA--------
PDHS_BRUC2      ----------ILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFSMLFAIESQRA--------
PDHS_BRUAB      ----------ILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFSMLFAIESQRA--------
PDHS_BRUA2      ----------ILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFSMLFAIESQRA--------
PDHS_BRUA1      ----------ILDTATDGVVLIDPEGRIRSMNHSASALFGYERDEAEGKFFSMLFAIESQRA--------
PHYA_CUCPE      ----TSEMVRLIETATVPILAVDLDGLINGWNTKIAELTGLPVDKAIGKHLLTLVEDSSVEVVRKMLFLA
Y8013_DICDI     -----------------AIVTINDKGYIQSVDRKTCELFGYTIEELQLQKVNILVPSPYKEQHDTYMQSY
PHYA_SORBI      ----TSEMVRLMETATVPILAVDGNGLVNGWNQKVAELSGLRVDEAIGRHILTLVEDSSVSIVQRMLYLA
PHYA3_AVESA     ----TSEMVRLMETATVPILAVDGNGLVNGWNQKAAELTGLRVDDAIGRHILTLVEDSSVPVVQRMLYLA
PHYA1_MAIZE     ----TSEMVRLMETATVPILAVDGNGLVNGWNQKVAELSGLRVDEAIGRHILTLVEDSSVSLVQRMLYLA
PDHS_OCHA4      ----------ILDTATDGVVLIDPEGRIRSMNHSASALFGYERDETEGKFFSMLFAIESQRA--------
FIXL_BRAJA      ----------ILHTIPDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRY
PHYC_SORBI      ----TNEMVRLIETATAPVLAVDIAGNINGWNNKAAELTGLPVMEAIGRPLDLVVVDSIE----------
PHYB_SOYBN      -----------LIETATAPIFADVDGHVNGWNAKVSELTGLPVEEAMGKSLDLVFKESEETVNSREEDKN
PHYA_PEA        ----TSEMVRLIETATVPILAVDVDGTVNGWNIKIAELTGLPVGEAIGKHLLTLVEDSSTDIVKKMLNLA
YQIR_BACSU      ---------RIFNSTHDGMIFIDINEEIILFNHMAEKMVGKKREEVIGRPIKEVIPS-------TKMPRI
PHY1_SELMA      -----NEMVRLIETATAPILAVDSSGFINGWNAKVADVTGLPVTEAMGRSLELVLHESADMVE-RLLYLA
PHY_PINSY       ---------RLIETATAPILAVDYNGLVNGWNAKVAELTGLPVGEAMGMSLDLVFEQSVERVE-KMLHNA
RCOM1_BURXL     -----------LEQFNPGIVWLDQHGRVTAFNDVALQILGPAGEQSLGVAQDSLFGIDVVQLHPEKSRDK
PHYA_LATSA      ----TSEMVRLIETATVPILAVDVDGTVNGWNIKIAELTGLPVGEAIGKHLLTLVEDSSTDIVKKMLNLA
KINC_BACSU      ---------RIMDNLQEIVFQTNAKGEITYLNQAWASITGFSISECMGTMYDYFIKEKHVADH-------
TCSA_EMENI      -----------------AIFMLDPTGHIATWNAGAGVLKGYKAEEIIGKHFSILYADRDNGKPARALDVC
PHYC_ARATH      LCVIVNEMVRLIDTAAVPIFAVDASGVINGWNSKAAEVTGLAVEQAIGKPVSDLVEDDSVETVKNMLALA
PHY_ADICA       ---------RLIETATAPILAVDGQGLINGWNGKVAELTGLSFETAMGKSLKELVHEESKTIVERVLHLA
PHYE_ARATH      ---------RVIETATAPIFGVDSSGCINGWNKKTAEMTGLLASEAMGKSLDEIVQEESRAA--------
PHY_MOUSC       ---------RLIETATAPILAVDTAGCVNGWNFKISELTGLSIPEVMGKSLDLTHPSSKDTVEKLLYMAL
PHYA_PETCR      ----TSEMVRLIETATVPIFAVDADEIVNGWNTKIAELTGLPVDQAMGKHLLTLVED--SSVGTVVFLLA
PHY1_PHYPA      LSVVANEMVRLIETATAPILAVDSNGMINGWNAKIAQVTGLPVSEAHGRSLDLVTDE-------------
PHYA_POPTM      ----TSEMVRLIETATVPILAVDVDGLVNGWNTKISELTGLLVDKAIGKHLLTLVED-------------
YYCG_BACSU      --------ASVIAYMTDGVIATNRNGAIILLNSPALELLNVSRETALEMPITSLL----------GLQEN
PASK_HUMAN      ------------------------DGTIHGINHSALTLFGYGKTELLGKNITFLIP--------------
DHKF_DICDI      ----------------------------------------------------------------------
PHYA_SOYBN      ------------------ILAVDVDGLVNGWNIKIAELTGLPIGEATGKHLLTLVEDSSTDRVKKMLNLA
PASK_MOUSE      ------------------------DGTIYGVNHSALMLFGYGKTELLGKNITFLIP--------------


                         .         .         *         .         .         .         .:140
query           IDTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARDVTDKVERERAQSAAGPVSR
FIXL_RHIME      MATGEKRIIGIDRVVSGQRKDGSTF--PMKLAVGEMRSGGERFFTGFIRDLTEREE-------------
Y3085_AZOC5     LATGENHIMRRLVEVEALRADGSVFPAELT-VNEHRAGGRRLFS-AFVRDISDRITSRRA---------
PHYB_SOLTU      EDKNKLRTFGAEQLEKAV-------FVVVNACASKDYTNNIVGVCFVGQDVT-----------------
FIXL_AZOC5      LTTGERRIIGIGRVVTGERKDGATFPMELAVGEMHSVSGRFF--TGFIRDLTERQNTE-----------
DOS_ECOLI       REGGKARVEGMSRELQLEKKDGSKIWTRFALSKVS-AEGKVY-YLALVRDAS-----------------
PHYB_TOBAC      RGEEKLRTFGPEQLKKAV-------FVVVNACSSKDYTNNIVGVCFVGQDVT-----------------
PHYA_SOLTU      LQGQEERNVEFEIKTHGPSRDSSPISLIVNACASKDVRDSVVGVCFIAQDIT-----------------
PHYB_ORYSJ      LRGDEDKNVEIKLKTFGPEQSKGPIFVIVNACSSRDYTKNIVGVCFVGQDVT-----------------
PHYB_ORYSI      LRGDEDKNVEIKLKTFGPEQSKGPIFVIVNACSSRDYTKNIVGVCFVGQDVT-----------------
PHYB_SORBI      LRGEEDKNVEIKLKTFGSEQSNGAIFVIVNACSSRDYTQNIVGVCFVGQDVT-----------------
PHYA_ORYSJ      LQGXXXXXXXXXXXTHGSKRDDGPVILVVNACASRDLHDHVVGVCFVAQDMT-----------------
PHYA_ORYSI      LQGXXXXXXXXXXXTHGSKRDDGPVILVVNACASRDLHDHVVGVCFVAQDMT-----------------
PHYD_ARATH      -DEGKNVEVKLKTFGSEL--QGKAMFVVVNACSSKDYLNNIVGVCFVGQDVT-----------------
PHYB_ARATH      LRGDEEKNVEVKLKTFSPELQGKAVFVVVNACSSKDYLNNIVGVCFVGQDVTSQ---------------
PHYC_ORYSJ      ALQGIEEQNLQIKLKTFNHQENNGPVILMVNACCSDLSEKVVGVCFVAQDMT-----------------
PHYC_ORYSI      ALQGIEEQNLQIKLKTFNHQENNGPVILMVNACCSDLSEKVVGVCFVAQDMT-----------------
PHYB1_SOLLC     NVEIKLRTFGAEQVEKAV-------FLVVNACSSRDYTNSIVGVSFVGQDVT-----------------
BDLA_PSEAE      LRRGE-HFSGR---CKRITREGRPLWLEATYNPVRDGQGRLLKVVKYASDIDAIVHQEEMQSKLDALSR
PHY_PICAB       LQGEEEQNVEIKLKTFGIQEEKGPVVLIVNACSSRDLEENVVGVCFVAQDVT-----------------
PHYA_ARATH      LEGTEEQNVQFEIKTHLSRADAGPISLVVNACASRDLHENVVGVCFVAHDLT-----------------
PHYA1_TOBAC     LQGKEERNVEFEIKTHGPSGDSSPISLIVNACASRDVGDSVVGVCFIAQDIT-----------------
ATOS_ECOLI      LDTLE---HGTEHVALEISFPGRDRTIELTTSRIHNTHGEMIGALVIFSDLTARKETQRRMAQA-----
PHYA4_AVESA     LQGKEEKEVRFEVKTHGPRRDDGPVILVVNACASRDLHDHVVGVCFVAQDMT-----------------
PDHS_BRUSU      ---------------------------------------------------------------------
PDHS_BRUSI      ---------------------------------------------------------------------
PDHS_BRUO2      ---------------------------------------------------------------------
PDHS_BRUME      ---------------------------------------------------------------------
PDHS_BRUC2      ---------------------------------------------------------------------
PDHS_BRUAB      ---------------------------------------------------------------------
PDHS_BRUA2      ---------------------------------------------------------------------
PDHS_BRUA1      ---------------------------------------------------------------------
PHYA_CUCPE      LQGQEEQNVQFEIKTHGSHIEVGSISLVVNACASRDLRENVVGVFFVAQDIT-----------------
Y8013_DICDI     FETGVRKIIDKSRVVEGLHKDG-----------------------------------------------
PHYA_SORBI      LQGKEEKEVRFELKTHGSKRDDGPVILVVNACASRDLHDHVVGVCFVAQDMT-----------------
PHYA3_AVESA     LQGKEEKEVRFEVKTHGPKRDDGPVILVVNACASRDLHDHVVGVCFVAQDMT-----------------
PHYA1_MAIZE     LQGREEKEVRFELKTHGSKRDDGPVILVVNACASRDLHDHVVGVCFVAQDMT-----------------
PDHS_OCHA4      ---------------------------------------------------------------------
FIXL_BRAJA      RTTSDPHIIGIGRIVTGKRRDG-----------------------------------------------
PHYC_SORBI      ---------------------------------------------------------------------
PHYB_SOYBN      VET-KMRTFGKEHQNKA-------AFLVVNACSSKHFTNNVVGVCFVGQNVT-----------------
PHYA_PEA        LQGEEEKNVQFEIKTHGDQVESGPISLIVNACASKDLRENVVGVCFVAQDIT-----------------
YQIR_BACSU      LKTRVPEYNQKQLL-------GDHLQIVTTRLPIIDEGGRLLGALCVFKDITDAVE-------------
PHY1_SELMA      LQGDEEQNVELKLKTFGGQKDKEAVILVVNACASRDVSDNVVGVCFVGQDVT-----------------
PHY_PINSY       LRGEEEKNVEMMLKTFGPQKEKEAVILVVNACSSRDFTDNIVGVCFVGQDVTSQ---------------
RCOM1_BURXL     LDVGGCPVKSPPPVAMMINIPDRILMIKVSSMI---AAGGACGTCMIFYDVTDLTTEPSGLPAGG----
PHYA_LATSA      LQGEEEKNVQFEIKTHGDQVEFGPISLIVNACASRDLRENVVGVCFVAQDIT-----------------
KINC_BACSU      INTQQNKASSGMFTAKYVTKNGTIFWGEVHYKLYYDRDDQFTGSLGTMSDITERKEAE-----------
TCSA_EMENI      LREGRIEDEG-----WRYRRDGSRFWANVLITPIYQF-GQHVGFVKVTRDLTERKEAEACMIAA-----
PHYC_ARATH      LEGSEER--GAEIRIRAFGPKRKSSPVELVVCCSRDMTNNVLGVCFIGQDVT-----------------
PHY_ADICA       LEGEEEQDIEIHLRTYDQHKQKGVVILIVNTCCSRDVSNNVVGVCFVGQDVT-----------------
PHYE_ARATH      ---------------------------------------------------------------------
PHY_MOUSC       --NGEEEQNVEIRLKTWGMQQGKGPVILMVNACASDVSEKVVGVCFVAQDVTEKIVQDK----------
PHYA_PETCR      LALQGKEEQGIPFKTYGSREDSVPITVVVNACATRGLHDNVVGVCFVAQDVTSQ---------------
PHY1_PHYPA      ---------------------------------------------------------------------
PHYA_POPTM      ---------------------------------------------------------------------
YYCG_BACSU      Y-TFEDLVEQQDSMLLEIERDDELTVLRVNFSVIQREHGKIDGLIAVIYDVTEKMDQERREFVA-----
PASK_HUMAN      ---------------------------------------------------------------------
DHKF_DICDI      -------LSTETTITK---KNGEKYPAEVFVKEISDIHSNSIGIMIIVRDITDQI--------------
PHYA_SOYBN      LLGEEEKNVQFEIKTLGSKMDSGPISLVVNRCASRDLRDNVVGVCFVAHDIT-----------------
PASK_MOUSE      ---------------------------------------------------------------------