[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08536.1

[Show Plain Result]


## Summary of Sequence Search
    1::404
  146::333     2e-13  30%  391 aa  GGR_METJA RecName: Full=Digeranylgeranylglycerophospholipid
  146::332     3e-13  29%  390 aa  GGR_METVS RecName: Full=Digeranylgeranylglycerophospholipid
  124::321     5e-13  32%  385 aa  GGR2_METTH RecName: Full=Digeranylgeranylglycerophospholipid
  146::332     2e-12  28%  390 aa  GGR_METM5 RecName: Full=Digeranylgeranylglycerophospholipid
  144::310     5e-12  29%  390 aa  GGR_METM7 RecName: Full=Digeranylgeranylglycerophospholipid
  146::306     7e-12  30%  390 aa  GGR_METM6 RecName: Full=Digeranylgeranylglycerophospholipid
  146::287     7e-11  35%  393 aa  GGR_PYRAB RecName: Full=Digeranylgeranylglycerophospholipid
  109::326     7e-11  26%  397 aa  GGR3_METST RecName: Full=Digeranylgeranylglycerophospholipid
  146::310     1e-10  28%  390 aa  GGR_METMP RecName: Full=Digeranylgeranylglycerophospholipid
  155::322     1e-10  26%  391 aa  GGR_META3 RecName: Full=Digeranylgeranylglycerophospholipid
  150::323     2e-10  27%  393 aa  GGR2_METST RecName: Full=Digeranylgeranylglycerophospholipid
  146::301     4e-10  31%  393 aa  GGR_PYRFU RecName: Full=Digeranylgeranylglycerophospholipid
  136::302     1e-08  28%  387 aa  GGR_ARCFU RecName: Full=Digeranylgeranylglycerophospholipid
  148::331     2e-08  28%  407 aa  GGR_METAC RecName: Full=Digeranylgeranylglycerophospholipid
  152::327     2e-08  25%  397 aa  GGR1_METTH RecName: Full=Digeranylgeranylglycerophospholipid
  150::284     3e-08  34%  395 aa  GGR_PYRKO RecName: Full=Digeranylgeranylglycerophospholipid
  127::311     1e-07  33%  391 aa  GGR_METTP RecName: Full=Digeranylgeranylglycerophospholipid
  148::325     1e-07  28%  392 aa  GGR_UNCMA RecName: Full=Digeranylgeranylglycerophospholipid
  141::294     1e-07  27%  396 aa  GGR2_METKA RecName: Full=Digeranylgeranylglycerophospholipid
  148::328     2e-07  27%  408 aa  GGR1_METBU RecName: Full=Digeranylgeranylglycerophospholipid
  146::292     5e-07  29%  393 aa  GGR_PYRHO RecName: Full=Digeranylgeranylglycerophospholipid
  140::298     8e-07  26%  387 aa  Y1520_METJA RecName: Full=Uncharacterized protein MJ1520;
  149::343     2e-06  23%  396 aa  GGR_THEVO RecName: Full=Digeranylgeranylglycerophospholipid
  149::343     2e-06  23%  396 aa  GGR_THEAC RecName: Full=Digeranylgeranylglycerophospholipid
  157::311     4e-06  29%  391 aa  UBIF_ECOLI RecName:
  148::331     2e-05  26%  407 aa  GGR_METMA RecName: Full=Digeranylgeranylglycerophospholipid
  193::394     2e-05  29%  464 aa  CHLP_TOBAC RecName: Full=Geranylgeranyl diphosphate reductase,
  107::314     2e-05  24%  393 aa  GGR_METS3 RecName: Full=Digeranylgeranylglycerophospholipid
  258::326     5e-05  30%  398 aa  GGR_METMJ RecName: Full=Digeranylgeranylglycerophospholipid
  148::314     5e-05  27%  397 aa  GGR_METLZ RecName: Full=Digeranylgeranylglycerophospholipid
  148::314     2e-04  24%  399 aa  GGR_METPE RecName: Full=Digeranylgeranylglycerophospholipid
  272::351     9e-04  43%  968 aa  RAPA_ERWT9 RecName: Full=RNA polymerase-associated protein rapA;   
  138::350     9e-04  28%  627 aa  HYDL_STRCO RecName: Full=Putative polyketide hydroxylase;       
  148::304     9e-04  24%  402 aa  GGR_METHJ RecName: Full=Digeranylgeranylglycerophospholipid
    6::118     9e-04  38%  298 aa  EUTC_SALSV RecName: Full=Ethanolamine ammonia-lyase light chain;   
  208::367     9e-04  28%  467 aa  CHLP_ARATH RecName: Full=Geranylgeranyl diphosphate reductase,
    1::404

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GGR_METJA       ----------------------------------------------------------------------
GGR_METVS       ----------------------------------------------------------------------
GGR2_METTH      ----------------------------------------------------------------------
GGR_METM5       ----------------------------------------------------------------------
GGR_METM7       ----------------------------------------------------------------------
GGR_METM6       ----------------------------------------------------------------------
GGR_PYRAB       ----------------------------------------------------------------------
GGR3_METST      ----------------------------------------------------------------------
GGR_METMP       ----------------------------------------------------------------------
GGR_META3       ----------------------------------------------------------------------
GGR2_METST      ----------------------------------------------------------------------
GGR_PYRFU       ----------------------------------------------------------------------
GGR_ARCFU       ----------------------------------------------------------------------
GGR_METAC       ----------------------------------------------------------------------
GGR1_METTH      ----------------------------------------------------------------------
GGR_PYRKO       ----------------------------------------------------------------------
GGR_METTP       ----------------------------------------------------------------------
GGR_UNCMA       ----------------------------------------------------------------------
GGR2_METKA      ----------------------------------------------------------------------
GGR1_METBU      ----------------------------------------------------------------------
GGR_PYRHO       ----------------------------------------------------------------------
Y1520_METJA     ----------------------------------------------------------------------
GGR_THEVO       ----------------------------------------------------------------------
GGR_THEAC       ----------------------------------------------------------------------
UBIF_ECOLI      ----------------------------------------------------------------------
GGR_METMA       ----------------------------------------------------------------------
CHLP_TOBAC      ----------------------------------------------------------------------
GGR_METS3       ----------------------------------------------------------------------
GGR_METMJ       ----------------------------------------------------------------------
GGR_METLZ       ----------------------------------------------------------------------
GGR_METPE       ----------------------------------------------------------------------
RAPA_ERWT9      ----------------------------------------------------------------------
HYDL_STRCO      ----------------------------------------------------------------------
GGR_METHJ       ----------------------------------------------------------------------
EUTC_SALSV      ----------------------------------------------------------------------
CHLP_ARATH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GGR_METJA       ----------------------------------------------------------------------
GGR_METVS       ----------------------------------------------------------------------
GGR2_METTH      ----------------------------------------------------------------------
GGR_METM5       ----------------------------------------------------------------------
GGR_METM7       ----------------------------------------------------------------------
GGR_METM6       ----------------------------------------------------------------------
GGR_PYRAB       ----------------------------------------------------------------------
GGR3_METST      ----------------------------------------------------------------------
GGR_METMP       ----------------------------------------------------------------------
GGR_META3       ----------------------------------------------------------------------
GGR2_METST      ----------------------------------------------------------------------
GGR_PYRFU       ----------------------------------------------------------------------
GGR_ARCFU       ----------------------------------------------------------------------
GGR_METAC       ----------------------------------------------------------------------
GGR1_METTH      ----------------------------------------------------------------------
GGR_PYRKO       ----------------------------------------------------------------------
GGR_METTP       ----------------------------------------------------------------------
GGR_UNCMA       ----------------------------------------------------------------------
GGR2_METKA      ----------------------------------------------------------------------
GGR1_METBU      ----------------------------------------------------------------------
GGR_PYRHO       ----------------------------------------------------------------------
Y1520_METJA     ----------------------------------------------------------------------
GGR_THEVO       ----------------------------------------------------------------------
GGR_THEAC       ----------------------------------------------------------------------
UBIF_ECOLI      ----------------------------------------------------------------------
GGR_METMA       ----------------------------------------------------------------------
CHLP_TOBAC      ----------------------------------------------------------------------
GGR_METS3       ----------------------------------------------------------------------
GGR_METMJ       ----------------------------------------------------------------------
GGR_METLZ       ----------------------------------------------------------------------
GGR_METPE       ----------------------------------------------------------------------
RAPA_ERWT9      ----------------------------------------------------------------------
HYDL_STRCO      ----------------------------------------------------------------------
GGR_METHJ       ----------------------------------------------------------------------
EUTC_SALSV      ----------------------------------------------------------------------
CHLP_ARATH      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxLASELVNHGVDLRLGTSFSQASRSGAGWSVPGVGRTRYLVGADGARSRVAQIAGLGQGNAFLYGVEYE
GGR_METJA       ------------------------------------KTKVVIAADGVESNIAEYAGLKAKKKPLECAEYE
GGR_METVS       ------------------------------------KTKLVIAADGVESTISEYAGLKSKNEVCSCAEYE
GGR2_METTH      -------------------FREGSVSGVVFRGPGVQEVEMVIAADGVQSSIARKAGLETGFRLCSCVQYE
GGR_METM5       ------------------------------------KTKIVIAADGVESNIAEYAGLKSKKSICSCAEYE
GGR_METM7       ----------------------------------VVKSKIVIAADGVESNIAEYAGLKSKKEICSCAEYE
GGR_METM6       ------------------------------------KTKIVIAADGVESNIAEYAGLXXXXXICSCAEYE
GGR_PYRAB       --------------------------------------KVIVAADGVESTIARKAGINTPHEFDSGYEYE
GGR3_METST      --MTMDAIREGAEVMIKTEALSMKREGDGYLVDIKSKAHIVIGADGPEGHVARWAELNTKVPLAEGLQYE
GGR_METMP       ------------------------------------KSKIVIAADGVESNIAEYAGLKSKKEICSCAEYE
GGR_META3       --------------------------------------------DGVESSIAEMAGIKKVTEICSCAEYE
GGR2_METST      --------------------------------------KIVIAADGPESRIGRWAGLECNTEFKYMIQFE
GGR_PYRFU       --------------------------------------KIIVAADGVESTVARLAGINTPHEFDSAYEYE
GGR_ARCFU       ------------------------RLGEDWEV----ETKILIGADGVESKIGRKAGIIKTNEVESCAQYL
GGR_METAC       ------------------------------------RAKIVIGADGVESKVGRWAGIDTSLKPITCAQYL
GGR1_METTH      ------------------------------------KARIVIAADGPESRVARWAGLNTATRMESAAQFE
GGR_PYRKO       ----------------------------------------IVAADGVESTIARKAGINTPHEFDSGYEYE
GGR_METTP       ---------------------------ANGSVKGIRAMRYVIGADGVESKVGRWAGID--TALKPGDIEV
GGR_UNCMA       ------------------------------------RAKVVVAADGVESKVGRWAGI---NTTLKMKDIE
GGR2_METKA      ------------------------------------RARIVIAADGIESRIGRTAGLVKPVEMCTCAQYE
GGR1_METBU      ------------------------------------RSKLVIGADGVESKVGRWAGIDTSSHIETCAQFL
GGR_PYRHO       --------------------------------------KVIVAADGVESTIARKAGIAPPHEFDSGYEYE
Y1520_METJA     --------------------------------------KIIVGADGAKTITGKKLGLNKNREILSSCQFE
GGR_THEVO       ------------------------------------RAKMVIAADGFESEFGRWAGLKSRNDIISALQYR
GGR_THEAC       ------------------------------------RAKMVIAADGFESEFGRWAGLKSRNDIISALQYR
UBIF_ECOLI      ------------------------------------RAKLVIGADGANSQVRQMAGIGV-HAWQYAQSCM
GGR_METMA       ------------------------------------RASIVIGADGVESKVGRWAGI---DTALKPVDVE
CHLP_TOBAC      ---------------------------------GAGEKRTLIGADGANSRVAKSINAGD---YEYAIAFQ
GGR_METS3       --MAMDAARAGAEIRIKTLATGMDKIEDGFSTESMGKTKIVIAADGPEGHVARWAGLAKAKEMESGVQYE
GGR_METMJ       ----------------------------------------------------------------------
GGR_METLZ       ------------------------------------RAKVIIAADGVESKFAKWAGINTTVPLAECAQYI
GGR_METPE       ------------------------------------RAKVVIAADGVESKFARWCGVDTANEIETCAQYL
RAPA_ERWT9      ---------------------------AEWDLMVVDEAHHLVWSEDAPSRIEQLAEQVPGILLLLGMESH
HYDL_STRCO      --LLTHATNLGGDLRFGTELLSFEADTEG--VTAIVKSRYLVAADGPRSPVREQLGIGQSGPLFHNVSIT
GGR_METHJ       ------------------------------------RAGLTIAADGVESKFARWCGVDTTREMETCAQYL
EUTC_SALSV      ----------------------------------------------------------------------
CHLP_ARATH      ----------------------------------------VIGADGANSRVAKSIDAGD---YDYAIAFQ


                         .         .         .         +         .         .         .:280
query           FAGLQLSDPDALHCFASKHFAPGYIGWVAQNPTGVQAGXXXXXXXXXXXXXDIDGFLRRVRHLLGVPEDA
GGR_METJA       MTNVELLDKNMMEFYFGNEVAPGGYVWIF--PKGETANVGLGVRDKKKKAIEIENGLAKDRL-----KDA
GGR_METVS       MTNVKLLDNNMMEFYFGEICPKGYI-WLFPKGDTVNVGIGIIEGSKKAIEY-LDDFLSNPL-LEGRLKNA
GGR2_METTH      VAGVDV-DPETMEFYFGSRFAPSGYLWVFPKGEG-RANVGLGIRRKSCSERGPLSYLNRFMEERGFKR--
GGR_METM5       MTNVKLLDNEMMEFYFGDICPKGYI-WLFPKGDTVNVGIGIIDSKKRAIDY-LDEFLTNPL-VKGRLDNA
GGR_METM7       MTNVQLLDNEMMEFYFGDICPKGYI-WLFPKGDTVNVGIGVIDSKKRAIDY-LDEFLSNPL-VEGRLDNA
GGR_METM6       MTNVKLLDNEMMEFYFGDICPKGYI-WLFPKGDTVNVGIGIIDSKKRALDY-LDEFLTNPL-VEGRLDNA
GGR_PYRAB       ML-IEGYDPDLIHLFFGNEVAPGYVWIFPKDEDRANVGIGIASDHPQTAKYYLDKWLKEMRKILEV----
GGR3_METST      MTNLKMKNNSVIQFFFGS-VAPGGYAWIF--PKGYDTANVGIDISGIKAEKSAVKYLNDFIANCDETKDG
GGR_METMP       MTNVKLLNNEMMEFYFGDICPKGYI-WLFPKGDTVNVGIGVIDSKKRAIDY-LDEFLTHPL-VEGRLDNA
GGR_META3       MTNVKLLDKNMMEFYFGDICPKGYV-WIF--PKGETANVGLGIIDSKKKAIDLNEFLEHPL-LEGRLDNA
GGR2_METST      MAGVNMENNRDIALFFGS-VAPGGYVWIF--PKGDDIANVGIGVLKNKTNKTAYEHLMEFIKTCPETKDA
GGR_PYRFU       MI-IEGYDPDLIHLWFGNEIAPGYVWVFPKDEDRANVGIGINSDNEKTAKYYLDKWLK---------ENN
GGR_ARCFU       MTGLDI-DESYTYFYLGRELAPGGYAWIFPKGNGANVGIGVLPKMAERTAKELDAFXXXXXXXXXXVEFV
GGR_METAC       IAGADI-DPEYCEFYIGNEIAPGGYVWIGEGKANVGVGILGNRTGKFKP--------RPVDYLNNFVEKK
GGR1_METTH      MVGVEMEDNNCIEFYFGS-VAPG--GYALDIPEGDDIANVGLGVLSTETDKSAYEHLLEFVESCPATRNA
GGR_PYRKO       ML-IEGFDPDLIHLWFGNEVAPGYVWVFPKDEDRANVGIGINSDNPKTAKYYLDKWLEEAKKLLEI----
GGR_METTP       CAQFLLYDKDDEYCFLGNELAPG--GYVWSFPKGEHLANVGLGVIGSRSEPGAPVKLLRRFVERRMPE-A
GGR_UNCMA       TAQFLMTDPNSCDFYLGSKYAPGGYVWVF--PKGDREANVGLGMLASHYKGK-----HPIEYLREFVADK
GGR2_METKA      MVGVDVEE-DATHFFVDAEFFPGGYFWIGEGRANVGLGIRGSESEPGDALKVLNRALEDHELISEAVADA
GGR1_METBU      VSGVDI-DQSSCYFYMGNKVAPGGYVWVGNNMANVGIGILGSRA----------GEKKPIEYLTDFVEAN
GGR_PYRHO       MI-IEGFDPDLIHLFFGNEVAPGYVWVFPKDEDRANVGIGINSDNEKTAKYYLDKWLKE----NNIPRNK
Y1520_METJA     MVNAEVDD-DFVYIFLDRKYSERFFTWII--PMGVRVGLIDRGNCYNKLIR----FINENKIAKEILKNA
GGR_THEVO       MINIDV-DPDYTDFYLGSIAPGGYI-WVFPKGEGMANVGIGSSINFIHNRLELKNYLDRIENHPGLKKGQ
GGR_THEAC       MINVDV-DPDYTDFYLGSIAPAGYI-WVFPKGEGMANVGIGSSINWIHNRFELKNYLDRIENHPGLKKGQ
UBIF_ECOLI      LISVQCEND------------PGDSTWQQFTPDGPRAFLPLFDNWASLVWYDSPARIRQLQNMNMAAEIA
GGR_METMA       TCAQYLADINQEYCYIGNEMAPGGYVWVGKANVGIGILGSKMGKFKPRPVDYLNDFVQKKF------PDA
CHLP_TOBAC      -ERIKISDDNLAEMYVGDDVSPDFYGWVFPKCDHVAVGTGTVTHKADIKKFQLATRLRADSKITGIRVEA
GGR_METS3       MVNVEF-DREAVIEFYFGSCAPGGYVWIFPKGDDINVGLAILQHKATKPAIELDDFIAKCP----ATKNA
GGR_METMJ       ----------------------------------------------------------------------
GGR_METLZ       VNDIDIDERANLFYFSYTDAPWGYI-WVGHRCANVGIGIAGTKSGEGHRAKDLDRFIARE-----FPNGK
GGR_METPE       LTDIDI-DESATVFYLGNEIAPEGYAWVPKGKRTANVGLGISGKKNLPGNRPIDYLNRFVEK--NFPNGK
RAPA_ERWT9      FARLRLLDPDRFHDFAQKHFSP------------------------------------------------
HYDL_STRCO      FRSRRLADVVGIVCYLTDENADGALNWVFHAPWHPEQGETVEDFTD-------ERCAAHIRRAIGDPDLD
GGR_METHJ       MTGIDI-DAHATEFYVGNNIAPGGYVWIPKGDKTANVGIGVGGDRCKPGNRPIDYLNRFVAR--NFPNGK
EUTC_SALSV      ----------------------------------------------------IEEIVRSVMASMGVPQPA
CHLP_ARATH      -ERIRIPDEDLAEMYVGDDVSPDFYGWVFPKCDHVAVGTGTVTHKGDIKKFQLATRNRAKDKILGIRVEA


                         .         *         .         .         .         .         +:350
query           APTTTRAGLIPCGGPVYPLARDGVLLTGDAAGIVSPVTAGGIHAAWRHGEAVGRAIAAHLRTGAATPEQV
GGR_METJA       TPIEFKVGGAPVSGPIEKTYTDGLLVVGDAAGQISPLTGGGIYLAMDCGLIAGEVASKAIKLNDWSEETL
GGR_METVS       VPVEFKVGGDPVGGPIKKTFKDNLIVVGDAAGHVSPLTGGGISLAMDCGLIAGEVCAKSI-----SSKNY
GGR2_METTH      --IEFNAGAVPVCGPIERTFTDGLLVVGDAAGQVDPLTGGGIHLAAECAKIAGEVAAEAIESGRVD----
GGR_METM5       VPVEFKVGGDPVGGPIEKTVADNIMVVGDAAGHVSPLTGGGIGLSMSCGLMAGDVAAQSIK---------
GGR_METM7       VPVEFKVGGDPVGGPIEKTVDDNIIVVGDAAGHVSPLTGGGIGLSMDCGLMAGEVAAQSIK---------
GGR_METM6       VPIEFKVGGDPVGGPIEKTVADNIMVVGDAAGHVSPLTGGGIGLSMACGVMAGEVAA-------------
GGR_PYRAB       -----NVGLVPVGGFVKELVKDNVLVVGDAARQVNPVHGGGM----------------------------
GGR3_METST      QIVEINAGGNPLCGIFDKIITDNVMLVGDAAGCVSPITGGGIDTALESGMIAGRVAAKAIKNRDYSEEKL
GGR_METMP       VPVEFKVGGDPVGGPIKKTVADNIMVVGDAAGHVSPLTGGGIGLSMDCGLMAGDVAAQSIK---------
GGR_META3       TPIEFKCGGAPVGGPIEKTVADNFMVVGDAAGQISPISGGGIYLSLSCGSIAGKVAGEAIKSNNCSEDYL
GGR2_METST      QPVEINVGGDPVGGIIKDRIGDNILVVGDAAGFVNSLTGGGINSALESGVYAGIVAAQAIKDGDYSKNNL
GGR_PYRFU       IPTKKNVGLVPVGGFVRELVKENVAVVGDAARQVNPVHGGGMYEAMKAANILAKWI--------------
GGR_ARCFU       ------AGAVPVYGEIETAVADNIMLAGDAAYHADPITGGGIANALSAGYYAGKVAA-------------
GGR_METAC       FPNAKIVGGVPVSGSIEKTSVNGLMLVGDAARQSDPITGGGILNAMDAGKIAGEAAYEAISSGDVSLEKL
GGR1_METTH      QPVELNIGGDPVGGMPKKLVADSLMVVGDAAGQVNPLTXXXXXXXXXXXXLAGQVAAAAVSEGDVTARRL
GGR_PYRKO       -----NVGLIPVGGFVKELAKDNVVVVGDAARQVNPM---------------------------------
GGR_METTP       RIVEMVVGGVPVSGPIERTIADGVMLVGDAARQSDPITGGGILNAMQAGMIAGEVVADAVSSG-------
GGR_UNCMA       FPEETVVGAVPVSGMLPKLSTGGLVLVGDAGHVSDPITGGGIINAMSSGRIAGNIIANCIRAGDVSAKAL
GGR2_METKA      XXXXXXXXXXXXXXXXERTYGDGILLVGDAARQVNPLTGGGLHTS-------------------------
GGR1_METBU      YPNGSIAGAVPASGPIEKTIANGLMLVGDAARQSDPFTGGGISNAMDAGLYAGE-VAAEAIAQDDVSEKI
GGR_PYRHO       I-LEVNVGLIPVGGFXXXXXXXXXXXXGDAARQVNPIHGGGMAEAMK-----------------------
Y1520_METJA     TITEFSTGSLPIGY-LDKTFKDNVLLVGDAACHVKPLSGGGLYFGAMGGKIAGEVISKYL----------
GGR_THEVO       DIQLVTGG-VSVSKVKMPITMPGLMLVGDAARLIDPITGGGIANAIVSGMYAAQVSKEAIESNDYSPQMM
GGR_THEAC       DIQLVTGG-VSVSKVKMPITMPGLMLVGDAARLIDPITGGGIANAIVSGMYAAQVTKEAIESNDYSPQMM
UBIF_ECOLI      KHFPSRLGYVPLAAGAFPLTRPGLALVGDAAHTIHPLAGQGVNLGYRDVDAL------------------
GGR_METMA       RIVEMVFGGVPVSGSIEKTSVNGLMLVGDAARQSDPITGGGILNAMDAGKLAGEAAYEAISAGDVSVVKL
CHLP_TOBAC      HPI-----------PEHPRPRDRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAIV----EGSEMGKRM
GGR_METS3       QAVELNVGGDPVGGMPKKMYDDNILVCGDAAGQVNPLXXXXXXXXXXXXXYAGQVAAEAIKEG-------
GGR_METMJ       ------AGGVPVCRPLACTVADGLMVAGDAARVVDPITGGGIGNAMYTGRLAAQVASKCIAAGDCSKEAL
GGR_METLZ       VTELIVGGVSVCK-PLDCTVADNLIIVGDAARLSDPITGGGIYNAMYTGKLAGEVAAAALKKG-------
GGR_METPE       TIECIVGGVSVCT-PLASTVSDGLMIVGDAARISDPLTGGGIYNAMYSGRLAAQVAIECIKRG-------
RAPA_ERWT9      ----------------------------------------------------------------------
HYDL_STRCO      VEITGKAPWHAAQRVARSYRSGRVLLAGDSAHEMSPTGAFGSNTGIQDAHNLAWKLAAVL----------
GGR_METHJ       TIELIAGGVSICQ-PLPCTVANNLMIVGDAARVSDPLTGGGIYAALYTGKLAG-----------------
EUTC_SALSV      APSTQEGAKPQCAVPT--VAESCALDLGSAEGVENPHRADVL-------TELRRSTAARVCTGRA-----
CHLP_ARATH      HPI-----------PEHPRPRKRVALVGDAAGYVTKCSGEGIYFAAKSGRMCAEAIVEGSQNG-------


                         .         .         .         .         *         .         .:420
query           AEQSAPRFRTKRLLRWAFDHFQSDWAFDVLLHSAPLRWVxxxxxxxxxxxxxxx
GGR_METJA       KEYER---------RWKEKHYE--------------------------------
GGR_METVS       SEEFLSQYET----RWKEKHYK--------------------------------
GGR2_METTH      -----GRFLSRYEMRW--------------------------------------
GGR_METM5       AEDHSREFLSAYEKRWKEKYYK--------------------------------
GGR_METM7       ------------------------------------------------------
GGR_METM6       ------------------------------------------------------
GGR_PYRAB       ------------------------------------------------------
GGR3_METST      QE----------------------------------------------------
GGR_METMP       ------------------------------------------------------
GGR_META3       VE----------------------------------------------------
GGR2_METST      KE----------------------------------------------------
GGR_PYRFU       ------------------------------------------------------
GGR_ARCFU       ------------------------------------------------------
GGR_METAC       EEVYEKRWR---------------------------------------------
GGR1_METTH      GE----------------------------------------------------
GGR_PYRKO       ------------------------------------------------------
GGR_METTP       ------------------------------------------------------
GGR_UNCMA       SRYDA-------------------------------------------------
GGR2_METKA      ------------------------------------------------------
GGR1_METBU      LQKYEKRWR---------------------------------------------
GGR_PYRHO       ------------------------------------------------------
Y1520_METJA     ------------------------------------------------------
GGR_THEVO       GKYEKDRFERKHLRNW--------------------------------------
GGR_THEAC       QKYEKERFERKHLRNW--------------------------------------
UBIF_ECOLI      ------------------------------------------------------
GGR_METMA       EEVYEKKWR---------------------------------------------
CHLP_TOBAC      VDESDLR---KYLEKWDKTYWPTYKVLDIL------------------------
GGR_METS3       ------------------------------------------------------
GGR_METMJ       MPYDA-------------------------------------------------
GGR_METLZ       ------------------------------------------------------
GGR_METPE       ------------------------------------------------------
RAPA_ERWT9      ------------------------------------------------------
HYDL_STRCO      ------------------------------------------------------
GGR_METHJ       ------------------------------------------------------
EUTC_SALSV      ----GPRPRTQALLRFLADHSRSK---DTVLKEVPEEWV---------------
CHLP_ARATH      ------------------------------------------------------