[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08549.1

[Show Plain Result]


## Summary of Sequence Search
    1::341
   12::201     4e-32  38%  224 aa  T431_STAAW RecName: Full=Transposase for insertion sequence-like
   12::201     4e-32  38%  224 aa  T431_STAAN RecName: Full=Transposase for insertion sequence-like
   12::201     4e-32  38%  224 aa  T431_STAAM RecName: Full=Transposase for insertion sequence-like
   12::201     4e-32  38%  224 aa  T431_STAA8 RecName: Full=Transposase for insertion sequence-like
   12::201     2e-31  37%  224 aa  T257_STAAU RecName: Full=Transposase for insertion sequence element
   12::61      2e-10  44%  107 aa  Y4551_YERPS RecName: Full=Uncharacterized protein pYV0051;
    1::341

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxDVILLCVRWYVAYSLSLRDLEEMMAERGLAVDHSMVHRWVIKLLPLFEKA
T431_STAAW      --------------------DVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQI
T431_STAAN      --------------------DVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQI
T431_STAAM      --------------------DVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQI
T431_STAA8      --------------------DVITVAVGYYLRYTLSYRDISEILRERGVNVHHSTVYRWVQEYAPILYQI
T257_STAAU      --------------------DVITVAVGYYLRYALSYRDISEILRGRGVNVHHSTVYRWVQEYAPILYQI
Y4551_YERPS     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FRRHKRSVSKSWRMDETYLKVRGKWAYLYRAVDKAGNTIDFLLCARRDKVAARRYFEKAIGQNGAPDTVA
T431_STAAW      WXXXXXXXXXXWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVI
T431_STAAN      WXXXXXXXXXXWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVI
T431_STAAM      WXXXXXXXXXXWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVI
T431_STAA8      WXXXXXXXXXXWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVI
T257_STAAU      WXXXXXXXXXXWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVI
Y4551_YERPS     ----------SWQLDEIYIRVNGKWFYLYRAINKHGTTLDFYFSPKRNKNTAYPFIKRVL----------


                         +         .         .         .         .         *         .:210
query           IDKSXXXXXXXXXXXXXRETPIRIRQRKYLNNIVEQDHRAIKRRARPMLGFKNFRCARILIGGIETMHMI
T431_STAAW      TDQASTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKRKTR----YQSINTAKNTLKGIECIYAL
T431_STAAN      TDQASTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKRKTR----YQSINTAKNTLKGIECIYAL
T431_STAAM      TDQASTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKRKTR----YQSINTAKNTLKGIECIYAL
T431_STAA8      TDQASTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKRKTR----YQSINTAKNTLKGIECIYAL
T257_STAAU      TDQASTKVAMAKVIKAFKLKPDCHCTSKYLNNLIEQDHRHIKRKTR----YQSINTAKNTLKGIECIYAL
Y4551_YERPS     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
T431_STAAW      YK--------------------------------------------------------------------
T431_STAAN      YK--------------------------------------------------------------------
T431_STAAM      YK--------------------------------------------------------------------
T431_STAA8      YK--------------------------------------------------------------------
T257_STAAU      YK--------------------------------------------------------------------
Y4551_YERPS     ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
T431_STAAW      -------------------------------------------------------------
T431_STAAN      -------------------------------------------------------------
T431_STAAM      -------------------------------------------------------------
T431_STAA8      -------------------------------------------------------------
T257_STAAU      -------------------------------------------------------------
Y4551_YERPS     -------------------------------------------------------------