[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08608.1

[Show Plain Result]


## Summary of Sequence Search
    1::405
   39::430     6e-79  40%  436 aa  CG010_MOUSE RecName: Full=CaiB/baiF CoA-transferase family protein
   30::365     8e-79  44%  471 aa  Y9880_DICDI RecName: Full=CaiB/baiF CoA-transferase family protein
   48::439     3e-78  39%  445 aa  CG010_HUMAN RecName: Full=CaiB/baiF CoA-transferase family protein
   39::414     2e-77  41%  436 aa  CG010_RAT RecName: Full=CaiB/baiF CoA-transferase family protein
   11::373     2e-61  36%  381 aa  YFDE_ECOLI RecName: Full=Uncharacterized protein yfdE;
    1::416     5e-49  34%  425 aa  FCTA_BRASO RecName: Full=Formyl-coenzyme A transferase;       
    1::416     5e-49  34%  425 aa  FCTA_BRASB RecName: Full=Formyl-coenzyme A transferase;       
    1::384     8e-48  34%  409 aa  FCTA_STRAW RecName: Full=Formyl-coenzyme A transferase;       
    6::385     1e-46  34%  410 aa  FCTA_STRCO RecName: Full=Formyl-coenzyme A transferase;       
    1::416     4e-46  33%  424 aa  FCTA_OLICO RecName: Full=Formyl-coenzyme A transferase;       
    1::416     4e-46  34%  425 aa  FCTA_BRAJA RecName: Full=Formyl-coenzyme A transferase;       
    1::416     3e-45  32%  426 aa  FCTA_RHOPB RecName: Full=Formyl-coenzyme A transferase;       
    1::416     5e-45  32%  425 aa  FCTA_RHOPS RecName: Full=Formyl-coenzyme A transferase;       
    1::414     5e-44  31%  425 aa  FCTA_RHOPA RecName: Full=Formyl-coenzyme A transferase;       
    1::414     7e-44  31%  425 aa  FCTA_RHOPT RecName: Full=Formyl-coenzyme A transferase;       
    1::416     1e-43  31%  425 aa  FCTA_RHOP2 RecName: Full=Formyl-coenzyme A transferase;       
    1::416     3e-42  31%  425 aa  FCTA_RHOP5 RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  36%  416 aa  FCTA_SHISS RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_SHIFL RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_SHIF8 RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_SHIDS RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_SHIBS RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  32%  416 aa  FCTA_SHIB3 RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECOUT RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECOSM RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECOSE RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECOLU RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECOLI RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECOLC RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECOL5 RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECOK1 RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECOHS RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECODH RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECOBW RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECO8A RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECO81 RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECO7I RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECO5E RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECO57 RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECO55 RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECO45 RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECO27 RecName: Full=Formyl-coenzyme A transferase;       
    1::416     6e-29  33%  416 aa  FCTA_ECO24 RecName: Full=Formyl-coenzyme A transferase;       
    1::428     3e-28  36%  428 aa  FCTA_OXAFO RecName: Full=Formyl-coenzyme A transferase;       
    1::416     3e-28  32%  416 aa  FCTA_ECOL6 RecName: Full=Formyl-coenzyme A transferase;       
    3::364     3e-24  26%  382 aa  AMACR_HUMAN RecName: Full=Alpha-methylacyl-CoA racemase;       
   13::401     5e-21  25%  406 aa  CAIB_PROMH RecName: Full=Crotonobetainyl-CoA:carnitine
   13::401     4e-20  25%  406 aa  CAIB_PROSL RecName: Full=Crotonobetainyl-CoA:carnitine
   13::400     3e-19  25%  426 aa  BAIF_EUBSP RecName: Full=Bile acid-CoA hydrolase;       
    3::373     2e-18  24%  382 aa  AMACR_RAT RecName: Full=Alpha-methylacyl-CoA racemase;       
   12::400     8e-18  25%  405 aa  CAIB_SALTY RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     8e-18  25%  405 aa  CAIB_SALCH RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     1e-17  25%  405 aa  CAIB_SALTI RecName: Full=Crotonobetainyl-CoA:carnitine
    2::177     2e-17  30%  381 aa  AMACR_MOUSE RecName: Full=Alpha-methylacyl-CoA racemase;       
   12::400     2e-17  25%  405 aa  CAIB_SALPK RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-17  25%  405 aa  CAIB_SALPA RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-17  25%  405 aa  CAIB_SALEP RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-17  23%  405 aa  CAIB_ECOUT RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-17  23%  405 aa  CAIB_ECOSM RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-17  23%  405 aa  CAIB_ECOL6 RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-17  23%  405 aa  CAIB_ECOK1 RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-17  23%  405 aa  CAIB_ECO81 RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-17  23%  405 aa  CAIB_ECO7I RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-17  23%  405 aa  CAIB_ECO45 RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-17  23%  405 aa  CAIB_ECO27 RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-17  23%  405 aa  CAIB_ECO24 RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     3e-17  23%  405 aa  CAIB_SHIDS RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     4e-17  23%  405 aa  CAIB_ECOSE RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     4e-17  23%  405 aa  CAIB_ECOLI RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     4e-17  23%  405 aa  CAIB_ECOLC RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     4e-17  23%  405 aa  CAIB_ECODH RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     4e-17  23%  405 aa  CAIB_ECOBW RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     4e-17  23%  405 aa  CAIB_ECO5E RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     4e-17  23%  405 aa  CAIB_ECO57 RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     5e-17  23%  405 aa  CAIB_ECOLU RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     7e-17  23%  405 aa  CAIB_SHIFL RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     7e-17  23%  405 aa  CAIB_ECOL5 RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     7e-17  23%  405 aa  CAIB_ECOHS RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     7e-17  23%  405 aa  CAIB_ECO8A RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     7e-17  23%  405 aa  CAIB_ECO55 RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     9e-17  23%  405 aa  CAIB_SHIF8 RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     1e-16  23%  405 aa  CAIB_ESCF3 RecName: Full=Crotonobetainyl-CoA:carnitine
   12::400     2e-16  23%  405 aa  CAIB_SALG2 RecName: Full=Crotonobetainyl-CoA:carnitine
    1::177     4e-16  31%  340 aa  YS74_CAEEL RecName: Full=CaiB/baiF CoA-transferase family protein
    1::405

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSAILQGIKVLDLTRVVAGPWATQNLADMGATVYKIEKPGDGDDTRRMGPFLTDGDGNVTNDSAFFLCCN
CG010_MOUSE     ----LEGVRILDLTRVLAGPFATMNLGDLGAEVIKVERPGAGDDTRSWGPPF------VNTESTYFLSVN
Y9880_DICDI     ----LNGFKILDLSRVLAGPYATQIFGDLGAQVIKVENVGKGDDTRQYGPFYVDEQGR--KGSAYFSCAN
CG010_HUMAN     ----LEGVKILDLTRVLAGPFATMNLGDLGAEVIKVERPGAGDDTRTWGPPF------VGTESTYYLSVN
CG010_RAT       ----LEGVRILDLTRVLAGPFATMNLGDLGAEVIKVERPGAGDDTRSWGPPF------VNTESTYFLSVN
YFDE_ECOLI      -----EGLLVIDMTHVLNGPFGTQLLCNMGARVIKVEPPGHGDDTRTFGPY-------VDGQSLYYSFIN
FCTA_BRASO      MTKALEGVRILDFTHVQSGPTCTQLLAWFGADVIKVERPGVGDITRGQ---LQD----IPNDSLYFTMLN
FCTA_BRASB      MTKALEGVRILDFTHVQSGPTCTQLLAWFGADVIKVERPGVGDITRGQ---LQD----IPNDSLYFTMLN
FCTA_STRAW      MTKALEGIRVLDMTHVQSGPSATQLLAWLGADVVKLEAP-TGDITRGQLRDLPDVD------SLYFTMLN
FCTA_STRCO      ----LEGIRVLDMTHVQSGPSATQLLAWLGADVVKLEAP-HGDITRGQLRDLPDVD------SLYFTMLN
FCTA_OLICO      MAKALNGVRILDFTHVQSGPTCTQLLAWFGADVIKVERPGTGDITRGQ---LQD----VPNDSLYFTMLN
FCTA_BRAJA      MTKALTGVRILDFTHVQSGPTCTQLLAWFGADVIKVERPGVGDITRGQ---LQD----IPNDSLYFTMLN
FCTA_RHOPB      MTKALNGVRILDFTHVQSGPTCTQLLAWFGADVIKVERPGVGDITRGQ---LQD----IPNDSLYFTMLN
FCTA_RHOPS      MTKALDGVRILDFTHVQSGPTCTQLLAWFGADVIKVERPGTGDITR----------GQLQDDSLYFTMLN
FCTA_RHOPA      MTKALDGVRVLDFTHVQSGPTCTQLLAWFGADVIKVERPGSGDITR----------GQLQDDSLYFTMLN
FCTA_RHOPT      MTKALDGVRVLDFTHVQSGPTCTQLLAWFGADVIKVERPGSGDITR----------GQLQDDSLYFTMLN
FCTA_RHOP2      MTKALDGVRILDFTHVQSGPTCTQLLAWFGADVIKVERPGTGDITR----------GQLQDDSLYFTMLN
FCTA_RHOP5      MTKALDGVRILDFTHVQSGPTCTQLLAWFGADVIKVERPGVGDITRGQLQDLP----NV--DSLYFTMLN
FCTA_SHISS      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_SHIFL      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_SHIF8      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_SHIDS      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_SHIBS      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_SHIB3      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECOUT      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECOSM      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECOSE      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECOLU      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECOLI      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECOLC      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECOL5      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECOK1      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECOHS      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECODH      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECOBW      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECO8A      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECO81      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGFGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECO7I      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECO5E      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECO57      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECO55      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECO45      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECO27      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_ECO24      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTRHQLRDIPD------IDALYFTMLN
FCTA_OXAFO      MTKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRG---WLQDKP-NV--DSLYFTMFN
FCTA_ECOL6      MSTPLQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPSVGDVTRHQLRDIPD------IDALYFTMLN
AMACR_HUMAN     ----LQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLG---------------------
CAIB_PROMH      ----LAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQPHYPQ-------------LSR
CAIB_PROSL      ----LAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQPHYPQ-------------LSR
BAIF_EUBSP      ----LAGLKILDSGSNIAGPLGGGLLAECGATVIHFEGPKKPDNQRGWYGYPQN---------------H
AMACR_RAT       ----LRGVRVLELAGLAPGPFCGMILADFGAEVVLVDRLGSVNHPSHLA---------------------
CAIB_SALTY      ----LAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_SALCH      ----LAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_SALTI      ----LAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
AMACR_MOUSE     ---VLRGVRVVELAGLAPGPFCGMVLADFGAEVVRVNRLGSTGEN--------------------FLA--
CAIB_SALPK      ----LAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_SALPA      ----LAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_SALEP      ----LAGVRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECOUT      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECOSM      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECOL6      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECOK1      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECO81      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECO7I      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECO45      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECO27      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECO24      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_SHIDS      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECOSE      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECOLI      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECOLC      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECODH      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECOBW      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECO5E      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECO57      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECOLU      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_SHIFL      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECOL5      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECOHS      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECO8A      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ECO55      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_SHIF8      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_ESCF3      ----LAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
CAIB_SALG2      ----LAGVRVVFSGIEIAAPFAGQMFAEWGAEVIWIENVA-WADTIRVQP-------------NYPQLSR
YS74_CAEEL      MYRFLSGIKVVEIAGLAPVPHCGMMLADFGADVTVIDKKNPAIEQR----------------------LN


                         .         .         *         .         .         .         .:140
query           RGKQSVTVDISQPEGAELVRQLASHCDVVVENYKAGSLKKYGLDYESIRALRPDIIYCSVTGFGPDGPYA
CG010_MOUSE     RNKKSIAVNIKDPRGVRIVKELAAICDVFVENYVPGKLSEMGLGYEDIDKIAPHIIYCSITGYGQTGPMS
Y9880_DICDI     RNKKSIALDISTKEGQDIVYSLAKESDVFIENFKVGGLKKYSLDYETIKQINPSIIYCSITGFGQDGEYS
CG010_HUMAN     RNKKSIAVNIKDPKGVKIIKELAAVCDVFVENYVPGKLSAMGLGYEDIDEIAPHIIYCSITGYGQTGPIS
CG010_RAT       RNKKSIAVNIKDPRGVRIVKELAAICDVFVENYVPGKLSEMGLGYADIDKIAPHIVYCSITGYGQTGPMS
YFDE_ECOLI      HGKESVVLDLKNDHDKSIFINMLKQADVLAENFRPGTMEKLGFSWETLQEINPRLIYASSSGFGHTGPLK
FCTA_BRASO      HNKRSITLDTKNPKGKEVLTELIKKCDVLVENFGPGVLDRMGFPWEKIQAINPKMIVASIKGFGP-GPYE
FCTA_BRASB      HNKRSITLDTKNPKGKEVLTELIKKCDVLVENFGPGVLDRMGFPWEKIQAINPKMIVASIKGFGP-GPYE
FCTA_STRAW      CNKRSITLNTKTERGKEILTELIRRSDVMVENFGPGAVDRMGFTWDRIRDINPRIVYASIKGFG-DGPYT
FCTA_STRCO      CNKRSITLNTKSERGKEILTELIRRSDVMVENFGPGAVDRMGFTWDRVKEINPRIVYASIKGFG-EGPYT
FCTA_OLICO      HNKRSITLDAKNPKGKEVLTALIKSCDVMVENFAPGVLDRMGFSWENIQKINPKLIVASIKGFGP-GPFE
FCTA_BRAJA      HNKRSITLDTKNPKGKEVLTELIKKCDVLVENFGPGVLDRMGFPWEKIQQINPKMIVASIKGFGP-GPYE
FCTA_RHOPB      HNKRSITLDTKNPKGKEVLTALIKSCDVLVENFGPGVLDRMGFSWEKIQSLNPKMIVASIKGFGP-GPYE
FCTA_RHOPS      HNKRSITLDTKNPKGKEVLTALIRSCDVLVENFGPGVLDRMGFTWDKIQEINPRMIVASIKGFGP-GPYE
FCTA_RHOPA      HNKRSITLDTKNPKGKEVLTALIRTCDVLVENFGPGVLDRMGFTWEKIQEINPRMIVASIKGFGP-GPYE
FCTA_RHOPT      HNKRSITLDTKNPKGKEVLTALIRTCDVLVENFGPGVLDRMGFTWEKIQEINPRMIVASIKGFGP-GPYE
FCTA_RHOP2      HNKRSITLDTKNPKGKEVLTALIRSCDVLVENFGPGVLDRMGFTWDKIQEINPRMIVASIKGFGP-GPYE
FCTA_RHOP5      HNKRSITLDTKNPKGKEVLTELIKTCDVLVENFGPGVLDRMGFPWEKIQSINPKMIVASIKGFGP-GPYE
FCTA_SHISS      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_SHIFL      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_SHIF8      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_SHIDS      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_SHIBS      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_SHIB3      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECOUT      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECOSM      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECOSE      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECOLU      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECOLI      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECOLC      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECOL5      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECOK1      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECOHS      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECODH      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECOBW      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECO8A      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECO81      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECO7I      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECO5E      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECO57      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECO55      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECO45      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECO27      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_ECO24      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
FCTA_OXAFO      CNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANE
FCTA_ECOL6      SNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINPRLIFGSIKGFDECSPYV
AMACR_HUMAN     RGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFC
CAIB_PROMH      RNLHALSLNIFKEEGRDAFLKLMETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQDPQYT
CAIB_PROSL      RNLHALSLNIFKDGGRDAFLKLMETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQDPQYT
BAIF_EUBSP      RNQLSMVADIKSEEGRKIFLDLIKWADIWVESSKGGQYDRLGLSDEVIWEVNPKIAIVHVSGYGQTGSYV
AMACR_RAT       RGKRSLALDLKRSPGAAVLRRMCARADVLLEPFRCGVMEKLQLGPETLRQDNPKLIYARLSGFGQSGIFS
CAIB_SALTY      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQYGEYT
CAIB_SALCH      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQYGEYT
CAIB_SALTI      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQYGEYT
AMACR_MOUSE     RGKRSLALDLKRSQGVTVLRRMCARADVLLEPFRCGVMEKLQLGPETLLQDNPKLIYARLSGFGQSGIFS
CAIB_SALPK      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQYGEYT
CAIB_SALPA      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQYGEYT
CAIB_SALEP      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQYGEYT
CAIB_ECOUT      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECOSM      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECOL6      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECOK1      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECO81      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECO7I      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECO45      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECO27      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECO24      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_SHIDS      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECOSE      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECOLI      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECOLC      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECODH      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECOBW      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECO5E      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECO57      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECOLU      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_SHIFL      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECOL5      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECOHS      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECO8A      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ECO55      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_SHIF8      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_ESCF3      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWQHNPKLVIAHLSGFGQYGEYT
CAIB_SALG2      RNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARRGITDEVLWEHNPKLVIAHLSGFGQYGEYT
YS74_CAEEL      RGKTMKQLDLKNPEDIKKVRDLCQTSDVLLDPYRPGTLEKMGLDPSTLWNNNKGLIICKISGYGQTGRMS


                         +         .         .         .         .         *         .:210
query           PRPAYDFILQGMAGLMSTCGQPDGTPGAAPMRTAIPLTDILTGLYASVALMGALYHRQATGEGQFXXXXX
CG010_MOUSE     HRAGYDAIASAMSGLMHITGPEDGD----PVRPGVAMTDLATGLFAYGAIMAGLLQRYRTGKGLFIDCNL
Y9880_DICDI     KLPGYDFSVQAMGGLISITGDKEN-----PYKCGVAIVDMMTGLYANIAIQAALHHREKSKDGQYIDVSL
CG010_HUMAN     QRAGYDAVASAVSGLMHITGPENGDP----VRPGVAMTDLATGLYAYGAIMAGLIQKYKTGKGLFIDCNL
CG010_RAT       HRAGYDAIASAMSGLMHITGPEDGD----PVRPGVAMTDLATGLFAYGAIMAGLIQRYRTGKGLFIDCNL
YFDE_ECOLI      DAPAYDTIIQAMSGIMMETGYPD----APPVRVGTSLADLCGGVYLFSGIVSALYGREKSQRGAHVDIAM
FCTA_BRASO      DCKVYENVAQCTGGAASTTGFRDG----LPLVTGAQIGDSGTGLHLALGIVTALYQRTHTGRGQLCRVKL
FCTA_BRASB      DCKVYENVAQCTGGAASTTGFRDG----LPLVTGAQIGDSGTGLHLALGIVTALYQRTHTGKGQLCRVKL
FCTA_STRAW      DFKAYEVVAQAMGGSMSTTGFEDG----PPLATGAQIGDSGTGIHAVAGILAALYQRENTGRGQMQHAVL
FCTA_STRCO      AFKAYEVVAQAMGGSMSTTGFEDG----PPLATGAQIGDSGTGVHVVAGILAALYQREHTGRGQMQHAVL
FCTA_OLICO      DCKVYENVAQCTGGSASTTGFRDG----LPLVTGAQIGDSGTGLHLALGIVTALFHRTHSGKGQDSVLNL
FCTA_BRAJA      DCKVYENVAQCTGGAASTTGFRDG----LPLVTGAQIGDSGTGLHLALGIVTALYQRTHSGKGQDGVLNL
FCTA_RHOPB      DCKVYENVAQCTGGAASTTGFRDG----LPLVTGAQIGDSGTGLHLALGIVTALYQRTVTGRGQKVTAAM
FCTA_RHOPS      DCKVYENVAQCTGGAASTTGFRDG----PPLVTGAQIGDSGTGLHLALGIVTALYQRQHTGRGQRVTAAM
FCTA_RHOPA      DCKVYENVAQCTGGAASTTGFREG----LPLVTGAQIGDSGTGLHLALGIVTALYQRHHTGRGQLCRVKL
FCTA_RHOPT      DCKVYENVAQCTGGAASTTGFREG----LPLVTGAQIGDSGTGLHLALGIVTALYQRHHTGRGQLCRVKL
FCTA_RHOP2      DCKVYENVAQCTGGAASTTGFRDG----PPLVTGAQIGDSGTGLHLALGIVTALYQRHHTGRGQRVTAAM
FCTA_RHOP5      DCKVYENVAQCTGGAASTTGFRDG----PPLVTGAQIGDSGTGLHLALGIVTALYXXXVTAAMQDGVLNL
FCTA_SHISS      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_SHIFL      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_SHIF8      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_SHIDS      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_SHIBS      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_SHIB3      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECOUT      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECOSM      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECOSE      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECOLU      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECOLI      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECOLC      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECOL5      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECOK1      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECOHS      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECODH      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECOBW      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECO8A      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECO81      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECO7I      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECO5E      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECO57      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECO55      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECO45      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECO27      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_ECO24      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
FCTA_OXAFO      HLKVYENVAQCSGGAAATTGFWDGPPTV----SGAALGDSNSGMHLMIGILAALEMRHKTGRGQ------
FCTA_ECOL6      NVKAYENVXXXXXXXXSTTGFWDG----PPLVSAAALGDSNTGMHXXXXXXXXXXHREKTGRGQ------
AMACR_HUMAN     RLAGHDINYLALSGVLSKIGRSGENP-YAPLNLLADFAG--GGLMCALGIIMALFDRTRTGKGQVIDANM
CAIB_PROMH      NLPAYNTIAQAFSGYLIQNGDKD-----QPM-PAFPYTDYFSGMTATTSALAALYKVQQTGKGESIDIAM
CAIB_PROSL      NLPAYNTIAQAFSGYLIQNGDKD-----QPM-PAFPYTDYFSGMTATTSALAALYKVQQTGKGESIDIAM
BAIF_EUBSP      TRASYDAVGQAFSGYMSLNGTTEA------LKINPYLSDFVCGLTTCWAMLACYVSTILTGKGESVDVAQ
AMACR_RAT       KVAGHDINYVALSGVLSKIGRSGENP--------YPPLNLLAGLMCTLGILLALFERTRSGLGQVIDANM
CAIB_SALTY      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGMXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_SALCH      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGMXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_SALTI      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGMXXXXXXXXXXHKVRETGKGESIDIAM
AMACR_MOUSE     KVAGHDINYLALSGVLSKIGRSGENP--------YPPLNLLAGLMCTLGIVLALFERTRSGRGQ------
CAIB_SALPK      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGMXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_SALPA      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGMXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_SALEP      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGMXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECOUT      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECOSM      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECOL6      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECOK1      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECO81      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECO7I      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECO45      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECO27      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECO24      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKARETGKGESIDIAM
CAIB_SHIDS      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKARETGKGESIDIAM
CAIB_ECOSE      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECOLI      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECOLC      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECODH      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECOBW      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECO5E      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKARETGKGESIDIAM
CAIB_ECO57      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKARETGKGESIDIAM
CAIB_ECOLU      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKARETGKGESIDIAM
CAIB_SHIFL      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECOL5      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECOHS      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECO8A      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ECO55      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_SHIF8      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETGKGESIDIAM
CAIB_ESCF3      NLPAYNTIAQAFSGYLIQNGDVD-----QPM-PAFPYTDYFSGXXXXXXXXXXXHKVRETSKGESIDIAM
CAIB_SALG2      NLPAYNTIAQAFSGYLIQNGDVD-----QPMPPFPYTADYFSGMXXXXXXXXXXHKVRETGKGESIDIAM
YS74_CAEEL      QETGHDINYVALSGMLPTF---SGVNATRPWPPANMLADFAGGLSAAFGILSAIYARSHNG---------


                         .         .         .         +         .         .         .:280
query           XXXXXXXNGHLALGYHMTGKVPQRAGNSNPVASPSEVFACLDGHVIIAAGNNGQFAALCRVIGCASLIED
CG010_MOUSE     LSSQVACLTQVAANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYLVIGAGNNQQFAVVCKILNLPELIDD
Y9880_DICDI     LDVQASFLANHGSSYLVTGETSERVGNSHPSISPYDSLKTKDGFMVVAIGNNTQFQSMCNVLGLPHLSTN
CG010_HUMAN     LSSQVACLSHIAANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYIVVGAGNNQQFATVCKILDLPELIDN
CG010_RAT       LSSQVACLTQVAANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYLVIGAGNNQQFAVLCKILNLPELIDD
YFDE_ECOLI      FDATLSFLEHGLMAYIATGKSPQRLGNRHPYMAPFDVFNTQDKPITICCGNDKLFSALCQALELTELVND
FCTA_BRASO      RDQQRLDHGPLKEYSQFGEGVPPRAGNDSGGGQPGRILKCKGWETIYFITQAPVWEKICDVIGEPTWKTD
FCTA_BRASB      RDQQRLERGPLKEYSQFGEGVPPRAGNDSGGGQPGRILKCKGWETIYFITQAPVWEKICDVIGEPTWKTD
FCTA_STRAW      NLCRVKLRDQQRLAHGPLAEYPNRSGNASGGGQPGWAVKCAPGYVYVIVQPVG-WKPLSELIGRPELADD
FCTA_STRCO      NLCRVKLRDQQRLSHGPLAEYPNRSGNASGGGQPGWAVKCAPGYVYVIVQPVG-WQPLSELIGRPELAED
FCTA_OLICO      CRVKMRDQQRLAHGYSQFGEATPRAGNDSGGGQPGRILKCKGWETIYFITQAAVWEKICDVIGEPTWKTD
FCTA_BRAJA      ARVKLRDQQRLAHGYSQFGEIPPRAGNDSGGGQPGRILKCKGWETIYFITQAPVWEKICDVIGEPTWKTD
FCTA_RHOPB      QDGVLNLSQRLAHGYSQFGEIPPRAGNDSGGGQPGRILKCKGWETIYFITQAPVWEKICDVIGEPDWKTH
FCTA_RHOPS      QDGVLNLSQRLAHGYSQFGEIPPRAGNDSGGGQPGRILKCKGWETIYFITQAPVWEKICDVIGETGWKTH
FCTA_RHOPA      RDQQRLDHGPLKEYSQFGEGIPPRAGNDSGGGQPGRILKCKPNAYIYVITQAPVWEKICDVIGETGWKTH
FCTA_RHOPT      RDQQRLDHGPLKEYSQFGEGIPPRAGNDSGGGQPGRILKCKPNAYIYVITQAPVWEKICDVIGETGWKMH
FCTA_RHOP2      QDGVLNLSQRLAHGYSQFGEIPPRAGNDSGGGQPGRILKCKGWETIYFIAQAPVWEKICDVIGETGWKTH
FCTA_RHOP5      TRVKLRDQQRLAHGPLKEGEAVPRAGNDSGGGQPGRILKCKGWQTIYFITQAPVWEKICDVINEPDWKTH
FCTA_SHISS      ----------------------------------------------------------------------
FCTA_SHIFL      ----------------------------------------------------------CKAIGKPEWITD
FCTA_SHIF8      ----------------------------------------------------------CKAIGKPEWITD
FCTA_SHIDS      ----------------------------------------------------------CKAIGKPDWITD
FCTA_SHIBS      ----------------------------------------------------------CKAIGKPEWITD
FCTA_SHIB3      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECOUT      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECOSM      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECOSE      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECOLU      ----------------------------------------------------------CKAIGKPDWITD
FCTA_ECOLI      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECOLC      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECOL5      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECOK1      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECOHS      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECODH      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECOBW      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECO8A      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECO81      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECO7I      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECO5E      ----------------------------------------------------------CKAIGKPDWITD
FCTA_ECO57      ----------------------------------------------------------CKAIGKPDWITD
FCTA_ECO55      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECO45      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECO27      ----------------------------------------------------------CKAIGKPEWITD
FCTA_ECO24      ----------------------------------------------------------CKAIGKPEWITD
FCTA_OXAFO      ----------------------------------------------------------------------
FCTA_ECOL6      ----------------------------------------------------------CKAIGKPEWITD
AMACR_HUMAN     VEGTAYLSSFLWKTQKSSLWEAPRGQNMLDGGAPYTTYRTADGEFMAVGAIEPQFYEL--LIKGLGLKSD
CAIB_PROMH      YEVMLRMGQYFMMDYFNGGEIPRMTKGKDPYYAGCGLYRCQDGYIVMEVVGITQIEEIFKDIGLAHLLEV
CAIB_PROSL      YEVMLRMGQYFMMDYFNGGEIPRMTKGKEPYYAGCGLYRCQDGYIVMEVVGITQIEEIFKDIGLAHLLEV
BAIF_EUBSP      YEALARIMDGRMIQYATDGVKMPRTGNKDAQAALFSFYTCKDGRTIF-IGMTG--AEVCKIIGLVPGTGD
AMACR_RAT       VEGTAYLSTFLWKTQAMGLWAQPRGQNLLDGGAPYTTYKTADGEFMAVGAIEPQFYTXXXXXXXXXXXXX
CAIB_SALTY      YEVMLRMGQYFMMDYFNGGEIPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILEV
CAIB_SALCH      YEVMLRMGQYFMMDYFNGGEIPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILEV
CAIB_SALTI      YEVMLRMGQYFMMDYFNGGEIPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILEV
AMACR_MOUSE     ----------------------------------------------------------------------
CAIB_SALPK      YEVMLRMGQYFMMDYFNGGEIPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILEV
CAIB_SALPA      YEVMLRMGQYFMMDYFNGGEIPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILEV
CAIB_SALEP      YEVMLRMGQYFMMDYFNGGEIPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILEV
CAIB_ECOUT      YEVMLRMGQYFMMDYFNGGEMPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQIAECFKDIGLAHLLGT
CAIB_ECOSM      YEVMLRMGQYFMMDYFNGGEMPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQIAECFKDIGLAHLLGT
CAIB_ECOL6      YEVMLRMGQYFMMDYFNGGEMPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQIAECFKDIGLAHLLGT
CAIB_ECOK1      YEVMLRMGQYFMMDYFNGGEMPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQIAECFKDIGLAHLLGT
CAIB_ECO81      YEVMLRMGQYFMMDYFNGGEMPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQIAECFKDIGLAHLLGT
CAIB_ECO7I      YEVMLRMGQYFMMDYFNGGEMPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQIAECFKDIGLAHLLGT
CAIB_ECO45      YEVMLRMGQYFMMDYFNGGEMPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQIAECFKDIGLAHLLGT
CAIB_ECO27      YEVMLRMGQYFMMDYFNGGEMPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQIAECFKDIGLAHLLGT
CAIB_ECO24      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLST
CAIB_SHIDS      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_ECOSE      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLST
CAIB_ECOLI      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_ECOLC      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_ECODH      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_ECOBW      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_ECO5E      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_ECO57      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_ECOLU      YEVMLRMGQYFMMDYFNGGEMPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_SHIFL      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_ECOL5      YEVMLRMGQYFMMDYFNGGEMPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQITECFKDIGLAHLLGT
CAIB_ECOHS      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_ECO8A      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_ECO55      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_SHIF8      YEVMLRMGQYFMMDYFNGGEMPRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGT
CAIB_ESCF3      YEVMLRMGQYFMMDYFNGGEMPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQIAECFKDIGLAHLLGT
CAIB_SALG2      YEVMLRMGQYFMMDYFNGGEIPRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILEA
YS74_CAEEL      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PRFLQNMDRVRNRPVLRETLGERLLNWRLADLIQALEGAGVPCGPINDIDDVFDDPQVRHRELLVRLPHG
CG010_MOUSE     SKYRTNHLRVQNRKELVKILSARFAEEVTAKWLCLFEGSGIPYGPINSLKDVFSEAQVLHNGLVMEMNHP
Y9880_DICDI     PLFSTNPSRVLNRKQLLSILTNETLKFNTDDIVKLLGDSNVPCSPINSIDKVVNHKQIKHRNMI------
CG010_HUMAN     SKYKTNHLRVHNRKELIKILSERFEEELTSKWLYLFEGSGVPYGPINNMKNVFAEPQVLHNGLVMEMEHP
CG010_RAT       SKYRTNHLRVQNRKELVKILSARFAEEVTAKWLCLFEGSGIPYGPINSLKDVFSEAQVLHNGLVMEMNHP
YFDE_ECOLI      PRFSSNILRVQNQAILKQYI-ERTLKTQAAEVLARIHEVGVPVAPLLSVAEAIKLPQTQARNMLI---EA
FCTA_BRASO      PNYAKPAARL---PRLNEIFG-RIEQWTMTEAMDILNEFDIPCGPILSMKEIAEDESLRKTGTLVEVDHP
FCTA_BRASB      PNYAKPAARL---PRLNEIFG-RIEQWTMTEAMDILNEFDIPCGPILSMKEIAEDESLRKTGTLVEVDHP
FCTA_STRAW      PEWATPEARLPQLTKMFQLIEEWSATLPKWEVLEKLNAHNIPCGPILSTKEIVEDASLVANEMVVTVPHP
FCTA_STRCO      PEWAARLPKLNKMFQLIEEWSSTLPKW---EVLERLNAHNIPCGPILSTKEIIEDDSLVANEMVVTVPHP
FCTA_OLICO      PNYAKPGARL---PRLNEIFG-RIEQWTMTEVMNICNPFDIPCGPILSMKEIAEDKSLYATGTLVEVDHP
FCTA_BRAJA      PNYAKPAARL---PRLNEIFA-RIEQWTMTEAMEILNKDDIPCGPILSMKEIAEDQSLRATGTVVEVDHP
FCTA_RHOPB      PDYAKPAARLKHLNDIFARIEQWTMTKTKFEAMDILNKDDIPCGPILSMKELAEDQSLRATGTVVEVDHP
FCTA_RHOPS      PDYATPPARLKHLNDIFARIEQWTMTKTKFEAMDILNSDDIPCGPILSMKELAEDPSLRATGTVVEVDHP
FCTA_RHOPA      PDYATPPARLSRLNEIFARIEQWTMTKTKFEAMEILNADDIPCGPILSMKELAEDQSLRATGTIVEVDHP
FCTA_RHOPT      PDYATPPARLSRLNEIFARIEQWTMTKTKFEAMEILNADDIPCGPILSMKELAEDQSLRATGTIVEVDHP
FCTA_RHOP2      PDYATPPARLKHLNDIFARIEQWTMTKTKFEAMDILNRDDIPCGPILSMKELAEDASLRATGTIVEVDHP
FCTA_RHOP5      AEYAKPAARLKHLNSIFARIEEWTMTKTKFEAMDILNEYDIPCGPILSMKELAEDPSLRATGTVVEVEHP
FCTA_SHISS      ----------------------------------------IPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_SHIFL      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_SHIF8      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_SHIDS      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_SHIBS      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_SHIB3      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECOUT      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECOSM      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECOSE      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECOLU      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECOLI      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECOLC      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECOL5      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECOK1      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECOHS      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECODH      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECOBW      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECO8A      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECO81      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECO7I      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECO5E      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECO57      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECO55      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECO45      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECO27      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_ECO24      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
FCTA_OXAFO      ---------------------------------------GIPCGPVMSMKELAHDPSLQKVGTVVEVVDE
FCTA_ECOL6      PAYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQSGSVVEVEQP
AMACR_HUMAN     E--LPNQMSMDDWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQ
CAIB_PROMH      PKGTQLIHRINHGQLFEDKLDEWLANQPITAVLKRLSELNIASAKVLTIPELEGNPQYVARESITQWKTM
CAIB_PROSL      PKGTQLIHRINHGQLFEDELDEWLANQPITAVLKRLSELNIASAKVLTIPELEGNPQYVARESITQWKTM
BAIF_EUBSP      PDFPEGFTGMIYTPVMEKAMEKYVSEHTMEEVEAEMQAHQIPCQRVYELEDCLNDPHWKARGTITEWDDP
AMACR_RAT       PSQMS----IEDWPEMKKKFADVFARKTKAEWCQIFDGTDACVTPVLTLEEALHHQHNRERGSFIEEQHA
CAIB_SALTY      PEGTQLIHRVEYGPLVEEKLDAWLATHTIADVQARFAELNIACAKVLTIPELEGNPQYVARESITQWQTM
CAIB_SALCH      PEGTQLIHRVEYGPLVEEKLDAWLATHTIADVQARFAELNIACAKVLTIPELEGNPQYVARESITQWQTM
CAIB_SALTI      PEGTQLIHRVEYGPLVEEKLDAWLAAHTIADVQARFAELNIACAKVLTIPELEGNPQYVARESITQWQTM
AMACR_MOUSE     ----------------------------------------------------------------------
CAIB_SALPK      PEGTQLIHRVEYGPLVEEKLDAWLATHTIAEVQARFAELNIACAKVLTIPELEGNPQYVARESITQWQTM
CAIB_SALPA      PEGTQLIHRVEYGPLVEEKLDAWLATHTIAEVQARFAELNIACAKVLTIPELEGNPQYVARESITQWQTM
CAIB_SALEP      PEGTQLIHRVEYGPLVEEKLDAWLATHTIAEVQARFAELNIACAKVLTIPELEGNPQYVARESITQWQTM
CAIB_ECOUT      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECOSM      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECOL6      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECOK1      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECO81      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECO7I      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECO45      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECO27      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECO24      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_SHIDS      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECOSE      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECOLI      PEIPEGTQLIHRGPLVEEKLDAWLATHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECOLC      PEIPEGTQLIHRGPLVEEKLDAWLATHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECODH      PEIPEGTQLIHRGPLVEEKLDAWLATHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECOBW      PEIPEGTQLIHRGPLVEEKLDAWLATHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECO5E      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECO57      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECOLU      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_SHIFL      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECOL5      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECOHS      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECO8A      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ECO55      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_SHIF8      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKKRFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_ESCF3      PEIPEGTQLIHRGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESITQWQTM
CAIB_SALG2      PEGTQLIHRVEYGPLVEEKLDAWLATHTIAEVQARFAELNIACAKVLTIPELEGNPQYVARESITQWQTM
YS74_CAEEL      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SGVEAPTLRSPLRFSATPVTMTAPPQLGQHTEAALRSELGMSAADVEAFRERGVI
CG010_MOUSE     TVGKISVPGPAVRYSKFKMSEAKPPPLGQHTRHILKEVLRYDEGAIEKLLCSGVI
Y9880_DICDI     -------------------------------------------------------
CG010_HUMAN     TVGKISVPGPAVRYSKFKMSEARPPPLGQHTTHILKEVLRYDDRAIGELLSAGVV
CG010_RAT       TVGKISVPGPAVRYSKFKMSEAKPPPLGQHTRHILKEVL----------------
YFDE_ECOLI      GGIMMP--GNPIKISADPHVMPGAATLDQHGE-----------------------
FCTA_BRASO      TRGKYLSVGNPIKLSDSPADVTRSPLLGEHTDEILRQVLGFSDHQVAEIHDSGAL
FCTA_BRASB      TRGKYLSVGNPIKLSDSPAEVTRSPLLGEHTDEILRQVLGFSDHQVAEIHDSGAL
FCTA_STRAW      ERGEFVTVGSPLKLSDSPVDVTSSPLLGEH-------------------------
FCTA_STRCO      ERGEFVTVGSPLKLSDSPVEVTSSPLLGEH-------------------------
FCTA_OLICO      TRGKYISVGNPIKLSDSPADVRRSPLLGEHTDEILRDVLKFSESQVSDIRSSGAL
FCTA_BRAJA      TRGKYISVGNPIKLSDSPSDVQRSPLLGEHTDEILRSVLGFSDHQVADIHKSGAL
FCTA_RHOPB      TRGKYLSVGNPIKMSDSPTEVMRSPLLGEHTDEILRQVLGFSDQQVAEVHDSGAL
FCTA_RHOPS      TRGKYLSVGNPIKLSDSPTEVKRSPLLGEHTDEVLREVLGFNDHQIAEIHDSGAL
FCTA_RHOPA      TRGKYLSVGNPIKLSDSPTEVKRSPLLGEHTDEILRDVLGYSDAHVAEIHDSG--
FCTA_RHOPT      TRGKYLSVGNPIKLSDSPTEVKRSPLLGEHTDEILRDVLGYSDAHVAEIHDSG--
FCTA_RHOP2      TRGKYLSVGNPIKLSDSPTHVERSPLLGEHTDEILRDVLGFNDHQVAEIHDSGAL
FCTA_RHOP5      TRGKYLSVGNPIKLSDSPTDVQRSPLLGEHTDEILRQVLGFSDHQVAEIHDSGAL
FCTA_SHISS      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_SHIFL      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_SHIF8      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_SHIDS      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_SHIBS      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_SHIB3      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAVVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECOUT      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECOSM      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECOSE      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECOLU      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECOLI      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECOLC      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECOL5      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECOK1      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECOHS      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECODH      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECOBW      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECO8A      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECO81      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECO7I      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECO5E      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECO57      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECO55      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECO45      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECO27      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_ECO24      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
FCTA_OXAFO      IRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLK-ELGLDDAKIKELHAKQVV
FCTA_ECOL6      LRGKYLTVGCPMKFSAFTPDIKAAPLLGEHTAAVLQ-ELGYSDDEIAAMKQNHAI
AMACR_HUMAN     DVSPRP---APLLLNTPAISFKRDPFIGEHTEEIL-EEFGFSREEI---------
CAIB_PROMH      SGETCKGPNIMPKFKNNPGKIRGMPAHGMDTNAILKN-IGYSDEQIRELVDKGL-
CAIB_PROSL      SGETCKGPNIMPKFKNNPGKIRGMPAHGMDTNAILKN-IGYSDEQIRELVDKGL-
BAIF_EUBSP      MMGHITGLGLINKFKRNPSEIRGAPLFGMDNRDILK-DLGYDDAKIDELYEQGIV
AMACR_RAT       CPRPAPQL------SRTPAVPSADPSVGEHTVEVLK-DYGFSQEEIHQLHSDRII
CAIB_SALTY      DGRTCKGPNIMPKFKNNPGKIRGMPSHGMDTAAILKN-IGYSEADIKELVGKGL-
CAIB_SALCH      DGRTCKGPNIMPKFKNNPGKIRGMPSHGMDTAAILKN-IGYSEADIKELVGKGL-
CAIB_SALTI      DGRTCKGPNIMPKFKNNPGKIRGMPSHGMDTAAILKN-IGYSEADIKELVGKGL-
AMACR_MOUSE     -------------------------------------------------------
CAIB_SALPK      DGRTCKGPNIMPKFKNNPGKIRGMPSHGMDTAAILKN-IGYSEADIKELVGKGL-
CAIB_SALPA      DGRTCKGPNIMPKFKNNPGKIRGMPSHGMDTAAILKN-IGYSEADIKELVGKGL-
CAIB_SALEP      DGRTCKGPNIMPKFKNNPGKIRGMPSHGMDTAAILKN-IGYSEADIKELVGKGL-
CAIB_ECOUT      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECOSM      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECOL6      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECOK1      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECO81      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECO7I      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECO45      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECO27      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECO24      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_SHIDS      DGRTCKRPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECOSE      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECOLI      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECOLC      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECODH      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECOBW      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECO5E      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECO57      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECOLU      DGRTCKGPNVMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_SHIFL      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECOL5      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECOHS      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECO8A      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ECO55      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_SHIF8      DGRTCKGPNIMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_ESCF3      DGRTCKGPNVMPKFKNNPGQIRGMPSHGMDTAAILKN-IGYSENDIQELVSKGL-
CAIB_SALG2      DGRTCKGPNIMPKFKNNPGKIRGMPSHGMDTAAILKN-IGYSEADIKELVGKGL-
YS74_CAEEL      -------------------------------------------------------