[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08673.1

[Show Plain Result]


## Summary of Sequence Search
    1::388
  511::648     6e-10  31%  650 aa  MACB_BDEBA RecName: Full=Macrolide export ATP-binding/permease
  543::650     8e-10  33%  653 aa  MACB_BURTA RecName: Full=Macrolide export ATP-binding/permease
  487::638     4e-09  35%  641 aa  MACB_CAMJR RecName: Full=Macrolide export ATP-binding/permease
  487::638     4e-09  35%  641 aa  MACB_CAMJJ RecName: Full=Macrolide export ATP-binding/permease
  487::638     4e-09  35%  641 aa  MACB_CAMJE RecName: Full=Macrolide export ATP-binding/permease
  534::641     4e-09  36%  644 aa  MACB_ACTAC RecName: Full=Macrolide export ATP-binding/permease
  303::407     9e-09  37%  409 aa  YVRN_BACSU RecName: Full=Uncharacterized ABC transporter permease
  257::397     1e-08  35%  399 aa  Y1507_METJA RecName: Full=Uncharacterized ABC transporter permease
  508::653     1e-08  33%  656 aa  MACB_SHESA RecName: Full=Macrolide export ATP-binding/permease
  543::650     1e-08  32%  653 aa  MACB_BURPS RecName: Full=Macrolide export ATP-binding/permease
  543::650     1e-08  32%  653 aa  MACB_BURP1 RecName: Full=Macrolide export ATP-binding/permease
  527::645     2e-08  31%  648 aa  MACB_AGRT5 RecName: Full=Macrolide export ATP-binding/permease
  524::646     3e-08  34%  649 aa  MACB2_YERPN RecName: Full=Macrolide export ATP-binding/permease
  524::646     3e-08  34%  649 aa  MACB1_YERPS RecName: Full=Macrolide export ATP-binding/permease
  524::646     3e-08  34%  649 aa  MACB1_YERPE RecName: Full=Macrolide export ATP-binding/permease
  524::646     3e-08  34%  649 aa  MACB1_YERPA RecName: Full=Macrolide export ATP-binding/permease
  508::653     3e-08  32%  656 aa  MACB_SHEON RecName: Full=Macrolide export ATP-binding/permease
  537::644     4e-08  33%  647 aa  MACB_SHESW RecName: Full=Macrolide export ATP-binding/permease
  523::645     6e-08  35%  648 aa  MACB_SHISS RecName: Full=Macrolide export ATP-binding/permease
  523::645     6e-08  35%  648 aa  MACB_SHIFL RecName: Full=Macrolide export ATP-binding/permease
  523::645     6e-08  35%  648 aa  MACB_SHIBS RecName: Full=Macrolide export ATP-binding/permease
  523::645     6e-08  35%  648 aa  MACB_ECOUT RecName: Full=Macrolide export ATP-binding/permease
  523::645     6e-08  35%  648 aa  MACB_ECOLI RecName: Full=Macrolide export ATP-binding/permease
  523::645     6e-08  35%  648 aa  MACB_ECOL5 RecName: Full=Macrolide export ATP-binding/permease
  523::645     6e-08  35%  648 aa  MACB1_ECOK1 RecName: Full=Macrolide export ATP-binding/permease
  523::645     7e-08  36%  648 aa  MACB_SALTY RecName: Full=Macrolide export ATP-binding/permease
  523::645     7e-08  36%  648 aa  MACB_SALTI RecName: Full=Macrolide export ATP-binding/permease
  523::645     7e-08  36%  648 aa  MACB_SALPA RecName: Full=Macrolide export ATP-binding/permease
  523::645     7e-08  36%  648 aa  MACB_SALCH RecName: Full=Macrolide export ATP-binding/permease
  577::684     7e-08  31%  687 aa  MACB_BURS3 RecName: Full=Macrolide export ATP-binding/permease
  523::645     1e-07  34%  648 aa  MACB_ECO57 RecName: Full=Macrolide export ATP-binding/permease
  571::678     1e-07  31%  681 aa  MACB_BURCH RecName: Full=Macrolide export ATP-binding/permease
  571::678     1e-07  31%  681 aa  MACB_BURCA RecName: Full=Macrolide export ATP-binding/permease
  535::652     1e-07  33%  655 aa  MACB_RHOPB RecName: Full=Macrolide export ATP-binding/permease
  522::644     2e-07  43%  647 aa  MACB_PHOLL RecName: Full=Macrolide export ATP-binding/permease
  517::657     2e-07  28%  660 aa  MACB_BARHE RecName: Full=Macrolide export ATP-binding/permease
  547::693     4e-07  30%  696 aa  MACB_HAEDU RecName: Full=Macrolide export ATP-binding/permease
  524::652     4e-07  38%  655 aa  MACB_BORA1 RecName: Full=Macrolide export ATP-binding/permease
  515::643     6e-07  29%  646 aa  MACB_ECOLX RecName: Full=Macrolide export ATP-binding/permease
  515::643     6e-07  29%  646 aa  MACB2_ECOK1 RecName: Full=Macrolide export ATP-binding/permease
  530::641     1e-06  47%  644 aa  MACB_NEIGO RecName: Full=Macrolide export ATP-binding/permease
  530::641     1e-06  47%  644 aa  MACB_NEIG1 RecName: Full=Macrolide export ATP-binding/permease
  533::651     1e-06  38%  654 aa  MACB_HAHCH RecName: Full=Macrolide export ATP-binding/permease
  537::641     1e-06  33%  644 aa  MACB_CHRVO RecName: Full=Macrolide export ATP-binding/permease
  502::647     2e-06  31%  650 aa  MACB_ERWCT RecName: Full=Macrolide export ATP-binding/permease
  530::641     2e-06  47%  644 aa  MACB_NEIMB RecName: Full=Macrolide export ATP-binding/permease
  530::641     2e-06  47%  644 aa  MACB_NEIMA RecName: Full=Macrolide export ATP-binding/permease
  542::649     2e-06  30%  652 aa  MACB1_PSEF5 RecName: Full=Macrolide export ATP-binding/permease
  544::651     5e-06  38%  654 aa  MACB_VIBPA RecName: Full=Macrolide export ATP-binding/permease
  527::651     5e-06  33%  654 aa  MACB_PSEPK RecName: Full=Macrolide export ATP-binding/permease
  533::640     5e-06  37%  643 aa  MACB_MANSM RecName: Full=Macrolide export ATP-binding/permease
  557::662     7e-06  43%  665 aa  MACB_PSYA2 RecName: Full=Macrolide export ATP-binding/permease
  524::653     1e-05  37%  656 aa  MACB_AZOSB RecName: Full=Macrolide export ATP-binding/permease
  541::648     2e-05  28%  651 aa  MACB2_PSEPF RecName: Full=Macrolide export ATP-binding/permease
  534::651     2e-05  37%  654 aa  MACB_RHOP2 RecName: Full=Macrolide export ATP-binding/permease
  606::713     3e-05  30%  715 aa  MACB_SYNFM RecName: Full=Macrolide export ATP-binding/permease
  517::587     3e-05  30%  660 aa  MACB_BARQU RecName: Full=Macrolide export ATP-binding/permease
  514::661     3e-05  32%  664 aa  MACB_ACIAD RecName: Full=Macrolide export ATP-binding/permease
  543::650     3e-05  25%  653 aa  MACB2_PSEU2 RecName: Full=Macrolide export ATP-binding/permease
  558::665     8e-05  28%  668 aa  MACB2_PSESM RecName: Full=Macrolide export ATP-binding/permease
  548::655     1e-04  37%  657 aa  MACB_CHLPD RecName: Full=Macrolide export ATP-binding/permease
  521::675     1e-04  30%  678 aa  MACB2_YERPS RecName: Full=Macrolide export ATP-binding/permease
  521::675     1e-04  30%  678 aa  MACB2_YERPE RecName: Full=Macrolide export ATP-binding/permease
  521::675     1e-04  30%  678 aa  MACB2_YERPA RecName: Full=Macrolide export ATP-binding/permease
  521::675     1e-04  30%  678 aa  MACB1_YERPN RecName: Full=Macrolide export ATP-binding/permease
    1::388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACB_BDEBA      ----------------------------------------------------------------------
MACB_BURTA      ----------------------------------------------------------------------
MACB_CAMJR      ----------------------------------------------------------------------
MACB_CAMJJ      ----------------------------------------------------------------------
MACB_CAMJE      ----------------------------------------------------------------------
MACB_ACTAC      ----------------------------------------------------------------------
YVRN_BACSU      ----------------------------------------------------------------------
Y1507_METJA     ----------------------------------------------------------------------
MACB_SHESA      ----------------------------------------------------------------------
MACB_BURPS      ----------------------------------------------------------------------
MACB_BURP1      ----------------------------------------------------------------------
MACB_AGRT5      ----------------------------------------------------------------------
MACB2_YERPN     ----------------------------------------------------------------------
MACB1_YERPS     ----------------------------------------------------------------------
MACB1_YERPE     ----------------------------------------------------------------------
MACB1_YERPA     ----------------------------------------------------------------------
MACB_SHEON      ----------------------------------------------------------------------
MACB_SHESW      ----------------------------------------------------------------------
MACB_SHISS      ----------------------------------------------------------------------
MACB_SHIFL      ----------------------------------------------------------------------
MACB_SHIBS      ----------------------------------------------------------------------
MACB_ECOUT      ----------------------------------------------------------------------
MACB_ECOLI      ----------------------------------------------------------------------
MACB_ECOL5      ----------------------------------------------------------------------
MACB1_ECOK1     ----------------------------------------------------------------------
MACB_SALTY      ----------------------------------------------------------------------
MACB_SALTI      ----------------------------------------------------------------------
MACB_SALPA      ----------------------------------------------------------------------
MACB_SALCH      ----------------------------------------------------------------------
MACB_BURS3      ----------------------------------------------------------------------
MACB_ECO57      ----------------------------------------------------------------------
MACB_BURCH      ----------------------------------------------------------------------
MACB_BURCA      ----------------------------------------------------------------------
MACB_RHOPB      ----------------------------------------------------------------------
MACB_PHOLL      ----------------------------------------------------------------------
MACB_BARHE      ----------------------------------------------------------------------
MACB_HAEDU      ----------------------------------------------------------------------
MACB_BORA1      ----------------------------------------------------------------------
MACB_ECOLX      ----------------------------------------------------------------------
MACB2_ECOK1     ----------------------------------------------------------------------
MACB_NEIGO      ----------------------------------------------------------------------
MACB_NEIG1      ----------------------------------------------------------------------
MACB_HAHCH      ----------------------------------------------------------------------
MACB_CHRVO      ----------------------------------------------------------------------
MACB_ERWCT      ----------------------------------------------------------------------
MACB_NEIMB      ----------------------------------------------------------------------
MACB_NEIMA      ----------------------------------------------------------------------
MACB1_PSEF5     ----------------------------------------------------------------------
MACB_VIBPA      ----------------------------------------------------------------------
MACB_PSEPK      ----------------------------------------------------------------------
MACB_MANSM      ----------------------------------------------------------------------
MACB_PSYA2      ----------------------------------------------------------------------
MACB_AZOSB      ----------------------------------------------------------------------
MACB2_PSEPF     ----------------------------------------------------------------------
MACB_RHOP2      ----------------------------------------------------------------------
MACB_SYNFM      ----------------------------------------------------------------------
MACB_BARQU      ----------------------------------------------------------------------
MACB_ACIAD      ----------------------------------------------------------------------
MACB2_PSEU2     ----------------------------------------------------------------------
MACB2_PSESM     ----------------------------------------------------------------------
MACB_CHLPD      ----------------------------------------------------------------------
MACB2_YERPS     ----------------------------------------------------------------------
MACB2_YERPE     ----------------------------------------------------------------------
MACB2_YERPA     ----------------------------------------------------------------------
MACB1_YERPN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACB_BDEBA      ----------------------------------------------------------------------
MACB_BURTA      ----------------------------------------------------------------------
MACB_CAMJR      ----------------------------------------------------------------------
MACB_CAMJJ      ----------------------------------------------------------------------
MACB_CAMJE      ----------------------------------------------------------------------
MACB_ACTAC      ----------------------------------------------------------------------
YVRN_BACSU      ----------------------------------------------------------------------
Y1507_METJA     ----------------------------------------------------------------------
MACB_SHESA      ----------------------------------------------------------------------
MACB_BURPS      ----------------------------------------------------------------------
MACB_BURP1      ----------------------------------------------------------------------
MACB_AGRT5      ----------------------------------------------------------------------
MACB2_YERPN     ----------------------------------------------------------------------
MACB1_YERPS     ----------------------------------------------------------------------
MACB1_YERPE     ----------------------------------------------------------------------
MACB1_YERPA     ----------------------------------------------------------------------
MACB_SHEON      ----------------------------------------------------------------------
MACB_SHESW      ----------------------------------------------------------------------
MACB_SHISS      ----------------------------------------------------------------------
MACB_SHIFL      ----------------------------------------------------------------------
MACB_SHIBS      ----------------------------------------------------------------------
MACB_ECOUT      ----------------------------------------------------------------------
MACB_ECOLI      ----------------------------------------------------------------------
MACB_ECOL5      ----------------------------------------------------------------------
MACB1_ECOK1     ----------------------------------------------------------------------
MACB_SALTY      ----------------------------------------------------------------------
MACB_SALTI      ----------------------------------------------------------------------
MACB_SALPA      ----------------------------------------------------------------------
MACB_SALCH      ----------------------------------------------------------------------
MACB_BURS3      ----------------------------------------------------------------------
MACB_ECO57      ----------------------------------------------------------------------
MACB_BURCH      ----------------------------------------------------------------------
MACB_BURCA      ----------------------------------------------------------------------
MACB_RHOPB      ----------------------------------------------------------------------
MACB_PHOLL      ----------------------------------------------------------------------
MACB_BARHE      ----------------------------------------------------------------------
MACB_HAEDU      ----------------------------------------------------------------------
MACB_BORA1      ----------------------------------------------------------------------
MACB_ECOLX      ----------------------------------------------------------------------
MACB2_ECOK1     ----------------------------------------------------------------------
MACB_NEIGO      ----------------------------------------------------------------------
MACB_NEIG1      ----------------------------------------------------------------------
MACB_HAHCH      ----------------------------------------------------------------------
MACB_CHRVO      ----------------------------------------------------------------------
MACB_ERWCT      ----------------------------------------------------------------------
MACB_NEIMB      ----------------------------------------------------------------------
MACB_NEIMA      ----------------------------------------------------------------------
MACB1_PSEF5     ----------------------------------------------------------------------
MACB_VIBPA      ----------------------------------------------------------------------
MACB_PSEPK      ----------------------------------------------------------------------
MACB_MANSM      ----------------------------------------------------------------------
MACB_PSYA2      ----------------------------------------------------------------------
MACB_AZOSB      ----------------------------------------------------------------------
MACB2_PSEPF     ----------------------------------------------------------------------
MACB_RHOP2      ----------------------------------------------------------------------
MACB_SYNFM      ----------------------------------------------------------------------
MACB_BARQU      ----------------------------------------------------------------------
MACB_ACIAD      ----------------------------------------------------------------------
MACB2_PSEU2     ----------------------------------------------------------------------
MACB2_PSESM     ----------------------------------------------------------------------
MACB_CHLPD      ----------------------------------------------------------------------
MACB2_YERPS     ----------------------------------------------------------------------
MACB2_YERPE     ----------------------------------------------------------------------
MACB2_YERPA     ----------------------------------------------------------------------
MACB1_YERPN     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACB_BDEBA      ----------------------------------------------------------------------
MACB_BURTA      ----------------------------------------------------------------------
MACB_CAMJR      ----------------------------------------------------------------------
MACB_CAMJJ      ----------------------------------------------------------------------
MACB_CAMJE      ----------------------------------------------------------------------
MACB_ACTAC      ----------------------------------------------------------------------
YVRN_BACSU      ----------------------------------------------------------------------
Y1507_METJA     ----------------------------------------------------------------------
MACB_SHESA      ----------------------------------------------------------------------
MACB_BURPS      ----------------------------------------------------------------------
MACB_BURP1      ----------------------------------------------------------------------
MACB_AGRT5      ----------------------------------------------------------------------
MACB2_YERPN     ----------------------------------------------------------------------
MACB1_YERPS     ----------------------------------------------------------------------
MACB1_YERPE     ----------------------------------------------------------------------
MACB1_YERPA     ----------------------------------------------------------------------
MACB_SHEON      ----------------------------------------------------------------------
MACB_SHESW      ----------------------------------------------------------------------
MACB_SHISS      ----------------------------------------------------------------------
MACB_SHIFL      ----------------------------------------------------------------------
MACB_SHIBS      ----------------------------------------------------------------------
MACB_ECOUT      ----------------------------------------------------------------------
MACB_ECOLI      ----------------------------------------------------------------------
MACB_ECOL5      ----------------------------------------------------------------------
MACB1_ECOK1     ----------------------------------------------------------------------
MACB_SALTY      ----------------------------------------------------------------------
MACB_SALTI      ----------------------------------------------------------------------
MACB_SALPA      ----------------------------------------------------------------------
MACB_SALCH      ----------------------------------------------------------------------
MACB_BURS3      ----------------------------------------------------------------------
MACB_ECO57      ----------------------------------------------------------------------
MACB_BURCH      ----------------------------------------------------------------------
MACB_BURCA      ----------------------------------------------------------------------
MACB_RHOPB      ----------------------------------------------------------------------
MACB_PHOLL      ----------------------------------------------------------------------
MACB_BARHE      ----------------------------------------------------------------------
MACB_HAEDU      ----------------------------------------------------------------------
MACB_BORA1      ----------------------------------------------------------------------
MACB_ECOLX      ----------------------------------------------------------------------
MACB2_ECOK1     ----------------------------------------------------------------------
MACB_NEIGO      ----------------------------------------------------------------------
MACB_NEIG1      ----------------------------------------------------------------------
MACB_HAHCH      ----------------------------------------------------------------------
MACB_CHRVO      ----------------------------------------------------------------------
MACB_ERWCT      ----------------------------------------------------------------------
MACB_NEIMB      ----------------------------------------------------------------------
MACB_NEIMA      ----------------------------------------------------------------------
MACB1_PSEF5     ----------------------------------------------------------------------
MACB_VIBPA      ----------------------------------------------------------------------
MACB_PSEPK      ----------------------------------------------------------------------
MACB_MANSM      ----------------------------------------------------------------------
MACB_PSYA2      ----------------------------------------------------------------------
MACB_AZOSB      ----------------------------------------------------------------------
MACB2_PSEPF     ----------------------------------------------------------------------
MACB_RHOP2      ----------------------------------------------------------------------
MACB_SYNFM      ----------------------------------------------------------------------
MACB_BARQU      ----------------------------------------------------------------------
MACB_ACIAD      ----------------------------------------------------------------------
MACB2_PSEU2     ----------------------------------------------------------------------
MACB2_PSESM     ----------------------------------------------------------------------
MACB_CHLPD      ----------------------------------------------------------------------
MACB2_YERPS     ----------------------------------------------------------------------
MACB2_YERPE     ----------------------------------------------------------------------
MACB2_YERPA     ----------------------------------------------------------------------
MACB1_YERPN     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxRLANEAKREQQFYSDQSKALSAFINILGLTLTTIFSVAAMIGAMITMYAS
MACB_BDEBA      ---------------------------------ADIQQALNSTSQTLSMLLASIAAISLVVGGMNIMLVS
MACB_BURTA      ------------------------------------------------------------IGVMNIMLVS
MACB_CAMJR      ------------------------EIKRGQKFNSDTFKANKRTTTILTACVAVIALIVGGIGVMNIMLVS
MACB_CAMJJ      ------------------------EIKRGQKFNSDTFKANKRTTTILTACVAVIALIVGGIGVMNIMLVS
MACB_CAMJE      ------------------------EIKRGQKFNSDTFKANKRTTTILTACVAVIALIVGGIGVMNIMLVS
MACB_ACTAC      ------------------------------------------------------------IGVMNIMLVS
YVRN_BACSU      ---------------------------------------------------------------MNIMLVS
Y1507_METJA     ------------------------------------AKTVSSVLGVITIFVVGVAAISLLVGAVNTMHMS
MACB_SHESA      -----------------------------QDFFTINTDTIRQNIEKTTATMTLLISAIAVIGVMNIMLVS
MACB_BURPS      ------------------------------------------------------------IGVMNIMLVS
MACB_BURP1      ------------------------------------------------------------IGVMNIMLVS
MACB_AGRT5      -------------------------------------------------SVAVISLIVGGIGVMNIMLVS
MACB2_YERPN     ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB1_YERPS     ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB1_YERPE     ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB1_YERPA     ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB_SHEON      -----------------------------QDFFTINTDTIRQNIEKTTATMTLLISAIAVIGVMNIMLVS
MACB_SHESW      ------------------------------------------------------------IGVMNIMLVS
MACB_SHISS      ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB_SHIFL      ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB_SHIBS      ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB_ECOUT      ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB_ECOLI      ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB_ECOL5      ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB1_ECOK1     ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB_SALTY      ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB_SALTI      ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB_SALPA      ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB_SALCH      ----------------------------------------------LFLTLVAVISVVGGIGVMNIMLVS
MACB_BURS3      ------------------------------------------------------------IGVMNIMLVS
MACB_ECO57      ----------------------------------------------LFMTLVAVISVVGGIGVMNIMLVS
MACB_BURCH      ------------------------------------------------------------IGVMNIMLVS
MACB_BURCA      ------------------------------------------------------------IGVMNIMLVS
MACB_RHOPB      --------------------------------------------------IAVISLVVGGIGVMNIMLVS
MACB_PHOLL      ----------------------------------------------LFLTMVAVISIVGGIGVMNIMLVS
MACB_BARHE      ---------------------------RNSQLFRDRIMESTHILTLLVSSIAAISLIVGGIGVMNIMLVT
MACB_HAEDU      ----------------------------QKDFYTFSSSRFLQSLNKTTQALTLMISSIAFIGIMNIMLVS
MACB_BORA1      ----------------------------------------TATLTLLVSMIAVISLVVVGIGVMNIMLVS
MACB_ECOLX      ----------------------------------------SMTFSILILMVACISLMIGSIGVMNIMLIS
MACB2_ECOK1     ----------------------------------------SMTFSILILMVACISLMIGSIGVMNIMLIS
MACB_NEIGO      --------------------------------------------------------VVGGIGVMNIMLVS
MACB_NEIG1      --------------------------------------------------------VVGGIGVMNIMLVS
MACB_HAHCH      -------------------------------------------------SIAVISLIVGGIGVMNIMLVS
MACB_CHRVO      ---------------------------------------------------------------MNIMLVS
MACB_ERWCT      -----------------------------KDFFIMNTDSIRQMIEKTTTTLTLLVSMIALIGVMNIMLVS
MACB_NEIMB      --------------------------------------------------------VVGGIGVMNIMLVS
MACB_NEIMA      --------------------------------------------------------VVGGIGVMNIMLVS
MACB1_PSEF5     ------------------------------------------------------------IGVMNIMLVS
MACB_VIBPA      ------------------------------------------------------------IGVMNIMLVS
MACB_PSEPK      --------------------------------------------NSLSLMLGAIAAISLLIGVMNIMLMT
MACB_MANSM      ------------------------------------------------------------IGVMNIMLVS
MACB_PSYA2      ---------------------------------------------------------------MNIMLVS
MACB_AZOSB      ---------------------------------------VSATQNTLTILLGTVAAISLLIGVMNIMLVS
MACB2_PSEPF     ------------------------------------------------------------IGVMNIMLVS
MACB_RHOP2      --------------------------------------------------IAVISLVVGGIGVMNIMLVS
MACB_SYNFM      ------------------------------------------------------------VGIMNIMMVS
MACB_BARQU      ---------------------------RNSQLFRDRIMESTHILTLLVSSIAAISLIVGGIGVMNIMLVT
MACB_ACIAD      ----------------------------QQDIFTMNSDSIRQTIEKTTSTMTLLVSAIAVIGVMNIMLVS
MACB2_PSEU2     ------------------------------------------------------------IGVMNIMLVS
MACB2_PSESM     ------------------------------------------------------------IGVMNIMLVS
MACB_CHLPD      ------------------------------------------------------------IGIMNIMLVS
MACB2_YERPS     --------------------KLLSQRHGTQDFFVMNTDSIRQTIQATTSTMTLLVSMIAVIGVMNIMLVS
MACB2_YERPE     --------------------KLLSQRHGTQDFFVMNTDSIRQTIQATTSTMTLLVSMIAVIGVMNIMLVS
MACB2_YERPA     --------------------KLLSQRHGTQDFFVMNTDSIRQTIQATTSTMTLLVSMIAVIGVMNIMLVS
MACB1_YERPN     --------------------KLLSQRHGTQDFFVMNTDSIRQTIQATTSTMTLLVSMIAVIGVMNIMLVS


                         .         *         .         .         .         .         +:350
query           VANRVGEIGTLRALGFQRINVLAAFLIEXXXXXXXXXXXXXXCASLMQFASFSTTNFQTFADLSFRFVLT
MACB_BDEBA      VTERTKEIGLRKAIGARRRDILLQFLAE--------SIVVSVCGGLLGIALGVGFSLLISKVLGWSTVVS
MACB_BURTA      VTERTREIGIRMAVGARQADIMQQFLVEAVTVCLMGGAIGIVLSLGMSFV------FSLFVD-QWKMVFS
MACB_CAMJR      VSERTREIGIRMAIGARREDIMMQFLIEAVMICTIGAILGVILSIFVIFA-FNTLS------TDFPMILN
MACB_CAMJJ      VSERTREIGIRMAIGARREDIMMQFLIEAVMICTIGAILGVILSIFVIFA-FNTLS------TDFPMILN
MACB_CAMJE      VSERTREIGIRMAIGARREDIMMQFLIEAVMICTIGAILGVILSIFVIFA-FNTLS------TDFPMILN
MACB_ACTAC      VTERTKEIGVRMAIGARQINILQQFLIEAVLICLIGGVAGILLSVLVLFNSFITDFSMDFSTAS------
YVRN_BACSU      VTERTREIGIKKALGAKRRVILFQFLTEAVVLTSIGGI-------LGVLAGFGIAKLLTVI-FPMPFIVS
Y1507_METJA     ILERRKDIGILKALGAETTDILAIFVVEXXXXXXXXXXXXXXXAEVIEALAHKMGYLMVNAWISWE----
MACB_SHESA      VTERTREIGVRMAVGARQSDILRQFLIEAVLVCLCGGALGVALAYLVVFAQ---------AGGSFQMIYS
MACB_BURPS      VTERTREIGIRMAVGARQTDIMQQFLVEAVTVCLMGGAIGIVLSFGMSFV------FSLFVD-QWKMVFS
MACB_BURP1      VTERTREIGIRMAVGARQTDIMQQFLVEAVTVCLMGGAIGIVLSFGMSFV------FSLFVD-QWKMVFS
MACB_AGRT5      VTERTKEIGVRVAVGARRSDILSQFLIEAVMV----------CXXXXXXXXXXXXXXSALFNLDFKMIFS
MACB2_YERPN     VTERTREIGIRMAVGARSSDVMQQFLIEAVLVCLIG-------GALGISLSFAIGLIVEMFLPNWRIAFP
MACB1_YERPS     VTERTREIGIRMAVGARSSDVMQQFLIEAVLVCLIG-------GALGISLSFAIGLIVEMFLPNWRIAFP
MACB1_YERPE     VTERTREIGIRMAVGARSSDVMQQFLIEAVLVCLIG-------GALGISLSFAIGLIVEMFLPNWRIAFP
MACB1_YERPA     VTERTREIGIRMAVGARSSDVMQQFLIEAVLVCLIG-------GALGISLSFAIGLIVEMFLPNWRIAFP
MACB_SHEON      VTERTREIGVRMAVGARQSDILRQFLIEAVLVCLCGGALGVALAYLVVFAQ---------AGGSFQMIYS
MACB_SHESW      VTERTREIGVRMAVGARQSDILRQFLIEAVLVCLCGGTLGIALAYLIGVVFAQTGG-------SFQMIYS
MACB_SHISS      VTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAF------TLQLFLP-GWEIGFS
MACB_SHIFL      VTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAF------TLQLFLP-GWEIGFS
MACB_SHIBS      VTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAF------TLQLFLP-GWEIGFS
MACB_ECOUT      VTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAF------TLQLFLP-GWEIGFS
MACB_ECOLI      VTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAF------TLQLFLP-GWEIGFS
MACB_ECOL5      VTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAF------TLQLFLP-GWEIGFS
MACB1_ECOK1     VTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAF------TLQLFLP-GWEIGFS
MACB_SALTY      VTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALG---ISLSMFIAFMLQLFLPGWEIGFSLT--
MACB_SALTI      VTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALG---ISLSMFIAFMLQLFLPGWEIGFSLT--
MACB_SALPA      VTERTREIGIRMAVGARASDVLQQFLIEAMLVCLVGGALG---ISLSMFIAFMLQLFLPGWEIGFSLT--
MACB_SALCH      VTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALG---ISLSMFIAFMLQLFLPGWEIGFSLT--
MACB_BURS3      VTERTREIGIRMAVGARQSDILQQFLVEAVLVCLLG-------GTIGIALSFGLGALFSMFVAQWKMVFS
MACB_ECO57      VTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAF------TLQLFLP-GWEIGFS
MACB_BURCH      VTERTREIGIRMAVGARQSDILQQFLVEAVLVCLLG-------GTIGIALSFGLGALFSVFVAQWKMVFS
MACB_BURCA      VTERTREIGIRMAVGARQSDILQQFLVEAVLVCLLG-------GTIGIALSFGLGALFSVFVAQWKMVFS
MACB_RHOPB      VSERVGEIGVRMAVGARRSDILQQFLIE------AVMVCLIXXXXXXXXXXXXXXTFNALVPM-FQLGLS
MACB_PHOLL      VTERTREIGIRMAVGARTSDVRQQFLIEAXXXXXXXXXXXXXXSYTIAFIA-------QLALPGWHFVFQ
MACB_BARHE      VSERINEIGVRMAVGARQSDILQQFLIE-------AILVCVXXXXXXXXXXXXXXXXXXXXKAPIHLIYT
MACB_HAEDU      VIERTKEIGIRIAVGAKERDIRFQFLIESTMVSLIGGCIGVGCALLFG-------GLFSLAETSIKIQFT
MACB_BORA1      VTERTREIGVRMAVGARRSDIMQQFLIEAXXXXXXXXXXXXXXXXXXXXXXXQATRG------AFQMLYS
MACB_ECOLX      VTERTHEIGVRMAVGARRSDIMQQFIIEAVLVCLIGG------ALGIALSYITGALFNALADGIFAAIYS
MACB2_ECOK1     VTERTHEIGVRMAVGARRSDIMQQFIIEAVLVCLIGG------ALGIALSYITGALFNALADGIFAAIYS
MACB_NEIGO      VTERTKEIGIRMAIGARRGNILQQFLIEXXXXXXXXXXXXXXXXXXXXFNHFVT---------DFPMDIS
MACB_NEIG1      VTERTKEIGIRMAIGARRGNILQQFLIEXXXXXXXXXXXXXXXXXXXXFNHFVT---------DFPMDIS
MACB_HAHCH      VTERTREIGIRMAVGARQSDILQQFLIE-AVMVCXXXXXXXXXXSFGVGALFSL----LVQDMQMSFSVT
MACB_CHRVO      VTERTREIGIRMAVGARQGDVLQQFLTEAVLVCLVGGAIG---VALSYGVSFVFSLFVT----EWKMSLS
MACB_ERWCT      VTERTREIGVRMAVGARTSDIMQQFLIEAVLVCLFGG---------IAGVALSLAIGVLFAQLSFAMIYX
MACB_NEIMB      VTERTKEIGIRMAIGARRGNILQQFLIEXXXXXXXXXXXXXXXXXXXXFNHFVT---------DFPMDIS
MACB_NEIMA      VTERTKEIGIRMAIGARRGNILQQFLIEXXXXXXXXXXXXXXXXXXXXFNHFVT---------DFPMDIS
MACB1_PSEF5     VTERTREIGIRMAVGARQSDIRQQFLVEAVMVCLIG-------GAIGISLSFAIGYLFTLFIKEWEMVFS
MACB_VIBPA      VTERTKEIGVRMAVGARQADILRQFLIEAVLVXXXXXXXXXXXXXXXXXXXSTSGS-------SFQMIYS
MACB_PSEPK      VRERTREIGIRMATGARQRDILRQFLSEAIMLSMVGGLTGIALA-LVVGASL------TLADIAVAFALP
MACB_MANSM      VTERTKEIGVRMAIGARKSNILQQFLIE------AXXXXXXXXXXXXXXXXXXXXXFNVFM-TDFTMVFS
MACB_PSYA2      VTERTNEIGVRMAVGARQSDIMQQFLIEAXXXXXXXXXXXXX----MAFAIGELIN--RVGGDSFKVIYS
MACB_AZOSB      VTERTREIGIRMATGARMKNILQQFLIE-------XXXXXXXXXXXXXXXXXXXXXXXXXFDTPIKYSLL
MACB2_PSEPF     VTERTREIGIRMAVGARQSDIRQQFLVEAVMVCLLG-------GAIGISLSYAIGHLFSLFIKEWEMVFS
MACB_RHOP2      VSERVGEIGVRMAVGARRSDILQQFLIE------XXXXXXXXXXXXXXXXXXXXXXFNLVVPM-FPLSLS
MACB_SYNFM      VTERTREIGLRMAVGARAKNILQQFLFEAVLLCFLGGAVGILVGRGISHLVTVLLNWPTELSLD------
MACB_BARQU      VSERINEIGVRMAVGARQSDILQQFLIE------------------------------------------
MACB_ACIAD      VTERTQEIGVRMAVGARQSDILQQFLIE------AXXXXXXXXXXXXXXXXXXXXXXNKVAAGNFAVAYS
MACB2_PSEU2     VTERTREIGIRMAVGARQSDIRQQFLVEAVMVCLIGGVIGISLSFVIGYVFSLLVK-------EWQMVFS
MACB2_PSESM     VTERTREIGIRMAVGARQSDIRQQFLVEAVMVCLMGGVIGIG-------LSYAIGYLFTLFVQQWEMVFS
MACB_CHLPD      VTERTREIGLRKAIGARKNDIMLQFLIESVG------------------MTISGGLIGVFAGVGISLILA
MACB2_YERPS     VTERTKEIGVRMAVGARASDIMQQFLIE-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMVYS
MACB2_YERPE     VTERTKEIGVRMAVGARASDIMQQFLIE-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMVYS
MACB2_YERPA     VTERTKEIGVRMAVGARASDIMQQFLIE-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMVYS
MACB1_YERPN     VTERTKEIGVRMAVGARASDIMQQFLIE-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMVYS


                         .         .         .         .         *         .         .:420
query           PGIVIKTLLFSMTMGLIGGFLPALRASRLNIVDALRxx
MACB_BDEBA      AGSVILSFGFSALIGIVFGSYPASKASKLHPIEALR--
MACB_BURTA      AGSIVSAFLCSTLIGVVFGFMPARNASRLDPIDAL---
MACB_CAMJR      AYSVLLGLLSSMFIGVVFGFFPARNAANLNPISAL---
MACB_CAMJJ      AYSVLLGLLSSMFIGVVFGFFPARNAANLNPISAL---
MACB_CAMJE      AYSVLLGLLSSMFIGVVFGFFPARNAANLNPISAL---
MACB_ACTAC      ---IVTAVLFSTLIGVLFGYMPAKKAAELNPITAL---
YVRN_BACSU      IPAVVGALIFSMAVGIIFGLLPSIKASKLQPVDALR--
Y1507_METJA     --LIVGVLIFSFLVGVISGYFPARSGAKLNPIETLR--
MACB_SHESA      TTSIVAAFACSTLIGVLFGFLPARNAARLDPVDAL---
MACB_BURPS      AASIASAFLCSTLIGVVFGFMPARNASRLDPIDAL---
MACB_BURP1      AASIASAFLCSTLIGVVFGFMPARNASRLDPIDAL---
MACB_AGRT5      PGSIIVAFACSTLIGIVFGFLPARNAAKLDPIEAL---
MACB2_YERPN     PMALFSAFLCSTVIGVVFGYLPARSAARLNPIDAL---
MACB1_YERPS     PMALFSAFLCSTVIGVVFGYLPARSAARLNPIDAL---
MACB1_YERPE     PMALFSAFLCSTVIGVVFGYLPARSAARLNPIDAL---
MACB1_YERPA     PMALFSAFLCSTVIGVVFGYLPARSAARLNPIDAL---
MACB_SHEON      TTSIVAAFACSTLIGVLFGFLPARNAARLDPVEAL---
MACB_SHESW      TTSIVAAFACSTLIGVLFGFLPARNAARLDPVDAL---
MACB_SHISS      PLALLLAFLCSTATGILFGWLPARNAARLDPVDAL---
MACB_SHIFL      PLALLLAFLCSTATGILFGWLPARNAARLDPVDAL---
MACB_SHIBS      PLALLLAFLCSTATGILFGWLPARNAARLDPVDAL---
MACB_ECOUT      PLALLLAFLCSTVTGILFGWLPARNAARLDPVDAL---
MACB_ECOLI      PLALLLAFLCSTVTGILFGWLPARNAARLDPVDAL---
MACB_ECOL5      PLALLLAFLCSTVTGILFGWLPARNAARLDPVDAL---
MACB1_ECOK1     PLALLLAFLCSTVTGILFGWLPARNAARLDPVDAL---
MACB_SALTY      --ALASAFLCSTFTGILFGWLPARNAARLDPVDAL---
MACB_SALTI      --ALASAFLCSTFTGILFGWLPARNAARLDPVDAL---
MACB_SALPA      --ALASAFLCSTFTGILFGWLPARNAARLDPVDAL---
MACB_SALCH      --ALASAFLCSTFTGILFGWLPARNAARLDPVDAL---
MACB_BURS3      AGAIVTAFVCSTLTGVIFGFMPARNASRLDPIDAL---
MACB_ECO57      PLALLLAFLCSTVTGILFGWLPARNAARLDPVDAL---
MACB_BURCH      AGAIVTAFVCSTLTGVIFGFMPARNASRLDPIDAL---
MACB_BURCA      AGAIVTAFVCSTLTGVIFGFMPARNASRLDPIDAL---
MACB_RHOPB      AGSIIAAFICSTGIGVVFGYLPARQASFLDPLAAL---
MACB_PHOLL      PIALLSAFACSTAIGVIFGFLPARNAARLDPIEAL---
MACB_BARHE      IDSIILSLTFSTLIGVCFGFSPARQASRLDPVVAL---
MACB_HAEDU      LSSFLIAFLCSSMIGIVFGYFPARNAAKLRPVDAL---
MACB_BORA1      SGSMVLAFVCSTLIGVAFGFLPARSAARLDPVESL---
MACB_ECOLX      WQAAVAAFFCSTLIGIIFGYLPARKAARMDPVISL---
MACB2_ECOK1     WQAAVAAFFCSTLIGIIFGYLPARKAARMDPVISL---
MACB_NEIGO      AASVIGAVACSTGIGIAFGFMPANKAAKLNPIDAL---
MACB_NEIG1      AASVIGAVACSTGIGIAFGFMPANKAAKLNPIDAL---
MACB_HAHCH      --AIVSAVVCSSLIGVLFGFLPARNAARLDPIEAL---
MACB_CHRVO      PPVIALAVACSSLIGVLFGFLPARNAAKLNPIDAL---
MACB_ERWCT      XXXXXXXFLCSSLIGIIFGFFPARRAARMEPIHAL---
MACB_NEIMB      AMSVIGAVACSTGIGIAFGFMPANKAAKLNPIDAL---
MACB_NEIMA      AMSVIGAVACSTGIGIAFGFMPANKAAKLNPIDAL---
MACB1_PSEF5     MGSIITAFACSTLIGIVFGFVPARNAARLDPIEAL---
MACB_VIBPA      MNSIIWAFICSTLIGIAFGFLPARNAAKLDPIEAL---
MACB_PSEPK      --AIVGAFACAVITGVVFGFMPARKAARLDPVKAL---
MACB_MANSM      TFSIVAAVLCSTLIGVIFGYMPAKNAAQLDPITAL---
MACB_PSYA2      STSIIAAFVCSTLIGVVFGFLPARNAAKLDPVEAL---
MACB_AZOSB      P--VVLAFGCAFATGLVFGYLPARKAARLDPVVAL---
MACB2_PSEPF     LTSVLTAVICSTLIGIVFGFVPARNASRLDPIEAL---
MACB_RHOP2      GTSIAAAFVCSTGIGIVFGYLPARQASFLDPLAAL---
MACB_SYNFM      --AILAAVGVSATVGIVFGYYPAWKASRLDPIVALR--
MACB_BARQU      --------------------------------------
MACB_ACIAD      TTSIVAAFVCSTLIGVVFGFLPARNAAQLDPVAAL---
MACB2_PSEU2     LGSIVTAFICSTLIGIVFGFVPARNAAQLDPIEAL---
MACB2_PSESM     LASVVTAFACSTLIGVLFGFVPARNAARLDPIEAL---
MACB_CHLPD      AGWAVKTSLFSALIGVFFGLWPARKAAALKPVEALR--
MACB2_YERPS     AASIITAFVCSSLIGVIFGFFPAKRAAEMDPIRAL---
MACB2_YERPE     AASIITAFVCSSLIGVIFGFFPAKRAAEMDPIRAL---
MACB2_YERPA     AASIITAFVCSSLIGVIFGFFPAKRAAEMDPIRAL---
MACB1_YERPN     AASIITAFVCSSLIGVIFGFFPAKRAAEMDPIRAL---