[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08678.1

[Show Plain Result]


## Summary of Sequence Search
    1::121
    6::74      7e-08  47%   92 aa  YUZN_BACSU RecName: Full=Uncharacterized HTH-type transcriptional
    1::79      6e-07  25%   90 aa  SDPR_BACSU RecName: Full=Transcriptional repressor sdpR;
   50::106     5e-06  40%  132 aa  ZIAR_SYNY3 RecName: Full=Transcriptional repressor smtB homolog;
   11::67      5e-05  36%   89 aa  Y1325_METJA RecName: Full=Uncharacterized HTH-type
   26::78      5e-05  42%  108 aa  HLYU_VIBCH RecName: Full=Transcriptional activator hlyU;
    7::70      7e-05  33%  111 aa  ASER_BACSU RecName: Full=HTH-type transcriptional repressor aseR;
   10::67      7e-05  37%  117 aa  ARSR_ECOLI RecName: Full=Arsenical resistance operon repressor;
   11::64      9e-05  39%   95 aa  Y229_METJA RecName: Full=Uncharacterized HTH-type transcriptional
   27::83      9e-05  37%  125 aa  MERR_STRLI RecName: Full=Probable mercury resistance operon
    2::67      9e-05  34%  117 aa  ARSR2_ECOLX RecName: Full=Arsenical resistance operon repressor;
   33::85      2e-04  38%  117 aa  BIGR_AGRT5 RecName: Full=Biofilm growth-associated repressor;
   10::85      6e-04  36%  118 aa  CMTR_MYCTU RecName: Full=HTH-type transcriptional regulator cmtR;
   10::85      6e-04  36%  118 aa  CMTR_MYCBO RecName: Full=HTH-type transcriptional regulator cmtR;
    1::121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxPHVALDATFQALADTTRRTMLAQLARGPLSVTELARPLAMSLPAVMQHLSVLEQAGLVRTEKVG
YUZN_BACSU      -----------DAIFKALGDSTRRLILDELSRNELTLYELTYDLSITRQAIAKHLSVLEDAGLVTSKRKG
SDPR_BACSU      ----------MNNVFKAISDPTRRKILDLLKGGDMTAGDIAEHFNISKPSISHHLNILKQAEVISDHRKG
ZIAR_SYNY3      --------------FSALADPSRLRLMSALARQELCVCDLAAAMKVSESAVSHQLRILRSQRLVKYRRVG
Y1325_METJA     --------------FKAFGDPTRLMILKLLAEGSMCVCKIIDELKKPQPTISHHLNILKKAGIVKARKEG
HLYU_VIBCH      ---------------KAMANERRLQILCMLLDNELSVGELSSRLELSQSALSQHLAWLRRDGLVNTRK--
ASER_BACSU      ---------AMTRCLKTLSDQTRLIMMRLFLEQEYCVCQLVDMFEMSQPAISQHLRKLKNAGFVNEDRRG
ARSR_ECOLI      --------------FKILADETRLGIVLLLSEGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQG
Y229_METJA      ---------------EALSNPIRVKILYILNKQPKNIYELAKELELSRPVVYAHLRKLEDADLVESDLV-
MERR_STRLI      --------------FRALADPTRLKLLQFILRGERTSAECVEHAGISQPRVSVHLSCLVDCGYVSARRDG
ARSR2_ECOLX     ------PEIASLQLFKILSDETRLGIVLLLREGELCVCDLCTALEQSQPKTSRHLAMLRESGLLLDRKQG
BIGR_AGRT5      ---------------KTLAHPARLMLACTLAQGEFSVGELEAKLDIRQPTLSQQLGVLREAGIVDTRR--
CMTR_MYCTU      ---------ALARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEG
CMTR_MYCBO      ---------ALARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEG


                         .         .         *         .         .         .         .:140
query           RVRTCTMAPKALSEAEQWIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YUZN_BACSU      KYR------------------------------------------------
SDPR_BACSU      QFIYYSLNTTVLQDSINWM--------------------------------
ZIAR_SYNY3      R--------------------------------------------------
Y1325_METJA     ---------------------------------------------------
HLYU_VIBCH      ---------------------------------------------------
ASER_BACSU      QWR------------------------------------------------
ARSR_ECOLI      K--------------------------------------------------
Y229_METJA      ---------------------------------------------------
MERR_STRLI      K--------------------------------------------------
ARSR2_ECOLX     K--------------------------------------------------
BIGR_AGRT5      ---------------------------------------------------
CMTR_MYCTU      RQVRYALADSHLARA------------------------------------
CMTR_MYCBO      RQVRYALADSHLARA------------------------------------