[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08687.1

[Show Plain Result]


## Summary of Sequence Search
    1::564
    7::292     e-113  68%  295 aa  PEPM_MYTED RecName: Full=Phosphoenolpyruvate phosphomutase;        
   12::300     e-106  63%  300 aa  PEPM_TETPY RecName: Full=Phosphoenolpyruvate phosphomutase;        
   17::311     9e-68  48%  313 aa  PEPM_STRVR RecName: Full=Phosphoenolpyruvate phosphomutase;        
   14::311     3e-59  43%  313 aa  PEPM_STRHY RecName: Full=Phosphoenolpyruvate phosphomutase;        
    1::286     6e-30  30%  295 aa  CPPM_STRHY RecName: Full=Carboxyvinyl-carboxyphosphonate
   17::291     4e-29  33%  300 aa  PRPB_BACHD RecName: Full=Methylisocitrate lyase;       
   33::297     5e-29  32%  307 aa  PRPB2_CORGL RecName: Full=Probable methylisocitrate lyase 2;       
   16::284     1e-27  31%  308 aa  PRPB_AERPE RecName: Full=Methylisocitrate lyase;       
   15::282     2e-25  32%  301 aa  PRPB_BACSU RecName: Full=Methylisocitrate lyase;       
    1::297     3e-25  29%  305 aa  PRPB1_CORGL RecName: Full=Probable methylisocitrate lyase 1;       
    5::192     1e-23  37%  288 aa  OADC_RHOPB RecName: Full=Oxaloacetate decarboxylase;       
   44::327     3e-23  29%  339 aa  CPPM_ARATH RecName: Full=Putative carboxyvinyl-carboxyphosphonate
    5::183     5e-23  36%  289 aa  OADC_RHOP5 RecName: Full=Oxaloacetate decarboxylase;       
    5::193     1e-22  34%  288 aa  OADC_BRAJA RecName: Full=Oxaloacetate decarboxylase;       
    2::212     8e-22  34%  287 aa  OADC_PSEU5 RecName: Full=Oxaloacetate decarboxylase;       
    6::207     2e-21  33%  288 aa  OADC_BRASO RecName: Full=Oxaloacetate decarboxylase;       
    5::207     3e-21  32%  288 aa  OADC_BRASB RecName: Full=Oxaloacetate decarboxylase;       
    9::268     1e-20  28%  308 aa  PRPB_VIBCH RecName: Full=Methylisocitrate lyase;       
   23::307     1e-20  26%  318 aa  PDP_DIACA RecName: Full=Petal death protein;         EC=3.7.1.1;   
   14::185     3e-20  34%  289 aa  OADC1_PSEPW RecName: Full=Oxaloacetate decarboxylase 1;       
    5::183     4e-20  36%  289 aa  OADC_RHOPS RecName: Full=Oxaloacetate decarboxylase;       
   14::185     4e-20  34%  289 aa  OADC_PSEPG RecName: Full=Oxaloacetate decarboxylase;       
   14::185     9e-20  33%  289 aa  OADC_PSEE4 RecName: Full=Oxaloacetate decarboxylase;       
   14::185     1e-19  33%  289 aa  OADC_PSEPK RecName: Full=Oxaloacetate decarboxylase;       
   14::185     1e-19  33%  289 aa  OADC_PSEP1 RecName: Full=Oxaloacetate decarboxylase;       
    6::207     2e-19  33%  289 aa  OADC_RHOP2 RecName: Full=Oxaloacetate decarboxylase;       
   13::190     2e-19  34%  290 aa  OADC_PSEMY RecName: Full=Oxaloacetate decarboxylase;       
    2::196     2e-19  31%  299 aa  OADC_BURXL RecName: Full=Oxaloacetate decarboxylase;       
   14::185     4e-19  33%  289 aa  OADC_PSEF5 RecName: Full=Oxaloacetate decarboxylase;       
   14::286     5e-19  28%  295 aa  PRPB_SALTY RecName: Full=Methylisocitrate lyase;       
   16::187     6e-19  33%  302 aa  OADC2_PSEPW RecName: Full=Oxaloacetate decarboxylase 2;       
   12::185     8e-19  34%  287 aa  OADC_AZOVD RecName: Full=Oxaloacetate decarboxylase;       
   14::286     1e-18  28%  296 aa  PRPB_ECOLI RecName: Full=Methylisocitrate lyase;       
   14::187     1e-18  33%  287 aa  OADC_CHRSD RecName: Full=Oxaloacetate decarboxylase;       
   14::187     1e-18  34%  289 aa  OADC_PSE14 RecName: Full=Oxaloacetate decarboxylase;       
   14::187     2e-18  34%  289 aa  OADC_PSEU2 RecName: Full=Oxaloacetate decarboxylase;       
    2::266     2e-18  29%  289 aa  OADC_PSEFS RecName: Full=Oxaloacetate decarboxylase;       
   14::185     2e-18  32%  289 aa  OADC1_PSEPF RecName: Full=Oxaloacetate decarboxylase 1;       
   14::187     4e-18  33%  289 aa  OADC_PSESM RecName: Full=Oxaloacetate decarboxylase;       
   11::187     4e-18  32%  287 aa  OADC_PSEAE RecName: Full=Oxaloacetate decarboxylase;       
   11::187     4e-18  32%  287 aa  OADC_PSEAB RecName: Full=Oxaloacetate decarboxylase;       
   11::187     4e-18  32%  287 aa  OADC_PSEA8 RecName: Full=Oxaloacetate decarboxylase;       
   11::187     4e-18  32%  287 aa  OADC_PSEA7 RecName: Full=Oxaloacetate decarboxylase;       
   14::185     9e-18  32%  287 aa  OADC_MARMS RecName: Full=Oxaloacetate decarboxylase;       
    6::192     3e-17  32%  288 aa  OADC_RHOPA RecName: Full=Oxaloacetate decarboxylase;       
    6::192     2e-16  31%  288 aa  OADC_RHOPT RecName: Full=Oxaloacetate decarboxylase;       
   15::187     3e-13  28%  290 aa  OADC2_PSEPF RecName: Full=Oxaloacetate decarboxylase 2;       
    1::121     8e-13  38%  484 aa  GLMU_DEIRA RecName: Full=Bifunctional protein glmU;Includes:
    3::128     9e-12  35%  414 aa  GLMU_METVS RecName: Full=Bifunctional protein glmU;Includes:
    3::128     6e-11  32%  411 aa  GLMU_METM5 RecName: Full=Bifunctional protein glmU;Includes:
    2::98      1e-10  36%  446 aa  GLMU_KOSOT RecName: Full=Bifunctional protein glmU;Includes:
    4::198     1e-10  28%  452 aa  GLMU_DECAR RecName: Full=Bifunctional protein glmU;Includes:
    3::104     5e-10  34%  408 aa  GLMU_METJA RecName: Full=Bifunctional protein glmU;Includes:
    1::122     5e-10  35%  481 aa  GLMU_DEIGD RecName: Full=Bifunctional protein glmU;Includes:
    4::191     5e-10  30%  453 aa  GLMU_BURPS RecName: Full=Bifunctional protein glmU;Includes:
    4::191     5e-10  30%  453 aa  GLMU_BURP6 RecName: Full=Bifunctional protein glmU;Includes:
    4::191     5e-10  30%  453 aa  GLMU_BURP1 RecName: Full=Bifunctional protein glmU;Includes:
    4::191     5e-10  30%  453 aa  GLMU_BURP0 RecName: Full=Bifunctional protein glmU;Includes:
    4::191     5e-10  30%  453 aa  GLMU_BURMS RecName: Full=Bifunctional protein glmU;Includes:
    4::191     5e-10  30%  453 aa  GLMU_BURMA RecName: Full=Bifunctional protein glmU;Includes:
    4::191     5e-10  30%  453 aa  GLMU_BURM7 RecName: Full=Bifunctional protein glmU;Includes:
    4::194     7e-10  28%  455 aa  GLMU_STRMK RecName: Full=Bifunctional protein glmU;Includes:
    5::216     9e-10  32%  471 aa  GLMU_SYMTH RecName: Full=Bifunctional protein glmU;Includes:
    7::115     1e-09  38%  462 aa  GLMU_BLOPB RecName: Full=Bifunctional protein glmU;Includes:
    5::200     2e-09  27%  453 aa  GLMU_CELJU RecName: Full=Bifunctional protein glmU;Includes:
    4::213     3e-09  28%  454 aa  GLMU_XANCB RecName: Full=Bifunctional protein glmU;Includes:
    5::103     4e-09  33%  460 aa  GLMU_ACHLI RecName: Full=Bifunctional protein glmU;Includes:
    7::211     7e-09  29%  453 aa  GLMU_RHIE6 RecName: Full=Bifunctional protein glmU;Includes:
    3::108     7e-09  31%  411 aa  GLMU_METM7 RecName: Full=Bifunctional protein glmU;Includes:
    4::194     1e-08  27%  455 aa  GLMU_STRM5 RecName: Full=Bifunctional protein glmU;Includes:
    4::191     1e-08  29%  453 aa  GLMU_BURPP RecName: Full=Bifunctional protein glmU;Includes:
    6::196     1e-08  27%  457 aa  GLMU_XYLFM RecName: Full=Bifunctional protein glmU;Includes:
    6::196     1e-08  27%  457 aa  GLMU_XYLFA RecName: Full=Bifunctional protein glmU;Includes:
    6::196     2e-08  27%  457 aa  GLMU_XYLFT RecName: Full=Bifunctional protein glmU;Includes:
    6::196     2e-08  27%  457 aa  GLMU_XYLF2 RecName: Full=Bifunctional protein glmU;Includes:
    4::200     3e-08  26%  453 aa  GLMU_VIBCM RecName: Full=Bifunctional protein glmU;Includes:
    4::200     3e-08  26%  453 aa  GLMU_VIBCH RecName: Full=Bifunctional protein glmU;Includes:
    4::200     3e-08  26%  453 aa  GLMU_VIBC3 RecName: Full=Bifunctional protein glmU;Includes:
    6::200     3e-08  24%  454 aa  GLMU_TOLAT RecName: Full=Bifunctional protein glmU;Includes:
    2::105     3e-08  36%  473 aa  GLMU_HALHL RecName: Full=Bifunctional protein glmU;Includes:
    4::213     4e-08  27%  454 aa  GLMU_XANOR RecName: Full=Bifunctional protein glmU;Includes:
    3::128     4e-08  30%  411 aa  GLMU_METMP RecName: Full=Bifunctional protein glmU;Includes:
    6::103     4e-08  36%  461 aa  GLMU_CLOTH RecName: Full=Bifunctional protein glmU;Includes:
    4::200     5e-08  25%  452 aa  GLMU_VIBFM RecName: Full=Bifunctional protein glmU;Includes:
    4::200     5e-08  25%  452 aa  GLMU_VIBF1 RecName: Full=Bifunctional protein glmU;Includes:
    7::108     5e-08  36%  453 aa  GLMU_RHIEC RecName: Full=Bifunctional protein glmU;Includes:
    4::142     5e-08  32%  454 aa  GLMU_RALEJ RecName: Full=Bifunctional protein glmU;Includes:
    4::101     5e-08  35%  452 aa  GLMU_AZOSB RecName: Full=Bifunctional protein glmU;Includes:
    4::200     5e-08  25%  452 aa  GLMU_ALISL RecName: Full=Bifunctional protein glmU;Includes:
    4::213     6e-08  27%  454 aa  GLMU_XANOM RecName: Full=Bifunctional protein glmU;Includes:
    7::211     6e-08  28%  453 aa  GLMU_RHILW RecName: Full=Bifunctional protein glmU;Includes:
    2::114     6e-08  34%  454 aa  GLMU_MARAV RecName: Full=Bifunctional protein glmU;Includes:
    2::93      6e-08  32%  460 aa  GLMU_GEOLS RecName: Full=Bifunctional protein glmU;Includes:
    4::200     8e-08  26%  453 aa  GLMU_VIBVY RecName: Full=Bifunctional protein glmU;Includes:
    4::200     8e-08  26%  453 aa  GLMU_VIBVU RecName: Full=Bifunctional protein glmU;Includes:
   18::114     8e-08  38%  461 aa  GLMU_GLUDA RecName: Full=Bifunctional protein glmU;Includes:
    4::101     8e-08  33%  453 aa  GLMU_BURP8 RecName: Full=Bifunctional protein glmU;Includes:
    4::200     8e-08  27%  453 aa  GLMU_AERHH RecName: Full=Bifunctional protein glmU;Includes:
    4::101     1e-07  32%  452 aa  GLMU_JANMA RecName: Full=Bifunctional protein glmU;Includes:
    4::106     1e-07  30%  456 aa  GLMU_EDWI9 RecName: Full=Bifunctional protein glmU;Includes:
    4::191     1e-07  28%  453 aa  GLMU_BURXL RecName: Full=Bifunctional protein glmU;Includes:
    4::191     1e-07  27%  453 aa  GLMU_BURCH RecName: Full=Bifunctional protein glmU;Includes:
    4::191     1e-07  27%  453 aa  GLMU_BURCA RecName: Full=Bifunctional protein glmU;Includes:
    4::192     1e-07  27%  454 aa  GLMU_SHEAM RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-07  31%  456 aa  GLMU_ENTS8 RecName: Full=Bifunctional protein glmU;Includes:
    4::117     2e-07  30%  459 aa  GLMU_THISH RecName: Full=Bifunctional protein glmU;Includes:
    5::102     2e-07  31%  451 aa  GLMU_SACD2 RecName: Full=Bifunctional protein glmU;Includes:
    4::198     2e-07  24%  452 aa  GLMU_HERAR RecName: Full=Bifunctional protein glmU;Includes:
    6::116     2e-07  31%  457 aa  GLMU_THETN RecName: Full=Bifunctional protein glmU;Includes:
    5::133     2e-07  32%  452 aa  GLMU_SPHWW RecName: Full=Bifunctional protein glmU;Includes:
    7::205     2e-07  30%  458 aa  GLMU_SODGM RecName: Full=Bifunctional protein glmU;Includes:
    4::192     2e-07  28%  454 aa  GLMU_SHEHH RecName: Full=Bifunctional protein glmU;Includes:
    7::211     2e-07  29%  453 aa  GLMU_RHIL3 RecName: Full=Bifunctional protein glmU;Includes:
    7::94      2e-07  35%  464 aa  GLMU_PELCD RecName: Full=Bifunctional protein glmU;Includes:
    4::101     2e-07  34%  453 aa  GLMU_BURTA RecName: Full=Bifunctional protein glmU;Includes:
    6::123     3e-07  33%  450 aa  GLMU_ZYMMO RecName: Full=Bifunctional protein glmU;Includes:
    4::138     3e-07  33%  451 aa  GLMU_SPHAL RecName: Full=Bifunctional protein glmU;Includes:
    4::200     3e-07  24%  453 aa  GLMU_PHOPR RecName: Full=Bifunctional protein glmU;Includes:
    6::107     3e-07  31%  452 aa  GLMU_HAHCH RecName: Full=Bifunctional protein glmU;Includes:
    4::98      3e-07  36%  452 aa  GLMU_FERNB RecName: Full=Bifunctional protein glmU;Includes:
    4::112     4e-07  33%  451 aa  GLMU_THEAB RecName: Full=Bifunctional protein glmU;Includes:
    7::188     4e-07  24%  456 aa  GLMU_SERP5 RecName: Full=Bifunctional protein glmU;Includes:
    7::229     4e-07  29%  458 aa  GLMU_NITEU RecName: Full=Bifunctional protein glmU;Includes:
    2::92      4e-07  34%  457 aa  GLMU_GEOSF RecName: Full=Bifunctional protein glmU;Includes:
    5::106     4e-07  30%  456 aa  GLMU_ERWT9 RecName: Full=Bifunctional protein glmU;Includes:
    5::117     4e-07  30%  455 aa  GLMU_CLOTE RecName: Full=Bifunctional protein glmU;Includes:
    4::191     4e-07  28%  453 aa  GLMU_BURA4 RecName: Full=Bifunctional protein glmU;Includes:
    3::107     4e-07  34%  457 aa  GLMU_BORA1 RecName: Full=Bifunctional protein glmU;Includes:
    3::57      4e-07  42%  464 aa  GLMU_AQUAE RecName: Full=Bifunctional protein glmU;Includes:
    7::106     5e-07  29%  456 aa  GLMU_YERE8 RecName: Full=Bifunctional protein glmU;Includes:
    4::213     5e-07  26%  456 aa  GLMU_XANAC RecName: Full=Bifunctional protein glmU;Includes:
    4::117     5e-07  33%  449 aa  GLMU_SYNWW RecName: Full=Bifunctional protein glmU;Includes:
    4::61      5e-07  41%  466 aa  GLMU_DESAP RecName: Full=Bifunctional protein glmU;Includes:
    6::104     5e-07  35%  461 aa  GLMU_BREBN RecName: Full=Bifunctional protein glmU;Includes:
    3::121     7e-07  31%  365 aa  GMPPB_CAEEL RecName: Full=Mannose-1-phosphate guanyltransferase
    4::213     7e-07  26%  454 aa  GLMU_XANC5 RecName: Full=Bifunctional protein glmU;Includes:
    5::214     7e-07  25%  451 aa  GLMU_STAES RecName: Full=Bifunctional protein glmU;Includes:
    5::214     7e-07  25%  451 aa  GLMU_STAEQ RecName: Full=Bifunctional protein glmU;Includes:
    5::214     7e-07  25%  451 aa  GLMU_STAEP RecName: Full=Bifunctional protein glmU;Includes:
    4::200     7e-07  25%  454 aa  GLMU_SHESA RecName: Full=Bifunctional protein glmU;Includes:
    4::105     7e-07  33%  454 aa  GLMU_RALME RecName: Full=Bifunctional protein glmU;Includes:
    5::186     7e-07  23%  454 aa  GLMU_MANSM RecName: Full=Bifunctional protein glmU;Includes:
    4::191     7e-07  28%  453 aa  GLMU_BURM1 RecName: Full=Bifunctional protein glmU;Includes:
    5::63      9e-07  39%  283 aa  Y1334_METJA RecName: Full=Putative UTP--glucose-1-phosphate
    4::192     9e-07  25%  454 aa  GLMU_SHEWM RecName: Full=Bifunctional protein glmU;Includes:
    4::192     9e-07  25%  454 aa  GLMU_SHEPA RecName: Full=Bifunctional protein glmU;Includes:
    4::185     9e-07  24%  454 aa  GLMU_SHEDO RecName: Full=Bifunctional protein glmU;Includes:
    2::105     9e-07  33%  418 aa  GLMU_PROAC RecName: Full=Bifunctional protein glmU;Includes:
    5::193     9e-07  23%  453 aa  GLMU_HAES1 RecName: Full=Bifunctional protein glmU;Includes:
    3::226     1e-06  26%  355 aa  STRD_STRGR RecName: Full=Glucose-1-phosphate thymidylyltransferase;
    7::106     1e-06  29%  456 aa  GLMU_YERPY RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-06  29%  456 aa  GLMU_YERPS RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-06  29%  456 aa  GLMU_YERPP RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-06  29%  456 aa  GLMU_YERPN RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-06  29%  456 aa  GLMU_YERPE RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-06  29%  456 aa  GLMU_YERPB RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-06  29%  456 aa  GLMU_YERPA RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-06  29%  456 aa  GLMU_YERP3 RecName: Full=Bifunctional protein glmU;Includes:
    4::192     1e-06  27%  454 aa  GLMU_SHEPW RecName: Full=Bifunctional protein glmU;Includes:
    3::133     1e-06  31%  411 aa  GLMU_META3 RecName: Full=Bifunctional protein glmU;Includes:
    5::193     1e-06  23%  453 aa  GLMU_HAES2 RecName: Full=Bifunctional protein glmU;Includes:
    5::226     1e-06  27%  455 aa  GLMU_CHRVO RecName: Full=Bifunctional protein glmU;Includes:
    3::119     1e-06  33%  456 aa  GLMU_BORPD RecName: Full=Bifunctional protein glmU;Includes:
    4::116     2e-06  31%  451 aa  GLMU_STAHJ RecName: Full=Bifunctional protein glmU;Includes:
    4::192     2e-06  27%  455 aa  GLMU_SHESH RecName: Full=Bifunctional protein glmU;Includes:
    3::110     2e-06  33%  450 aa  GLMU_ROSDO RecName: Full=Bifunctional protein glmU;Includes:
    3::109     2e-06  29%  458 aa  GLMU_PSYA2 RecName: Full=Bifunctional protein glmU;Includes:
    4::116     2e-06  28%  453 aa  GLMU_PSEA6 RecName: Full=Bifunctional protein glmU;Includes:
    5::92      2e-06  37%  476 aa  GLMU_GEOSL RecName: Full=Bifunctional protein glmU;Includes:
    3::121     2e-06  29%  364 aa  GMPPB_CAEBR RecName: Full=Mannose-1-phosphate guanyltransferase
    4::200     2e-06  24%  454 aa  GLMU_SHEFN RecName: Full=Bifunctional protein glmU;Includes:
    4::120     2e-06  26%  452 aa  GLMU_PSYIN RecName: Full=Bifunctional protein glmU;Includes:
    7::188     2e-06  26%  456 aa  GLMU_PECCP RecName: Full=Bifunctional protein glmU;Includes:
    5::193     2e-06  26%  453 aa  GLMU_HAEPS RecName: Full=Bifunctional protein glmU;Includes:
    3::99      3e-06  33%  445 aa  GLMU_THESQ RecName: Full=Bifunctional protein glmU;Includes:
    3::99      3e-06  33%  445 aa  GLMU_THEP1 RecName: Full=Bifunctional protein glmU;Includes:
    6::102     3e-06  33%  455 aa  GLMU_PSE14 RecName: Full=Bifunctional protein glmU;Includes:
    7::188     3e-06  27%  456 aa  GLMU_ERWCT RecName: Full=Bifunctional protein glmU;Includes:
    3::196     3e-06  27%  457 aa  GLMU_BORPE RecName: Full=Bifunctional protein glmU;Includes:
    3::196     3e-06  27%  457 aa  GLMU_BORPA RecName: Full=Bifunctional protein glmU;Includes:
    3::196     3e-06  27%  457 aa  GLMU_BORBR RecName: Full=Bifunctional protein glmU;Includes:
    6::135     3e-06  31%  455 aa  GLMU_OCEIH RecName: Full=Bifunctional protein glmU;Includes:
    5::92      3e-06  31%  457 aa  GLMU_GEOUR RecName: Full=Bifunctional protein glmU;Includes:
    4::158     3e-06  28%  451 aa  GLMU_FRAP2 RecName: Full=Bifunctional protein glmU;Includes:
    5::91      3e-06  34%  456 aa  GLMU_CLOK5 RecName: Full=Bifunctional protein glmU;Includes:
    5::91      3e-06  34%  456 aa  GLMU_CLOK1 RecName: Full=Bifunctional protein glmU;Includes:
    5::115     3e-06  29%  459 aa  GLMU_CLOD6 RecName: Full=Bifunctional protein glmU;Includes:
    7::65      4e-06  37%  288 aa  GTAB_STAHJ RecName: Full=UTP--glucose-1-phosphate
    3::99      4e-06  33%  445 aa  GLMU_THEMA RecName: Full=Bifunctional protein glmU;Includes:
    5::113     4e-06  30%  450 aa  GLMU_STAAW RecName: Full=Bifunctional protein glmU;Includes:
    5::113     4e-06  30%  450 aa  GLMU_STAAS RecName: Full=Bifunctional protein glmU;Includes:
    5::113     4e-06  30%  450 aa  GLMU_STAAR RecName: Full=Bifunctional protein glmU;Includes:
    5::113     4e-06  30%  450 aa  GLMU_STAAN RecName: Full=Bifunctional protein glmU;Includes:
    5::113     4e-06  30%  450 aa  GLMU_STAAM RecName: Full=Bifunctional protein glmU;Includes:
    5::113     4e-06  30%  450 aa  GLMU_STAAC RecName: Full=Bifunctional protein glmU;Includes:
    5::113     4e-06  30%  450 aa  GLMU_STAAB RecName: Full=Bifunctional protein glmU;Includes:
    5::113     4e-06  30%  450 aa  GLMU_STAA3 RecName: Full=Bifunctional protein glmU;Includes:
    4::200     4e-06  24%  454 aa  GLMU_SHESW RecName: Full=Bifunctional protein glmU;Includes:
    4::200     4e-06  24%  454 aa  GLMU_SHEPC RecName: Full=Bifunctional protein glmU;Includes:
    4::192     4e-06  27%  454 aa  GLMU_SHELP RecName: Full=Bifunctional protein glmU;Includes:
    7::195     4e-06  26%  458 aa  GLMU_PASMU RecName: Full=Bifunctional protein glmU;Includes:
    3::131     4e-06  30%  451 aa  GLMU_NOVAD RecName: Full=Bifunctional protein glmU;Includes:
    7::207     4e-06  23%  456 aa  GLMU_HAEIN RecName: Full=Bifunctional protein glmU;Includes:
    5::60      4e-06  36%  476 aa  GLMU_GEOMG RecName: Full=Bifunctional protein glmU;Includes:
    5::88      4e-06  32%  455 aa  GLMU_DESVV RecName: Full=Bifunctional protein glmU;Includes:
    5::88      4e-06  32%  455 aa  GLMU_DESVH RecName: Full=Bifunctional protein glmU;Includes:
    4::186     4e-06  26%  455 aa  GLMU_COXBN RecName: Full=Bifunctional protein glmU;Includes:
    7::97      4e-06  36%  291 aa  GALU_MYCPN RecName: Full=UTP--glucose-1-phosphate
    7::65      6e-06  36%  292 aa  GTAB_BACSU RecName: Full=UTP--glucose-1-phosphate
    7::65      6e-06  37%  289 aa  GTAB2_STAS1 RecName: Full=UTP--glucose-1-phosphate
    6::102     6e-06  35%  455 aa  GLMU_PSEU2 RecName: Full=Bifunctional protein glmU;Includes:
    6::200     6e-06  28%  452 aa  GLMU_PSEMY RecName: Full=Bifunctional protein glmU;Includes:
    6::192     6e-06  31%  454 aa  GLMU_PSEAE RecName: Full=Bifunctional protein glmU;Includes:
    6::192     6e-06  31%  454 aa  GLMU_PSEAB RecName: Full=Bifunctional protein glmU;Includes:
    6::192     6e-06  31%  454 aa  GLMU_PSEA8 RecName: Full=Bifunctional protein glmU;Includes:
    6::192     6e-06  29%  454 aa  GLMU_PSEA7 RecName: Full=Bifunctional protein glmU;Includes:
    7::144     6e-06  28%  458 aa  GLMU_NITEC RecName: Full=Bifunctional protein glmU;Includes:
    4::107     6e-06  30%  461 aa  GLMU_COLP3 RecName: Full=Bifunctional protein glmU;Includes:
    4::225     6e-06  28%  452 aa  GLMU_ALCBS RecName: Full=Bifunctional protein glmU;Includes:
    5::193     6e-06  24%  454 aa  GLMU_ACTSZ RecName: Full=Bifunctional protein glmU;Includes:
    3::60      8e-06  40%  257 aa  RFBF_SALTY RecName: Full=Glucose-1-phosphate cytidylyltransferase; 
    4::200     8e-06  24%  454 aa  GLMU_SHESM RecName: Full=Bifunctional protein glmU;Includes:
   12::109     8e-06  32%  458 aa  GLMU_METFK RecName: Full=Bifunctional protein glmU;Includes:
    7::207     8e-06  23%  456 aa  GLMU_HAEI8 RecName: Full=Bifunctional protein glmU;Includes:
    4::186     8e-06  26%  455 aa  GLMU_COXB1 RecName: Full=Bifunctional protein glmU;Includes:
    4::117     8e-06  36%  456 aa  GLMU_CLONN RecName: Full=Bifunctional protein glmU;Includes:
    5::102     1e-05  29%  450 aa  GLMU_STAA8 RecName: Full=Bifunctional protein glmU;Includes:
    6::102     1e-05  35%  455 aa  GLMU_PSEF5 RecName: Full=Bifunctional protein glmU;Includes:
    7::207     1e-05  22%  456 aa  GLMU_HAEIG RecName: Full=Bifunctional protein glmU;Includes:
    7::207     1e-05  22%  456 aa  GLMU_HAEIE RecName: Full=Bifunctional protein glmU;Includes:
    5::105     1e-05  28%  456 aa  GLMU_HAEDU RecName: Full=Bifunctional protein glmU;Includes:
    4::186     1e-05  26%  455 aa  GLMU_COXB2 RecName: Full=Bifunctional protein glmU;Includes:
    5::59      1e-05  38%  455 aa  GLMU_CLOBB RecName: Full=Bifunctional protein glmU;Includes:
    5::59      1e-05  38%  455 aa  GLMU_CLOBA RecName: Full=Bifunctional protein glmU;Includes:
    7::127     1e-05  31%  476 aa  GLMU_ACISJ RecName: Full=Bifunctional protein glmU;Includes:
    6::64      1e-05  37%  287 aa  GTAB1_STAS1 RecName: Full=UTP--glucose-1-phosphate
    4::200     1e-05  24%  454 aa  GLMU_SHESR RecName: Full=Bifunctional protein glmU;Includes:
    4::103     1e-05  32%  460 aa  GLMU_SHEB5 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALTY RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALTI RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALSV RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALPK RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALPB RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALPA RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALNS RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALHS RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALG2 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALEP RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALDC RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALCH RecName: Full=Bifunctional protein glmU;Includes:
    7::106     1e-05  29%  456 aa  GLMU_SALA4 RecName: Full=Bifunctional protein glmU;Includes:
    5::88      1e-05  32%  455 aa  GLMU_DESVM RecName: Full=Bifunctional protein glmU;Includes:
    1::95      1e-05  32%  460 aa  GLMU_DESDG RecName: Full=Bifunctional protein glmU;Includes:
    6::115     1e-05  33%  453 aa  GLMU_CHRSD RecName: Full=Bifunctional protein glmU;Includes:
   30::124     2e-05  37%  291 aa  ISPD_BIFLD RecName: Full=2-C-methyl-D-erythritol 4-phosphate
    4::112     2e-05  27%  450 aa  GLMU_THEM4 RecName: Full=Bifunctional protein glmU;Includes:
    4::103     2e-05  28%  460 aa  GLMU_SHEB8 RecName: Full=Bifunctional protein glmU;Includes:
    4::103     2e-05  28%  460 aa  GLMU_SHEB2 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     2e-05  28%  457 aa  GLMU_PHOLL RecName: Full=Bifunctional protein glmU;Includes:
    7::123     2e-05  33%  449 aa  GLMU_MAGSA RecName: Full=Bifunctional protein glmU;Includes:
    5::85      2e-05  35%  451 aa  GLMU_EXISA RecName: Full=Bifunctional protein glmU;Includes:
    4::186     2e-05  26%  455 aa  GLMU_COXBU RecName: Full=Bifunctional protein glmU;Includes:
    4::186     2e-05  26%  455 aa  GLMU_COXBR RecName: Full=Bifunctional protein glmU;Includes:
    5::118     2e-05  28%  454 aa  GLMU_CLOPS RecName: Full=Bifunctional protein glmU;Includes:
    6::192     2e-05  30%  454 aa  GLMU_AZOVD RecName: Full=Bifunctional protein glmU;Includes:
    9::68      2e-05  41%  414 aa  GLGC_KOCRD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    3::109     2e-05  31%  359 aa  MPG1_SULAC RecName: Full=Putative mannose-1-phosphate
    2::111     2e-05  26%  233 aa  LICC_HAEIN RecName: Full=Protein licC;
   30::124     2e-05  37%  291 aa  ISPD_BIFLO RecName: Full=2-C-methyl-D-erythritol 4-phosphate
   30::124     2e-05  37%  291 aa  ISPD_BIFLI RecName: Full=2-C-methyl-D-erythritol 4-phosphate
    4::200     2e-05  23%  453 aa  GLMU_VIBPA RecName: Full=Bifunctional protein glmU;Includes:
    7::55      2e-05  39%  457 aa  GLMU_THEP3 RecName: Full=Bifunctional protein glmU;Includes:
    5::228     2e-05  28%  451 aa  GLMU_STAS1 RecName: Full=Bifunctional protein glmU;Includes:
    4::103     2e-05  28%  460 aa  GLMU_SHEB9 RecName: Full=Bifunctional protein glmU;Includes:
    5::85      2e-05  31%  449 aa  GLMU_EXIS2 RecName: Full=Bifunctional protein glmU;Includes:
    5::96      2e-05  31%  454 aa  GLMU_CLOP1 RecName: Full=Bifunctional protein glmU;Includes:
    4::101     2e-05  31%  455 aa  GLMU_AZOSE RecName: Full=Bifunctional protein glmU;Includes:
    6::102     3e-05  32%  455 aa  GLMU_PSESM RecName: Full=Bifunctional protein glmU;Includes:
    6::102     3e-05  36%  455 aa  GLMU_PSEPK RecName: Full=Bifunctional protein glmU;Includes:
    6::102     3e-05  36%  455 aa  GLMU_PSEPG RecName: Full=Bifunctional protein glmU;Includes:
    6::62      3e-05  39%  459 aa  GLMU_GEOSW RecName: Full=Bifunctional protein glmU;Includes:
    3::117     3e-05  29%  451 aa  GLMU_CYAP7 RecName: Full=Bifunctional protein glmU;Includes:
    5::96      3e-05  31%  454 aa  GLMU_CLOPE RecName: Full=Bifunctional protein glmU;Includes:
    9::68      3e-05  39%  405 aa  GLGC_CORGL RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   13::72      3e-05  39%  409 aa  GLGC_CORGB RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::68      3e-05  39%  405 aa  GLGC_CORA7 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::63      3e-05  38%  279 aa  GALU2_PSEAE RecName: Full=UTP--glucose-1-phosphate
    5::159     3e-05  34%  452 aa  EI2BG_HUMAN RecName: Full=Translation initiation factor eIF-2B
    4::125     4e-05  25%  454 aa  GLMU_SHEON RecName: Full=Bifunctional protein glmU;Includes:
    6::102     4e-05  32%  455 aa  GLMU_PSEE4 RecName: Full=Bifunctional protein glmU;Includes:
    3::116     4e-05  30%  449 aa  GLMU_PROM0 RecName: Full=Bifunctional protein glmU;Includes:
    8::120     4e-05  32%  452 aa  GLMU_PARL1 RecName: Full=Bifunctional protein glmU;Includes:
    6::105     4e-05  32%  452 aa  GLMU_MARMM RecName: Full=Bifunctional protein glmU;Includes:
    6::103     4e-05  32%  459 aa  GLMU_GEOTN RecName: Full=Bifunctional protein glmU;Includes:
    5::109     4e-05  30%  463 aa  GLMU_CALS8 RecName: Full=Bifunctional protein glmU;Includes:
    5::103     4e-05  28%  454 aa  GLMU_ACTPJ RecName: Full=Bifunctional protein glmU;Includes:
    5::103     4e-05  28%  454 aa  GLMU_ACTP7 RecName: Full=Bifunctional protein glmU;Includes:
    5::103     4e-05  28%  457 aa  GLMU_ACTP2 RecName: Full=Bifunctional protein glmU;Includes:
   28::143     4e-05  25%  446 aa  GLGC_RHOBA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::66      4e-05  32%  411 aa  GLGC_ANADF RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  142::355     4e-05  27%  542 aa  ACEA_KLULA RecName: Full=Isocitrate lyase;         Short=ICL;      
    4::200     5e-05  23%  453 aa  GLMU_VIBHB RecName: Full=Bifunctional protein glmU;Includes:
    6::102     5e-05  36%  455 aa  GLMU_PSEP1 RecName: Full=Bifunctional protein glmU;Includes:
    3::87      5e-05  31%  449 aa  GLMU_PROM9 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     5e-05  27%  456 aa  GLMU_KLEP7 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     5e-05  27%  456 aa  GLMU_KLEP3 RecName: Full=Bifunctional protein glmU;Includes:
    5::115     5e-05  32%  453 aa  GLMU_DESHY RecName: Full=Bifunctional protein glmU;Includes:
   10::69      5e-05  36%  408 aa  GLGC_PROAC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   13::72      5e-05  39%  409 aa  GLGC_COREF RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::65      5e-05  40%  292 aa  GALU_MYCGE RecName: Full=UTP--glucose-1-phosphate
  136::246     5e-05  33%  538 aa  ACEA_EMENI RecName: Full=Isocitrate lyase;         Short=ICL;      
    5::64      6e-05  39%  272 aa  YTDA_BACSU RecName: Full=Putative UTP--glucose-1-phosphate
    4::122     6e-05  28%  364 aa  MPG1_PICAN RecName: Full=Mannose-1-phosphate guanyltransferase;    
    6::109     6e-05  27%  458 aa  GLMU_PSYCK RecName: Full=Bifunctional protein glmU;Includes:
    3::116     6e-05  30%  449 aa  GLMU_PROMS RecName: Full=Bifunctional protein glmU;Includes:
    4::103     6e-05  32%  453 aa  GLMU_NITOC RecName: Full=Bifunctional protein glmU;Includes:
    6::103     6e-05  33%  457 aa  GLMU_LISMH RecName: Full=Bifunctional protein glmU;Includes:
    6::103     6e-05  33%  457 aa  GLMU_LISMF RecName: Full=Bifunctional protein glmU;Includes:
    6::103     6e-05  33%  457 aa  GLMU_LISMC RecName: Full=Bifunctional protein glmU;Includes:
    5::115     6e-05  32%  453 aa  GLMU_DESHD RecName: Full=Bifunctional protein glmU;Includes:
    5::59      6e-05  33%  457 aa  GLMU_CLOBM RecName: Full=Bifunctional protein glmU;Includes:
    5::59      6e-05  33%  457 aa  GLMU_CLOB6 RecName: Full=Bifunctional protein glmU;Includes:
    5::90      6e-05  33%  456 aa  GLMU_CLOAB RecName: Full=Bifunctional protein glmU;Includes:
    3::116     6e-05  25%  454 aa  GLMU_ACIBY RecName: Full=Bifunctional protein glmU;Includes:
    3::116     6e-05  25%  454 aa  GLMU_ACIBC RecName: Full=Bifunctional protein glmU;Includes:
   33::91      6e-05  40%  440 aa  GLGC_DECAR RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   31::90      6e-05  39%  427 aa  GLGC_CORDI RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::65      6e-05  34%  413 aa  GLGC_ANASK RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::65      6e-05  34%  413 aa  GLGC_ANADE RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::65      6e-05  34%  413 aa  GLGC_ANAD2 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::64      6e-05  34%  297 aa  GALF_SALTY RecName: Full=UTP--glucose-1-phosphate
    6::64      6e-05  34%  297 aa  GALF_SALTI RecName: Full=UTP--glucose-1-phosphate
    8::66      6e-05  34%  298 aa  GALF_KLEPN RecName: Full=UTP--glucose-1-phosphate
    8::66      6e-05  37%  299 aa  CAP4C_STRPN RecName: Full=UTP--glucose-1-phosphate
  159::247     6e-05  35%  538 aa  ACEA_COCIM RecName: Full=Isocitrate lyase;         Short=ICL;      
    5::212     8e-05  29%  459 aa  GLMU_STRMU RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_SHISS RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_SHIFL RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_SHIF8 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_SHIDS RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_SHIBS RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_SHIB3 RecName: Full=Bifunctional protein glmU;Includes:
    6::105     8e-05  26%  455 aa  GLMU_PSYWF RecName: Full=Bifunctional protein glmU;Includes:
    8::108     8e-05  32%  454 aa  GLMU_OCHA4 RecName: Full=Bifunctional protein glmU;Includes:
    6::62      8e-05  39%  461 aa  GLMU_LEGPH RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ESCF3 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ENT38 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECOUT RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECOSM RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECOSE RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECOLU RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECOLI RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECOLC RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECOL6 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECOL5 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECOK1 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECOHS RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECODH RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECOBW RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECO8A RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECO81 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECO7I RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECO5E RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECO57 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECO55 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECO45 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECO27 RecName: Full=Bifunctional protein glmU;Includes:
    7::106     8e-05  27%  456 aa  GLMU_ECO24 RecName: Full=Bifunctional protein glmU;Includes:
    5::59      8e-05  33%  457 aa  GLMU_CLOBL RecName: Full=Bifunctional protein glmU;Includes:
    5::59      8e-05  33%  457 aa  GLMU_CLOBK RecName: Full=Bifunctional protein glmU;Includes:
    5::59      8e-05  33%  457 aa  GLMU_CLOBH RecName: Full=Bifunctional protein glmU;Includes:
    5::59      8e-05  33%  457 aa  GLMU_CLOB1 RecName: Full=Bifunctional protein glmU;Includes:
    2::110     8e-05  30%  460 aa  GLMU_BIFAA RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACHK RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACCZ RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACCR RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACCQ RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACCN RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACC7 RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACC4 RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACC3 RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACC2 RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACC1 RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACC0 RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACAN RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACAH RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACAC RecName: Full=Bifunctional protein glmU;Includes:
    6::60      8e-05  36%  459 aa  GLMU_BACAA RecName: Full=Bifunctional protein glmU;Includes:
    3::116     8e-05  25%  454 aa  GLMU_ACIBS RecName: Full=Bifunctional protein glmU;Includes:
    6::64      8e-05  34%  297 aa  GALF_SHIFL RecName: Full=UTP--glucose-1-phosphate
    6::64      8e-05  34%  297 aa  GALF_ECOLI RecName: Full=UTP--glucose-1-phosphate
    6::64      8e-05  34%  297 aa  GALF_ECO57 RecName: Full=UTP--glucose-1-phosphate
    5::169     8e-05  30%  452 aa  EI2BG_RAT RecName: Full=Translation initiation factor eIF-2B
    5::159     8e-05  33%  452 aa  EI2BG_MACFA RecName: Full=Translation initiation factor eIF-2B
    8::105     1e-04  32%  458 aa  GLMU_THIDA RecName: Full=Bifunctional protein glmU;Includes:
    4::99      1e-04  28%  450 aa  GLMU_THELT RecName: Full=Bifunctional protein glmU;Includes:
    7::107     1e-04  28%  456 aa  GLMU_RHISN RecName: Full=Bifunctional protein glmU;Includes:
    4::200     1e-04  23%  452 aa  GLMU_PSEHT RecName: Full=Bifunctional protein glmU;Includes:
    3::87      1e-04  30%  449 aa  GLMU_PROM2 RecName: Full=Bifunctional protein glmU;Includes:
    5::63      1e-04  34%  466 aa  GLMU_MYXXD RecName: Full=Bifunctional protein glmU;Includes:
    5::60      1e-04  38%  458 aa  GLMU_HELMI RecName: Full=Bifunctional protein glmU;Includes:
   11::114     1e-04  36%  462 aa  GLMU_CAUCR RecName: Full=Bifunctional protein glmU;Includes:
   11::114     1e-04  36%  462 aa  GLMU_CAUCN RecName: Full=Bifunctional protein glmU;Includes:
    2::99      1e-04  26%  458 aa  GLMU_BDEBA RecName: Full=Bifunctional protein glmU;Includes:
    7::108     1e-04  30%  474 aa  GLMU_ACIAC RecName: Full=Bifunctional protein glmU;Includes:
   10::134     1e-04  30%  301 aa  EXON_RHIME RecName: Full=UTP--glucose-1-phosphate
  166::248     1e-04  35%  540 aa  ACEA_PENMA RecName: Full=Isocitrate lyase;         Short=ICL;      
  160::255     1e-04  35%  548 aa  ACEA_NEUCR RecName: Full=Isocitrate lyase;         Short=ICL;      
    9::118     1e-04  32%  456 aa  GLMU_NEIMF RecName: Full=Bifunctional protein glmU;Includes:
    9::118     1e-04  31%  456 aa  GLMU_NEIM0 RecName: Full=Bifunctional protein glmU;Includes:
    6::103     1e-04  32%  457 aa  GLMU_LISMO RecName: Full=Bifunctional protein glmU;Includes:
    7::127     1e-04  29%  476 aa  GLMU_DIAST RecName: Full=Bifunctional protein glmU;Includes:
    6::118     1e-04  31%  454 aa  GLMU_BACSK RecName: Full=Bifunctional protein glmU;Includes:
   21::79      1e-04  36%  424 aa  GLGC_METCA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    5::110     1e-04  33%  452 aa  EI2BG_BOVIN RecName: Full=Translation initiation factor eIF-2B
  173::255     1e-04  35%  546 aa  ACEA_GIBZE RecName: Full=Isocitrate lyase;         Short=ICL;      
  164::246     1e-04  35%  538 aa  ACEA_ASPFU RecName: Full=Isocitrate lyase;         Short=ICL;      
   15::109     2e-04  29%  371 aa  GMPPB_DROPS RecName: Full=Mannose-1-phosphate guanyltransferase
    4::146     2e-04  29%  464 aa  GLMU_RHOFD RecName: Full=Bifunctional protein glmU;Includes:
    6::200     2e-04  27%  452 aa  GLMU_PSEU5 RecName: Full=Bifunctional protein glmU;Includes:
    3::116     2e-04  25%  449 aa  GLMU_PROMP RecName: Full=Bifunctional protein glmU;Includes:
    7::106     2e-04  27%  457 aa  GLMU_PROMH RecName: Full=Bifunctional protein glmU;Includes:
    6::79      2e-04  32%  457 aa  GLMU_LISW6 RecName: Full=Bifunctional protein glmU;Includes:
    6::65      2e-04  31%  409 aa  GLGC_MYXXD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   12::58      2e-04  47%  230 aa  ISPD_NOCFA RecName: Full=2-C-methyl-D-erythritol 4-phosphate
   13::65      2e-04  36%  288 aa  GTAB_STAES RecName: Full=UTP--glucose-1-phosphate
   13::65      2e-04  36%  288 aa  GTAB_STAEQ RecName: Full=UTP--glucose-1-phosphate
    7::108     2e-04  32%  460 aa  GLMU_NITMU RecName: Full=Bifunctional protein glmU;Includes:
    9::105     2e-04  31%  456 aa  GLMU_NEIMB RecName: Full=Bifunctional protein glmU;Includes:
    5::102     2e-04  35%  458 aa  GLMU_LACLS RecName: Full=Bifunctional protein glmU;Includes:
    5::102     2e-04  35%  458 aa  GLMU_LACLM RecName: Full=Bifunctional protein glmU;Includes:
    5::102     2e-04  34%  458 aa  GLMU_LACLA RecName: Full=Bifunctional protein glmU;Includes:
    5::59      2e-04  31%  457 aa  GLMU_CLOBJ RecName: Full=Bifunctional protein glmU;Includes:
    8::69      2e-04  35%  454 aa  GLMU_BRUSU RecName: Full=Bifunctional protein glmU;Includes:
    8::69      2e-04  35%  454 aa  GLMU_BRUSI RecName: Full=Bifunctional protein glmU;Includes:
    8::69      2e-04  35%  454 aa  GLMU_BRUME RecName: Full=Bifunctional protein glmU;Includes:
    8::69      2e-04  35%  454 aa  GLMU_BRUMB RecName: Full=Bifunctional protein glmU;Includes:
    8::69      2e-04  35%  454 aa  GLMU_BRUC2 RecName: Full=Bifunctional protein glmU;Includes:
    8::69      2e-04  35%  454 aa  GLMU_BRUAB RecName: Full=Bifunctional protein glmU;Includes:
    8::69      2e-04  35%  454 aa  GLMU_BRUA2 RecName: Full=Bifunctional protein glmU;Includes:
    8::69      2e-04  35%  454 aa  GLMU_BRUA1 RecName: Full=Bifunctional protein glmU;Includes:
    7::108     2e-04  33%  453 aa  GLMU_AGRRK RecName: Full=Bifunctional protein glmU;Includes:
    6::116     2e-04  27%  455 aa  GLMU_ACIF5 RecName: Full=Bifunctional protein glmU;Includes:
    6::116     2e-04  27%  455 aa  GLMU_ACIF2 RecName: Full=Bifunctional protein glmU;Includes:
  173::255     2e-04  35%  547 aa  ACEA_MAGGR RecName: Full=Isocitrate lyase;         Short=ICL;      
    7::65      3e-04  34%  304 aa  HASC_STRPY RecName: Full=UTP--glucose-1-phosphate
    7::65      3e-04  32%  299 aa  HASC2_STRP8 RecName: Full=UTP--glucose-1-phosphate
    7::65      3e-04  34%  304 aa  HASC2_STRP6 RecName: Full=UTP--glucose-1-phosphate
    7::65      3e-04  32%  299 aa  HASC2_STRP3 RecName: Full=UTP--glucose-1-phosphate
    7::65      3e-04  32%  299 aa  HASC2_STRP1 RecName: Full=UTP--glucose-1-phosphate
    7::65      3e-04  34%  304 aa  HASC1_STRP8 RecName: Full=UTP--glucose-1-phosphate
    7::65      3e-04  32%  299 aa  HASC1_STRP6 RecName: Full=UTP--glucose-1-phosphate
    7::65      3e-04  34%  304 aa  HASC1_STRP3 RecName: Full=UTP--glucose-1-phosphate
    7::65      3e-04  34%  304 aa  HASC1_STRP1 RecName: Full=UTP--glucose-1-phosphate
   13::65      3e-04  36%  288 aa  GTAB_STAAW RecName: Full=UTP--glucose-1-phosphate
   13::65      3e-04  36%  288 aa  GTAB_STAAS RecName: Full=UTP--glucose-1-phosphate
   13::65      3e-04  36%  288 aa  GTAB_STAAN RecName: Full=UTP--glucose-1-phosphate
   13::65      3e-04  36%  288 aa  GTAB_STAAM RecName: Full=UTP--glucose-1-phosphate
   13::65      3e-04  36%  288 aa  GTAB_STAAC RecName: Full=UTP--glucose-1-phosphate
   13::65      3e-04  36%  288 aa  GTAB_STAAB RecName: Full=UTP--glucose-1-phosphate
   13::65      3e-04  36%  288 aa  GTAB_STAA8 RecName: Full=UTP--glucose-1-phosphate
   13::65      3e-04  36%  288 aa  GTAB_STAA3 RecName: Full=UTP--glucose-1-phosphate
    4::58      3e-04  40%  430 aa  GLMU_SULNB RecName: Full=Bifunctional protein glmU;Includes:
    6::102     3e-04  34%  455 aa  GLMU_PSEFS RecName: Full=Bifunctional protein glmU;Includes:
    6::60      3e-04  35%  457 aa  GLMU_LISIN RecName: Full=Bifunctional protein glmU;Includes:
    6::62      3e-04  37%  461 aa  GLMU_LEGPL RecName: Full=Bifunctional protein glmU;Includes:
    6::62      3e-04  37%  461 aa  GLMU_LEGPC RecName: Full=Bifunctional protein glmU;Includes:
    6::62      3e-04  37%  461 aa  GLMU_LEGPA RecName: Full=Bifunctional protein glmU;Includes:
    1::110     3e-04  30%  461 aa  GLMU_HYPNA RecName: Full=Bifunctional protein glmU;Includes:
    6::60      3e-04  35%  459 aa  GLMU_BACWK RecName: Full=Bifunctional protein glmU;Includes:
    7::107     3e-04  38%  452 aa  GLMU_AGRVS RecName: Full=Bifunctional protein glmU;Includes:
   19::134     3e-04  26%  423 aa  GLGC_NITOC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   25::83      3e-04  36%  433 aa  GLGC_NITEU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    6::64      3e-04  34%  404 aa  GLGC2_VIBPA RecName: Full=Glucose-1-phosphate adenylyltransferase
    9::56      3e-04  40%  279 aa  GALU_PSEAE RecName: Full=UTP--glucose-1-phosphate
    7::65      3e-04  34%  306 aa  CAP3C_STRPN RecName: Full=UTP--glucose-1-phosphate
  164::246     3e-04  34%  537 aa  ACEA_LEPMC RecName: Full=Isocitrate lyase;         Short=ICL;      
    4::52      4e-04  37%  246 aa  SPSI_BACSU RecName: Full=Spore coat polysaccharide biosynthesis
   13::65      4e-04  34%  288 aa  GTAB_STAAR RecName: Full=UTP--glucose-1-phosphate
    3::121     4e-04  26%  360 aa  GMPPB_HUMAN RecName: Full=Mannose-1-phosphate guanyltransferase
    3::97      4e-04  28%  359 aa  GMPPB_DICDI RecName: Full=Mannose-1-phosphate guanyltransferase
    6::60      4e-04  35%  458 aa  GLMU_ENTFA RecName: Full=Bifunctional protein glmU;Includes:
    6::106     4e-04  28%  448 aa  GLMU_BARHE RecName: Full=Bifunctional protein glmU;Includes:
    4::102     4e-04  26%  452 aa  GLMU_ALTMD RecName: Full=Bifunctional protein glmU;Includes:
   10::69      4e-04  37%  470 aa  GLGC_ARTAT RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  161::196     4e-04  44%  540 aa  ACEA_YARLI RecName: Full=Isocitrate lyase;         Short=ICL;      
  171::253     4e-04  31%  550 aa  ACEA_PICPA RecName: Full=Isocitrate lyase;         Short=ICL;      
  168::203     4e-04  42%  550 aa  ACEA_DEBHA RecName: Full=Isocitrate lyase;         Short=ICL;      
  149::196     4e-04  42%  537 aa  ACEA_COPCI RecName: Full=Isocitrate lyase;         Short=ICL;      
  149::196     4e-04  42%  538 aa  ACEA_COPC7 RecName: Full=Isocitrate lyase;         Short=ICL;      
    6::94      5e-04  27%  195 aa  MOBA_YERPP RecName: Full=Probable molybdopterin-guanine
    6::94      5e-04  27%  195 aa  MOBA_YERPN RecName: Full=Probable molybdopterin-guanine
    6::94      5e-04  27%  195 aa  MOBA_YERPG RecName: Full=Probable molybdopterin-guanine
    6::94      5e-04  27%  195 aa  MOBA_YERPE RecName: Full=Probable molybdopterin-guanine
    6::94      5e-04  27%  195 aa  MOBA_YERPB RecName: Full=Probable molybdopterin-guanine
    6::94      5e-04  27%  195 aa  MOBA_YERPA RecName: Full=Probable molybdopterin-guanine
    4::65      5e-04  34%  226 aa  ISPD_SYNSC RecName: Full=2-C-methyl-D-erythritol 4-phosphate
    3::121     5e-04  26%  360 aa  GMPPB_MOUSE RecName: Full=Mannose-1-phosphate guanyltransferase
   13::131     5e-04  27%  369 aa  GMPPB_DROME RecName: Full=Mannose-1-phosphate guanyltransferase
    5::102     5e-04  31%  459 aa  GLMU_STRGC RecName: Full=Bifunctional protein glmU;Includes:
    7::106     5e-04  25%  455 aa  GLMU_SALAR RecName: Full=Bifunctional protein glmU;Includes:
    7::137     5e-04  30%  454 aa  GLMU_RHOS5 RecName: Full=Bifunctional protein glmU;Includes:
    7::55      5e-04  35%  456 aa  GLMU_RHIME RecName: Full=Bifunctional protein glmU;Includes:
    6::102     5e-04  33%  455 aa  GLMU_PSEPF RecName: Full=Bifunctional protein glmU;Includes:
    5::118     5e-04  30%  460 aa  GLMU_PELPD RecName: Full=Bifunctional protein glmU;Includes:
    9::108     5e-04  38%  452 aa  GLMU_NITHX RecName: Full=Bifunctional protein glmU;Includes:
    6::249     5e-04  28%  461 aa  GLMU_LACDB RecName: Full=Bifunctional protein glmU;Includes:
   13::107     5e-04  30%  451 aa  GLMU_GRABC RecName: Full=Bifunctional protein glmU;Includes:
    2::91      5e-04  32%  460 aa  GLMU_BIFLO RecName: Full=Bifunctional protein glmU;Includes:
    2::91      5e-04  32%  460 aa  GLMU_BIFLI RecName: Full=Bifunctional protein glmU;Includes:
    6::60      5e-04  33%   68 aa  GLMU_BACME RecName: Full=Bifunctional protein glmU;Includes:
    6::60      5e-04  35%  455 aa  GLMU_BACHD RecName: Full=Bifunctional protein glmU;Includes:
    3::54      5e-04  33%  454 aa  GLMU_ACIAD RecName: Full=Bifunctional protein glmU;Includes:
    1::71      5e-04  32%  412 aa  GLGC_GEOMG RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   38::163     5e-04  23%  717 aa  EI2BE_MOUSE RecName: Full=Translation initiation factor eIF-2B
  168::203     5e-04  42%  550 aa  ACEA_CANAL RecName: Full=Isocitrate lyase;         Short=ICL;      
   38::168     7e-04  30%  238 aa  SPLE_STAAU RecName: Full=Serine protease splE;       
    6::94      7e-04  27%  195 aa  MOBA_YERPY RecName: Full=Probable molybdopterin-guanine
    6::94      7e-04  27%  195 aa  MOBA_YERP3 RecName: Full=Probable molybdopterin-guanine
    4::48      7e-04  42%  225 aa  ISPD_PROMM RecName: Full=2-C-methyl-D-erythritol 4-phosphate
   11::143     7e-04  29%  461 aa  GLMU_WIGBR RecName: Full=Bifunctional protein glmU;Includes:
    3::118     7e-04  26%  454 aa  GLMU_SYNS3 RecName: Full=Bifunctional protein glmU;Includes:
    4::101     7e-04  28%  455 aa  GLMU_RALPJ RecName: Full=Bifunctional protein glmU;Includes:
    7::105     7e-04  29%  456 aa  GLMU_NEIGO RecName: Full=Bifunctional protein glmU;Includes:
    7::105     7e-04  29%  456 aa  GLMU_NEIG1 RecName: Full=Bifunctional protein glmU;Includes:
    5::105     7e-04  28%  460 aa  GLMU_METPP RecName: Full=Bifunctional protein glmU;Includes:
    7::106     7e-04  27%  456 aa  GLMU_CITK8 RecName: Full=Bifunctional protein glmU;Includes:
    7::110     7e-04  29%  461 aa  GLMU_BUCAP RecName: Full=Bifunctional protein glmU;Includes:
    2::91      7e-04  32%  460 aa  GLMU_BIFLD RecName: Full=Bifunctional protein glmU;Includes:
    6::60      7e-04  35%  456 aa  GLMU_BACLD RecName: Full=Bifunctional protein glmU;Includes:
   17::77      7e-04  37%  425 aa  GLGC_NITMU RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::68      7e-04  34%  414 aa  GLGC_LEIXX RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::65      7e-04  32%  413 aa  GLGC_DEIDV RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   42::167     7e-04  22%  721 aa  EI2BE_RABIT RecName: Full=Translation initiation factor eIF-2B
  168::203     7e-04  42%  550 aa  ACEA_PICJA RecName: Full=Isocitrate lyase;         Short=ICL;      
  168::203     7e-04  42%  550 aa  ACEA_CANTR RecName: Full=Isocitrate lyase;         Short=ICL;      
    3::97      0.001  26%  360 aa  GMPPB_XENTR RecName: Full=Mannose-1-phosphate guanyltransferase
    5::102     0.001  32%  460 aa  GLMU_STRPG RecName: Full=Bifunctional protein glmU;Includes:
    5::102     0.001  32%  460 aa  GLMU_STRPF RecName: Full=Bifunctional protein glmU;Includes:
    5::102     0.001  32%  460 aa  GLMU_STRPC RecName: Full=Bifunctional protein glmU;Includes:
    5::102     0.001  32%  416 aa  GLMU_STRPB RecName: Full=Bifunctional protein glmU;Includes:
    5::102     0.001  32%  460 aa  GLMU_STRP6 RecName: Full=Bifunctional protein glmU;Includes:
    5::102     0.001  32%  460 aa  GLMU_STRP3 RecName: Full=Bifunctional protein glmU;Includes:
    9::92      0.001  29%  457 aa  GLMU_LAWIP RecName: Full=Bifunctional protein glmU;Includes:
    9::118     0.001  27%  469 aa  GLMU_BAUCH RecName: Full=Bifunctional protein glmU;Includes:
    6::58      0.001  34%  451 aa  GLMU_ANAVT RecName: Full=Bifunctional protein glmU;Includes:
   10::68      0.001  36%  404 aa  GLGC_RHOE4 RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    3::82      0.001  33%  429 aa  GLGC_MAGSA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
   10::70      0.001  33%  418 aa  GLGC_JANSC RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    8::65      0.001  33%  413 aa  GLGC_DEIGD RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::68      0.001  34%  405 aa  GLGC_CORJK RecName: Full=Glucose-1-phosphate adenylyltransferase;  
    9::68      0.001  36%  470 aa  GLGC_ARTCA RecName: Full=Glucose-1-phosphate adenylyltransferase;  
  170::204     0.001  43%  606 aa  ACEA_MYCLE RecName: Full=Isocitrate lyase;         Short=ICL;      
    1::564

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNAHDPNLLATSRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASW
PEPM_MYTED      ------------KTTQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASW
PEPM_TETPY      ---------STRKTTQLKNMIQSKDLSFIMEAHNGLSAAIVEETGFKGIWGSGLSISAAMGVRDSNEASY
PEPM_STRVR      -----------SVGSRLKNLLHGPGTCQLMGVHDGLSARIAVAEGFEALWASGLCMSTARGVRDSDEASW
PEPM_STRHY      ----------TTRSARLRYLLHAPGACQLMGVHDGLSARIAVAEGFEALWASGLCMSTARGVRDSDEASW
CPPM_STRHY      --------MAVTKARTFRELMNAPEILVVPSAYDALSAKVIQQAGFPAVHMTGSGTSASMGLPDLGFTSV
PRPB_BACHD      ---------------RFRQLMKEEAILQIPGAHDAMAALVAKKAGFSALYLSGDAYTASRGLPDLGIVTS
PRPB2_CORGL     -------------------------------AFSPLAARAIQEAGFEGVYVSGAVVAADLALPDIGLTTL
PRPB_AERPE      ----------------LRELIEKRDIVVAPGVYNPAVALLAERMGFEALYLSGAAITGSLAMPDLGLITL
PRPB_BACSU      -------------AGRFRKLMSAPDILQIPGAHDGMAALLAKEAGFSAIYLSGAAYTASRGLPDLGIITS
PRPB1_CORGL     MNLFSNGVDVGRRRQAFKAALAAPHIARLPGAFSPLIARSIEEAGFEGVYVSGAVIAADLALPDIGLTTL
OADC_RHOPB      -----------SRREALRAILSGSRCARPASVFDPISMRIAEDLGFEGMFGGSVASLAILGDPDIALITL
CPPM_ARATH      ---------------RFHRLIEEQGIVLMPGCYDALSAAIVQQTGFSAGFISGYALSASFGLLTPPEMAA
OADC_RHOP5      -----------NRRGALRAILSGSHCTRPASVYDPISMRIADDLGFEGMFGGSVASLAILGDPDIALITL
OADC_BRAJA      -----------SRREKLRSILSGPGCIHPGSVYDAISIRIAEDLGFPGMFGGSVASLAVLGDPDITLITL
OADC_PSEU5      -----PRLSHHDLRRNFRELLNADRCFHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFNLITL
OADC_BRASO      ------------RREALRTILTSDRCVNPGSVYDAISIRIAEDLGFPGMFGGSAASLAILGDPDIALITL
OADC_BRASB      -----------ARREVLRTILTGERCIHPGSVYDAISIRIAEDLGFEGMFGGSAASLAVLGDPDIALITL
PRPB_VIBCH      ------NPMSLSPGAKFRLAVKTHHPLQIVGTINPYCAMMAKSIGHQAIYLSGGGIAASYGLPDLGITTL
PDP_DIACA       --------VSTGRKTTMHRLIEEHGSVLMPGVQDALSAAVVEKTGFHAAFVSGYSVSAMLGLPDFGLLTT
OADC1_PSEPW     -----------------RELLASGSCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_RHOPS      -----------NRRGALRAILSGSACVRPASVYDAISIRIADDLGFPGMFGGSVASLAILGDPDIALITL
OADC_PSEPG      -----------------RELLASGSCFHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_PSEE4      -----------------RELLASGSCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_PSEPK      -----------------RELLASGSCFHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_PSEP1      -----------------RELLASGSCFHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_RHOP2      ------------RRGALRAILEGSACVRPASVYDAISIRIADDLRFPGMFGGSVASLAILGDPDSALITL
OADC_PSEMY      ------------RSA-FRALLASERCYHTASVFDPMSARIAADLDFEGILGGSVASLQVLGAPDFALITL
OADC_BURXL      LNEHGRRLLLTTQRRRLRQILDREDCVTMATIFDPVSARLAEQLGYEGLMGGSLASYAVLGAPDLIVLTL
OADC_PSEF5      -----------------RELIASNSCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
PRPB_SALTY      -------------------LAKENPLQ-IVGAINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
OADC2_PSEPW     -------------------LLQGHVCKFAASVFDPISVRMASDLGFEGIQGGSVASLQVLGAPDIALLTL
OADC_AZOVD      ---------------QFRALLESNTCYDAASVFDPMSARIAGDLKFEGILGGSVAALQVLAAPDYALITL
PRPB_ECOLI      -------------------LTKENPLQ-IVGTINANHALLAQRAGYQAIYXXXXXXXXXXXXXDLGISTL
OADC_CHRSD      -----------------RALLASSECYFTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_PSE14      -----------------RALTSSNSCFHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_PSEU2      -----------------RALTSSNACFHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_PSEFS      -----PKISHSALRRTFRELLATPTCVETASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC1_PSEPF     -----------------RQLLASDTCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLGAPDFALITL
OADC_PSESM      -----------------RALTSSNSCFHTASVFDPMSAQIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_PSEAE      --------------AMFRALLDSSRCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_PSEAB      --------------AMFRALLDSSRCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_PSEA8      --------------AMFRALLDSSRCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_PSEA7      --------------AMFRALLDSSRCYHTASVFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_MARMS      -----------------RALLASGKCYYTASTFDPMSARIAADLGFEGILGGSVASLQVLAAPDFALITL
OADC_RHOPA      ------------RRGALRAILTGSACVRPASVYDAISIRIADDLGFPGMFGGSVASLAILGDPDIALITL
OADC_RHOPT      ------------RRGALRAILTGSACVRPASVYDAISIRIADDLGFPGMFGGSVASLAILGDPDIALITL
OADC2_PSEPF     ------------------ELLQGDTCKFAASVFDPISVRMAYDLGFDVAIQGGSVASLQLGAPDIALLTL
GLMU_DEIRA      ----------------------------------------------------------------------
GLMU_METVS      ----------------------------------------------------------------------
GLMU_METM5      ----------------------------------------------------------------------
GLMU_KOSOT      ----------------------------------------------------------------------
GLMU_DECAR      ----------------------------------------------------------------------
GLMU_METJA      ----------------------------------------------------------------------
GLMU_DEIGD      ----------------------------------------------------------------------
GLMU_BURPS      ----------------------------------------------------------------------
GLMU_BURP6      ----------------------------------------------------------------------
GLMU_BURP1      ----------------------------------------------------------------------
GLMU_BURP0      ----------------------------------------------------------------------
GLMU_BURMS      ----------------------------------------------------------------------
GLMU_BURMA      ----------------------------------------------------------------------
GLMU_BURM7      ----------------------------------------------------------------------
GLMU_STRMK      ----------------------------------------------------------------------
GLMU_SYMTH      ----------------------------------------------------------------------
GLMU_BLOPB      ----------------------------------------------------------------------
GLMU_CELJU      ----------------------------------------------------------------------
GLMU_XANCB      ----------------------------------------------------------------------
GLMU_ACHLI      ----------------------------------------------------------------------
GLMU_RHIE6      ----------------------------------------------------------------------
GLMU_METM7      ----------------------------------------------------------------------
GLMU_STRM5      ----------------------------------------------------------------------
GLMU_BURPP      ----------------------------------------------------------------------
GLMU_XYLFM      ----------------------------------------------------------------------
GLMU_XYLFA      ----------------------------------------------------------------------
GLMU_XYLFT      ----------------------------------------------------------------------
GLMU_XYLF2      ----------------------------------------------------------------------
GLMU_VIBCM      ----------------------------------------------------------------------
GLMU_VIBCH      ----------------------------------------------------------------------
GLMU_VIBC3      ----------------------------------------------------------------------
GLMU_TOLAT      ----------------------------------------------------------------------
GLMU_HALHL      ----------------------------------------------------------------------
GLMU_XANOR      ----------------------------------------------------------------------
GLMU_METMP      ----------------------------------------------------------------------
GLMU_CLOTH      ----------------------------------------------------------------------
GLMU_VIBFM      ----------------------------------------------------------------------
GLMU_VIBF1      ----------------------------------------------------------------------
GLMU_RHIEC      ----------------------------------------------------------------------
GLMU_RALEJ      ----------------------------------------------------------------------
GLMU_AZOSB      ----------------------------------------------------------------------
GLMU_ALISL      ----------------------------------------------------------------------
GLMU_XANOM      ----------------------------------------------------------------------
GLMU_RHILW      ----------------------------------------------------------------------
GLMU_MARAV      ----------------------------------------------------------------------
GLMU_GEOLS      ----------------------------------------------------------------------
GLMU_VIBVY      ----------------------------------------------------------------------
GLMU_VIBVU      ----------------------------------------------------------------------
GLMU_GLUDA      ----------------------------------------------------------------------
GLMU_BURP8      ----------------------------------------------------------------------
GLMU_AERHH      ----------------------------------------------------------------------
GLMU_JANMA      ----------------------------------------------------------------------
GLMU_EDWI9      ----------------------------------------------------------------------
GLMU_BURXL      ----------------------------------------------------------------------
GLMU_BURCH      ----------------------------------------------------------------------
GLMU_BURCA      ----------------------------------------------------------------------
GLMU_SHEAM      ----------------------------------------------------------------------
GLMU_ENTS8      ----------------------------------------------------------------------
GLMU_THISH      ----------------------------------------------------------------------
GLMU_SACD2      ----------------------------------------------------------------------
GLMU_HERAR      ----------------------------------------------------------------------
GLMU_THETN      ----------------------------------------------------------------------
GLMU_SPHWW      ----------------------------------------------------------------------
GLMU_SODGM      ----------------------------------------------------------------------
GLMU_SHEHH      ----------------------------------------------------------------------
GLMU_RHIL3      ----------------------------------------------------------------------
GLMU_PELCD      ----------------------------------------------------------------------
GLMU_BURTA      ----------------------------------------------------------------------
GLMU_ZYMMO      ----------------------------------------------------------------------
GLMU_SPHAL      ----------------------------------------------------------------------
GLMU_PHOPR      ----------------------------------------------------------------------
GLMU_HAHCH      ----------------------------------------------------------------------
GLMU_FERNB      ----------------------------------------------------------------------
GLMU_THEAB      ----------------------------------------------------------------------
GLMU_SERP5      ----------------------------------------------------------------------
GLMU_NITEU      ----------------------------------------------------------------------
GLMU_GEOSF      ----------------------------------------------------------------------
GLMU_ERWT9      ----------------------------------------------------------------------
GLMU_CLOTE      ----------------------------------------------------------------------
GLMU_BURA4      ----------------------------------------------------------------------
GLMU_BORA1      ----------------------------------------------------------------------
GLMU_AQUAE      ----------------------------------------------------------------------
GLMU_YERE8      ----------------------------------------------------------------------
GLMU_XANAC      ----------------------------------------------------------------------
GLMU_SYNWW      ----------------------------------------------------------------------
GLMU_DESAP      ----------------------------------------------------------------------
GLMU_BREBN      ----------------------------------------------------------------------
GMPPB_CAEEL     ----------------------------------------------------------------------
GLMU_XANC5      ----------------------------------------------------------------------
GLMU_STAES      ----------------------------------------------------------------------
GLMU_STAEQ      ----------------------------------------------------------------------
GLMU_STAEP      ----------------------------------------------------------------------
GLMU_SHESA      ----------------------------------------------------------------------
GLMU_RALME      ----------------------------------------------------------------------
GLMU_MANSM      ----------------------------------------------------------------------
GLMU_BURM1      ----------------------------------------------------------------------
Y1334_METJA     ----------------------------------------------------------------------
GLMU_SHEWM      ----------------------------------------------------------------------
GLMU_SHEPA      ----------------------------------------------------------------------
GLMU_SHEDO      ----------------------------------------------------------------------
GLMU_PROAC      ----------------------------------------------------------------------
GLMU_HAES1      ----------------------------------------------------------------------
STRD_STRGR      ----------------------------------------------------------------------
GLMU_YERPY      ----------------------------------------------------------------------
GLMU_YERPS      ----------------------------------------------------------------------
GLMU_YERPP      ----------------------------------------------------------------------
GLMU_YERPN      ----------------------------------------------------------------------
GLMU_YERPE      ----------------------------------------------------------------------
GLMU_YERPB      ----------------------------------------------------------------------
GLMU_YERPA      ----------------------------------------------------------------------
GLMU_YERP3      ----------------------------------------------------------------------
GLMU_SHEPW      ----------------------------------------------------------------------
GLMU_META3      ----------------------------------------------------------------------
GLMU_HAES2      ----------------------------------------------------------------------
GLMU_CHRVO      ----------------------------------------------------------------------
GLMU_BORPD      ----------------------------------------------------------------------
GLMU_STAHJ      ----------------------------------------------------------------------
GLMU_SHESH      ----------------------------------------------------------------------
GLMU_ROSDO      ----------------------------------------------------------------------
GLMU_PSYA2      ----------------------------------------------------------------------
GLMU_PSEA6      ----------------------------------------------------------------------
GLMU_GEOSL      ----------------------------------------------------------------------
GMPPB_CAEBR     ----------------------------------------------------------------------
GLMU_SHEFN      ----------------------------------------------------------------------
GLMU_PSYIN      ----------------------------------------------------------------------
GLMU_PECCP      ----------------------------------------------------------------------
GLMU_HAEPS      ----------------------------------------------------------------------
GLMU_THESQ      ----------------------------------------------------------------------
GLMU_THEP1      ----------------------------------------------------------------------
GLMU_PSE14      ----------------------------------------------------------------------
GLMU_ERWCT      ----------------------------------------------------------------------
GLMU_BORPE      ----------------------------------------------------------------------
GLMU_BORPA      ----------------------------------------------------------------------
GLMU_BORBR      ----------------------------------------------------------------------
GLMU_OCEIH      ----------------------------------------------------------------------
GLMU_GEOUR      ----------------------------------------------------------------------
GLMU_FRAP2      ----------------------------------------------------------------------
GLMU_CLOK5      ----------------------------------------------------------------------
GLMU_CLOK1      ----------------------------------------------------------------------
GLMU_CLOD6      ----------------------------------------------------------------------
GTAB_STAHJ      ----------------------------------------------------------------------
GLMU_THEMA      ----------------------------------------------------------------------
GLMU_STAAW      ----------------------------------------------------------------------
GLMU_STAAS      ----------------------------------------------------------------------
GLMU_STAAR      ----------------------------------------------------------------------
GLMU_STAAN      ----------------------------------------------------------------------
GLMU_STAAM      ----------------------------------------------------------------------
GLMU_STAAC      ----------------------------------------------------------------------
GLMU_STAAB      ----------------------------------------------------------------------
GLMU_STAA3      ----------------------------------------------------------------------
GLMU_SHESW      ----------------------------------------------------------------------
GLMU_SHEPC      ----------------------------------------------------------------------
GLMU_SHELP      ----------------------------------------------------------------------
GLMU_PASMU      ----------------------------------------------------------------------
GLMU_NOVAD      ----------------------------------------------------------------------
GLMU_HAEIN      ----------------------------------------------------------------------
GLMU_GEOMG      ----------------------------------------------------------------------
GLMU_DESVV      ----------------------------------------------------------------------
GLMU_DESVH      ----------------------------------------------------------------------
GLMU_COXBN      ----------------------------------------------------------------------
GALU_MYCPN      ----------------------------------------------------------------------
GTAB_BACSU      ----------------------------------------------------------------------
GTAB2_STAS1     ----------------------------------------------------------------------
GLMU_PSEU2      ----------------------------------------------------------------------
GLMU_PSEMY      ----------------------------------------------------------------------
GLMU_PSEAE      ----------------------------------------------------------------------
GLMU_PSEAB      ----------------------------------------------------------------------
GLMU_PSEA8      ----------------------------------------------------------------------
GLMU_PSEA7      ----------------------------------------------------------------------
GLMU_NITEC      ----------------------------------------------------------------------
GLMU_COLP3      ----------------------------------------------------------------------
GLMU_ALCBS      ----------------------------------------------------------------------
GLMU_ACTSZ      ----------------------------------------------------------------------
RFBF_SALTY      ----------------------------------------------------------------------
GLMU_SHESM      ----------------------------------------------------------------------
GLMU_METFK      ----------------------------------------------------------------------
GLMU_HAEI8      ----------------------------------------------------------------------
GLMU_COXB1      ----------------------------------------------------------------------
GLMU_CLONN      ----------------------------------------------------------------------
GLMU_STAA8      ----------------------------------------------------------------------
GLMU_PSEF5      ----------------------------------------------------------------------
GLMU_HAEIG      ----------------------------------------------------------------------
GLMU_HAEIE      ----------------------------------------------------------------------
GLMU_HAEDU      ----------------------------------------------------------------------
GLMU_COXB2      ----------------------------------------------------------------------
GLMU_CLOBB      ----------------------------------------------------------------------
GLMU_CLOBA      ----------------------------------------------------------------------
GLMU_ACISJ      ----------------------------------------------------------------------
GTAB1_STAS1     ----------------------------------------------------------------------
GLMU_SHESR      ----------------------------------------------------------------------
GLMU_SHEB5      ----------------------------------------------------------------------
GLMU_SALTY      ----------------------------------------------------------------------
GLMU_SALTI      ----------------------------------------------------------------------
GLMU_SALSV      ----------------------------------------------------------------------
GLMU_SALPK      ----------------------------------------------------------------------
GLMU_SALPB      ----------------------------------------------------------------------
GLMU_SALPA      ----------------------------------------------------------------------
GLMU_SALNS      ----------------------------------------------------------------------
GLMU_SALHS      ----------------------------------------------------------------------
GLMU_SALG2      ----------------------------------------------------------------------
GLMU_SALEP      ----------------------------------------------------------------------
GLMU_SALDC      ----------------------------------------------------------------------
GLMU_SALCH      ----------------------------------------------------------------------
GLMU_SALA4      ----------------------------------------------------------------------
GLMU_DESVM      ----------------------------------------------------------------------
GLMU_DESDG      ----------------------------------------------------------------------
GLMU_CHRSD      ----------------------------------------------------------------------
ISPD_BIFLD      ----------------------------------------------------------------------
GLMU_THEM4      ----------------------------------------------------------------------
GLMU_SHEB8      ----------------------------------------------------------------------
GLMU_SHEB2      ----------------------------------------------------------------------
GLMU_PHOLL      ----------------------------------------------------------------------
GLMU_MAGSA      ----------------------------------------------------------------------
GLMU_EXISA      ----------------------------------------------------------------------
GLMU_COXBU      ----------------------------------------------------------------------
GLMU_COXBR      ----------------------------------------------------------------------
GLMU_CLOPS      ----------------------------------------------------------------------
GLMU_AZOVD      ----------------------------------------------------------------------
GLGC_KOCRD      ----------------------------------------------------------------------
MPG1_SULAC      ----------------------------------------------------------------------
LICC_HAEIN      ----------------------------------------------------------------------
ISPD_BIFLO      ----------------------------------------------------------------------
ISPD_BIFLI      ----------------------------------------------------------------------
GLMU_VIBPA      ----------------------------------------------------------------------
GLMU_THEP3      ----------------------------------------------------------------------
GLMU_STAS1      ----------------------------------------------------------------------
GLMU_SHEB9      ----------------------------------------------------------------------
GLMU_EXIS2      ----------------------------------------------------------------------
GLMU_CLOP1      ----------------------------------------------------------------------
GLMU_AZOSE      ----------------------------------------------------------------------
GLMU_PSESM      ----------------------------------------------------------------------
GLMU_PSEPK      ----------------------------------------------------------------------
GLMU_PSEPG      ----------------------------------------------------------------------
GLMU_GEOSW      ----------------------------------------------------------------------
GLMU_CYAP7      ----------------------------------------------------------------------
GLMU_CLOPE      ----------------------------------------------------------------------
GLGC_CORGL      ----------------------------------------------------------------------
GLGC_CORGB      ----------------------------------------------------------------------
GLGC_CORA7      ----------------------------------------------------------------------
GALU2_PSEAE     ----------------------------------------------------------------------
EI2BG_HUMAN     ----------------------------------------------------------------------
GLMU_SHEON      ----------------------------------------------------------------------
GLMU_PSEE4      ----------------------------------------------------------------------
GLMU_PROM0      ----------------------------------------------------------------------
GLMU_PARL1      ----------------------------------------------------------------------
GLMU_MARMM      ----------------------------------------------------------------------
GLMU_GEOTN      ----------------------------------------------------------------------
GLMU_CALS8      ----------------------------------------------------------------------
GLMU_ACTPJ      ----------------------------------------------------------------------
GLMU_ACTP7      ----------------------------------------------------------------------
GLMU_ACTP2      ----------------------------------------------------------------------
GLGC_RHOBA      ----------------------------------------------------------------------
GLGC_ANADF      ----------------------------------------------------------------------
ACEA_KLULA      ----------------------------------------------------------------HDRKQW
GLMU_VIBHB      ----------------------------------------------------------------------
GLMU_PSEP1      ----------------------------------------------------------------------
GLMU_PROM9      ----------------------------------------------------------------------
GLMU_KLEP7      ----------------------------------------------------------------------
GLMU_KLEP3      ----------------------------------------------------------------------
GLMU_DESHY      ----------------------------------------------------------------------
GLGC_PROAC      ----------------------------------------------------------------------
GLGC_COREF      ----------------------------------------------------------------------
GALU_MYCGE      ----------------------------------------------------------------------
ACEA_EMENI      -----------------------------------------------------------FHDRKQREERM
YTDA_BACSU      ----------------------------------------------------------------------
MPG1_PICAN      ----------------------------------------------------------------------
GLMU_PSYCK      ----------------------------------------------------------------------
GLMU_PROMS      ----------------------------------------------------------------------
GLMU_NITOC      ----------------------------------------------------------------------
GLMU_LISMH      ----------------------------------------------------------------------
GLMU_LISMF      ----------------------------------------------------------------------
GLMU_LISMC      ----------------------------------------------------------------------
GLMU_DESHD      ----------------------------------------------------------------------
GLMU_CLOBM      ----------------------------------------------------------------------
GLMU_CLOB6      ----------------------------------------------------------------------
GLMU_CLOAB      ----------------------------------------------------------------------
GLMU_ACIBY      ----------------------------------------------------------------------
GLMU_ACIBC      ----------------------------------------------------------------------
GLGC_DECAR      ----------------------------------------------------------------------
GLGC_CORDI      ----------------------------------------------------------------------
GLGC_ANASK      ----------------------------------------------------------------------
GLGC_ANADE      ----------------------------------------------------------------------
GLGC_ANAD2      ----------------------------------------------------------------------
GALF_SALTY      ----------------------------------------------------------------------
GALF_SALTI      ----------------------------------------------------------------------
GALF_KLEPN      ----------------------------------------------------------------------
CAP4C_STRPN     ----------------------------------------------------------------------
ACEA_COCIM      ----------------------------------------------------------------------
GLMU_STRMU      ----------------------------------------------------------------------
GLMU_SHISS      ----------------------------------------------------------------------
GLMU_SHIFL      ----------------------------------------------------------------------
GLMU_SHIF8      ----------------------------------------------------------------------
GLMU_SHIDS      ----------------------------------------------------------------------
GLMU_SHIBS      ----------------------------------------------------------------------
GLMU_SHIB3      ----------------------------------------------------------------------
GLMU_PSYWF      ----------------------------------------------------------------------
GLMU_OCHA4      ----------------------------------------------------------------------
GLMU_LEGPH      ----------------------------------------------------------------------
GLMU_ESCF3      ----------------------------------------------------------------------
GLMU_ENT38      ----------------------------------------------------------------------
GLMU_ECOUT      ----------------------------------------------------------------------
GLMU_ECOSM      ----------------------------------------------------------------------
GLMU_ECOSE      ----------------------------------------------------------------------
GLMU_ECOLU      ----------------------------------------------------------------------
GLMU_ECOLI      ----------------------------------------------------------------------
GLMU_ECOLC      ----------------------------------------------------------------------
GLMU_ECOL6      ----------------------------------------------------------------------
GLMU_ECOL5      ----------------------------------------------------------------------
GLMU_ECOK1      ----------------------------------------------------------------------
GLMU_ECOHS      ----------------------------------------------------------------------
GLMU_ECODH      ----------------------------------------------------------------------
GLMU_ECOBW      ----------------------------------------------------------------------
GLMU_ECO8A      ----------------------------------------------------------------------
GLMU_ECO81      ----------------------------------------------------------------------
GLMU_ECO7I      ----------------------------------------------------------------------
GLMU_ECO5E      ----------------------------------------------------------------------
GLMU_ECO57      ----------------------------------------------------------------------
GLMU_ECO55      ----------------------------------------------------------------------
GLMU_ECO45      ----------------------------------------------------------------------
GLMU_ECO27      ----------------------------------------------------------------------
GLMU_ECO24      ----------------------------------------------------------------------
GLMU_CLOBL      ----------------------------------------------------------------------
GLMU_CLOBK      ----------------------------------------------------------------------
GLMU_CLOBH      ----------------------------------------------------------------------
GLMU_CLOB1      ----------------------------------------------------------------------
GLMU_BIFAA      ----------------------------------------------------------------------
GLMU_BACHK      ----------------------------------------------------------------------
GLMU_BACCZ      ----------------------------------------------------------------------
GLMU_BACCR      ----------------------------------------------------------------------
GLMU_BACCQ      ----------------------------------------------------------------------
GLMU_BACCN      ----------------------------------------------------------------------
GLMU_BACC7      ----------------------------------------------------------------------
GLMU_BACC4      ----------------------------------------------------------------------
GLMU_BACC3      ----------------------------------------------------------------------
GLMU_BACC2      ----------------------------------------------------------------------
GLMU_BACC1      ----------------------------------------------------------------------
GLMU_BACC0      ----------------------------------------------------------------------
GLMU_BACAN      ----------------------------------------------------------------------
GLMU_BACAH      ----------------------------------------------------------------------
GLMU_BACAC      ----------------------------------------------------------------------
GLMU_BACAA      ----------------------------------------------------------------------
GLMU_ACIBS      ----------------------------------------------------------------------
GALF_SHIFL      ----------------------------------------------------------------------
GALF_ECOLI      ----------------------------------------------------------------------
GALF_ECO57      ----------------------------------------------------------------------
EI2BG_RAT       ----------------------------------------------------------------------
EI2BG_MACFA     ----------------------------------------------------------------------
GLMU_THIDA      ----------------------------------------------------------------------
GLMU_THELT      ----------------------------------------------------------------------
GLMU_RHISN      ----------------------------------------------------------------------
GLMU_PSEHT      ----------------------------------------------------------------------
GLMU_PROM2      ----------------------------------------------------------------------
GLMU_MYXXD      ----------------------------------------------------------------------
GLMU_HELMI      ----------------------------------------------------------------------
GLMU_CAUCR      ----------------------------------------------------------------------
GLMU_CAUCN      ----------------------------------------------------------------------
GLMU_BDEBA      ----------------------------------------------------------------------
GLMU_ACIAC      ----------------------------------------------------------------------
EXON_RHIME      ----------------------------------------------------------------------
ACEA_PENMA      ----------------------------------------------------------------------
ACEA_NEUCR      ----------------------------------------------------------------------
GLMU_NEIMF      ----------------------------------------------------------------------
GLMU_NEIM0      ----------------------------------------------------------------------
GLMU_LISMO      ----------------------------------------------------------------------
GLMU_DIAST      ----------------------------------------------------------------------
GLMU_BACSK      ----------------------------------------------------------------------
GLGC_METCA      ----------------------------------------------------------------------
EI2BG_BOVIN     ----------------------------------------------------------------------
ACEA_GIBZE      ----------------------------------------------------------------------
ACEA_ASPFU      ----------------------------------------------------------------------
GMPPB_DROPS     ----------------------------------------------------------------------
GLMU_RHOFD      ----------------------------------------------------------------------
GLMU_PSEU5      ----------------------------------------------------------------------
GLMU_PROMP      ----------------------------------------------------------------------
GLMU_PROMH      ----------------------------------------------------------------------
GLMU_LISW6      ----------------------------------------------------------------------
GLGC_MYXXD      ----------------------------------------------------------------------
ISPD_NOCFA      ----------------------------------------------------------------------
GTAB_STAES      ----------------------------------------------------------------------
GTAB_STAEQ      ----------------------------------------------------------------------
GLMU_NITMU      ----------------------------------------------------------------------
GLMU_NEIMB      ----------------------------------------------------------------------
GLMU_LACLS      ----------------------------------------------------------------------
GLMU_LACLM      ----------------------------------------------------------------------
GLMU_LACLA      ----------------------------------------------------------------------
GLMU_CLOBJ      ----------------------------------------------------------------------
GLMU_BRUSU      ----------------------------------------------------------------------
GLMU_BRUSI      ----------------------------------------------------------------------
GLMU_BRUME      ----------------------------------------------------------------------
GLMU_BRUMB      ----------------------------------------------------------------------
GLMU_BRUC2      ----------------------------------------------------------------------
GLMU_BRUAB      ----------------------------------------------------------------------
GLMU_BRUA2      ----------------------------------------------------------------------
GLMU_BRUA1      ----------------------------------------------------------------------
GLMU_AGRRK      ----------------------------------------------------------------------
GLMU_ACIF5      ----------------------------------------------------------------------
GLMU_ACIF2      ----------------------------------------------------------------------
ACEA_MAGGR      ----------------------------------------------------------------------
HASC_STRPY      ----------------------------------------------------------------------
HASC2_STRP8     ----------------------------------------------------------------------
HASC2_STRP6     ----------------------------------------------------------------------
HASC2_STRP3     ----------------------------------------------------------------------
HASC2_STRP1     ----------------------------------------------------------------------
HASC1_STRP8     ----------------------------------------------------------------------
HASC1_STRP6     ----------------------------------------------------------------------
HASC1_STRP3     ----------------------------------------------------------------------
HASC1_STRP1     ----------------------------------------------------------------------
GTAB_STAAW      ----------------------------------------------------------------------
GTAB_STAAS      ----------------------------------------------------------------------
GTAB_STAAN      ----------------------------------------------------------------------
GTAB_STAAM      ----------------------------------------------------------------------
GTAB_STAAC      ----------------------------------------------------------------------
GTAB_STAAB      ----------------------------------------------------------------------
GTAB_STAA8      ----------------------------------------------------------------------
GTAB_STAA3      ----------------------------------------------------------------------
GLMU_SULNB      ----------------------------------------------------------------------
GLMU_PSEFS      ----------------------------------------------------------------------
GLMU_LISIN      ----------------------------------------------------------------------
GLMU_LEGPL      ----------------------------------------------------------------------
GLMU_LEGPC      ----------------------------------------------------------------------
GLMU_LEGPA      ----------------------------------------------------------------------
GLMU_HYPNA      ----------------------------------------------------------------------
GLMU_BACWK      ----------------------------------------------------------------------
GLMU_AGRVS      ----------------------------------------------------------------------
GLGC_NITOC      ----------------------------------------------------------------------
GLGC_NITEU      ----------------------------------------------------------------------
GLGC2_VIBPA     ----------------------------------------------------------------------
GALU_PSEAE      ----------------------------------------------------------------------
CAP3C_STRPN     ----------------------------------------------------------------------
ACEA_LEPMC      ----------------------------------------------------------------------
SPSI_BACSU      ----------------------------------------------------------------------
GTAB_STAAR      ----------------------------------------------------------------------
GMPPB_HUMAN     ----------------------------------------------------------------------
GMPPB_DICDI     ----------------------------------------------------------------------
GLMU_ENTFA      ----------------------------------------------------------------------
GLMU_BARHE      ----------------------------------------------------------------------
GLMU_ALTMD      ----------------------------------------------------------------------
GLGC_ARTAT      ----------------------------------------------------------------------
ACEA_YARLI      ----------------------------------------------------------------------
ACEA_PICPA      ----------------------------------------------------------------------
ACEA_DEBHA      ----------------------------------------------------------------------
ACEA_COPCI      ------------------------------------------------------------------ELAN
ACEA_COPC7      ------------------------------------------------------------------ELAN
MOBA_YERPP      ----------------------------------------------------------------------
MOBA_YERPN      ----------------------------------------------------------------------
MOBA_YERPG      ----------------------------------------------------------------------
MOBA_YERPE      ----------------------------------------------------------------------
MOBA_YERPB      ----------------------------------------------------------------------
MOBA_YERPA      ----------------------------------------------------------------------
ISPD_SYNSC      ----------------------------------------------------------------------
GMPPB_MOUSE     ----------------------------------------------------------------------
GMPPB_DROME     ----------------------------------------------------------------------
GLMU_STRGC      ----------------------------------------------------------------------
GLMU_SALAR      ----------------------------------------------------------------------
GLMU_RHOS5      ----------------------------------------------------------------------
GLMU_RHIME      ----------------------------------------------------------------------
GLMU_PSEPF      ----------------------------------------------------------------------
GLMU_PELPD      ----------------------------------------------------------------------
GLMU_NITHX      ----------------------------------------------------------------------
GLMU_LACDB      ----------------------------------------------------------------------
GLMU_GRABC      ----------------------------------------------------------------------
GLMU_BIFLO      ----------------------------------------------------------------------
GLMU_BIFLI      ----------------------------------------------------------------------
GLMU_BACME      ----------------------------------------------------------------------
GLMU_BACHD      ----------------------------------------------------------------------
GLMU_ACIAD      ----------------------------------------------------------------------
GLGC_GEOMG      ----------------------------------------------------------------------
EI2BE_MOUSE     ----------------------------------------------------------------------
ACEA_CANAL      ----------------------------------------------------------------------
SPLE_STAAU      --------------------------------HNVKLIKNTNVAPYNGIVSIGSGTG--FIVGKNTIVTN
MOBA_YERPY      ----------------------------------------------------------------------
MOBA_YERP3      ----------------------------------------------------------------------
ISPD_PROMM      ----------------------------------------------------------------------
GLMU_WIGBR      ----------------------------------------------------------------------
GLMU_SYNS3      ----------------------------------------------------------------------
GLMU_RALPJ      ----------------------------------------------------------------------
GLMU_NEIGO      ----------------------------------------------------------------------
GLMU_NEIG1      ----------------------------------------------------------------------
GLMU_METPP      ----------------------------------------------------------------------
GLMU_CITK8      ----------------------------------------------------------------------
GLMU_BUCAP      ----------------------------------------------------------------------
GLMU_BIFLD      ----------------------------------------------------------------------
GLMU_BACLD      ----------------------------------------------------------------------
GLGC_NITMU      ----------------------------------------------------------------------
GLGC_LEIXX      ----------------------------------------------------------------------
GLGC_DEIDV      ----------------------------------------------------------------------
EI2BE_RABIT     ----------------------------------------------------------------------
ACEA_PICJA      ----------------------------------------------------------------------
ACEA_CANTR      ----------------------------------------------------------------------
GMPPB_XENTR     ----------------------------------------------------------------------
GLMU_STRPG      ----------------------------------------------------------------------
GLMU_STRPF      ----------------------------------------------------------------------
GLMU_STRPC      ----------------------------------------------------------------------
GLMU_STRPB      ----------------------------------------------------------------------
GLMU_STRP6      ----------------------------------------------------------------------
GLMU_STRP3      ----------------------------------------------------------------------
GLMU_LAWIP      ----------------------------------------------------------------------
GLMU_BAUCH      ----------------------------------------------------------------------
GLMU_ANAVT      ----------------------------------------------------------------------
GLGC_RHOE4      ----------------------------------------------------------------------
GLGC_MAGSA      ----------------------------------------------------------------------
GLGC_JANSC      ----------------------------------------------------------------------
GLGC_DEIGD      ----------------------------------------------------------------------
GLGC_CORJK      ----------------------------------------------------------------------
GLGC_ARTCA      ----------------------------------------------------------------------
ACEA_MYCLE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLAD
PEPM_MYTED      TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLAD
PEPM_TETPY      TQVLEVLEFMSDRTKIPILLDGDTGYGNYNNARRLVKKLEQRSIAGVCLEDKIFPKRNSLLDDGRQELAP
PEPM_STRVR      TELLTLVGTMTEAAPAPVLVDGDTGYGNFNTARPSPPAPSCLGAAGVCFEDKVFPKMNSFFGDGHQ-LAP
PEPM_STRHY      TELLTLVGTMTDAPGVPVLVDGDTGYGNFNTXXXXXXXXXXXXXXXVCFEDKVFPKMNSFFGDGHQ-LAP
CPPM_STRHY      SEQAINLKNIVLTVDVPVIMDADAGYGNAMSVWRATREFERVGIVGYHLEDQVNPKRCGHLEGKR--LIS
PRPB_BACHD      TEVADRAKDLVRATNLPVLVDIDTGFGGVLNVARTAQEMLEANVAAVQIEDQQLPKKCGHLNGKQ--LVS
PRPB2_CORGL     TEVAHRSRQIARVTDLPVLVDADTGFGEPMSAARTVSELEDAGVAGCHLEDQVNPKRCGHLDGKE--VVG
PRPB_AERPE      SELAMFTSYITRVVRVPVIVDADTGFGEAINVERTVRELERAGAAAIQIEDQVMPKKCGHLQG--KALIS
PRPB_BACSU      AEIAERAKDLVRAADLPLLVDIDTGFGGVLNAARTAREMLEARVAAVQMEDQQLPKKCGHLNGKQ--LVP
PRPB1_CORGL     TEVAHRARQIARVTDLGVLVDADTGFGEPMSAARTVAELEDAGVAGCHLEDQVNPKRCGHLDGKE--VVR
OADC_RHOPB      TELAEQVRRMSRAAALPILVDADHGYGNALNVRRTVQELEGAGAAGLTIEDTALPQP---FGEATPQLIA
CPPM_ARATH      TA----RSVCASAPNIPIIADADTGGGNALNIQRTVKDLIAAGAAGCFLEDQAWPKKCGHMRGKQ--VIP
OADC_RHOP5      TELAEQVRRMSRAAALPVLVDADHGYGNALNVRRTVQELEAAGAAGLTIEDTLLPQA---FGETQPQLIS
OADC_BRAJA      TELAEQMRRMSRASALPVLVDADHGYGNALNVRRTVQELETAGAAGLTIEDTLLP---AAFGEAKTQLIS
OADC_PSEU5      SEFVEQATRICRVAQLPVLADADHGYGNALNVMRTVSELERAGISALTIEDTLLPPK---FGRRSTDLIG
OADC_BRASO      TELAEQMRRMSRAAVLPVLVDADHGYGNAMNVRRTVQELEAAGAAGLTIEDTSLPQA---YGAAKPQLIS
OADC_BRASB      TELADQMRRMSRAATLPVLVDADHGYGNAMNVRRTVQELEAAGAAGLTIEDTLLPQA---FGAAKPQLIS
PRPB_VIBCH      NDVLVDVERITNACDLPLLVDIDTGFGGAFNIARTIKAMEKAGAAAVHMEDQVAQKRCGH--RPNKAIVS
PDP_DIACA       TEVVETRRITAAAPNLCXXXXXXXXXXXPLNVQRFIRELISAGAKGVFLEDQVWPKKCGHMRGKA--VVP
OADC1_PSEPW     SEFVEQATRIGRVAQLPVLADADHGYGNALNVMRTVIELERAGVAALTIEDTLLP---AQFGRKSTDLIP
OADC_RHOPS      TELAEQXXXXXXXXXLPVLVDADHGYGNALNVRRTVQELEAAGAAGLTIEDTLLPQAY----GEASPLIS
OADC_PSEPG      SEFVEQATRIGRVAQLPVLADADHGYGNALNVMRTVIELERAGVAALTIEDTLLP---AQFGRKSTDLIP
OADC_PSEE4      SEFVEQATRIGRVAQLPVLADADHGYGNALNVMRTVIELERAGVAGLTIEDTLLP---AQFGRKSTDLIS
OADC_PSEPK      SEFVEQATRIGRVAQLPVLADADHGYGNALNVMRTVIELERAGVAALTIEDTLLP---AQFGRKSTDLIP
OADC_PSEP1      SEFVEQATRIGRVAQLPVLADADHGYGNALNVMRTVIELERAGVAALTIEDTLLP---AQFGRKSTDLIP
OADC_RHOP2      TELAEQXXXXXXXXXLPVLVDADHGYGNALNVRRTVQELEAAGCAGLTIEDTLLPQAY----GEAKPLIS
OADC_PSEMY      SEFVEQAARIGRVARLPVIADADHGYGNALNVMRTVVELERAGVAALTIEDTLLP---AQFGRKSTDLIS
OADC_BURXL      TELAEQVHRCTRVSDVPLVVDGDHGYGNALSVMRTVHELDRAGAAAVTIEDTLLPRPYGSSG--KPALVS
OADC_PSEF5      SEFAEQATRIGRVAQLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGRKSTDLIS
PRPB_SALTY      DDVLTDIRRITDVCPLPLLVDADIGFGSSANVARTVKSIAKAGAAALHIEDQVGAKRCGH--RPNKAIVS
OADC2_PSEPW     DEYVEQVTRVGRASQIPVIADADHGFGNALNVMRTVSELQKAGVAALTLEDTHLPARYE----EQSPLIG
OADC_AZOVD      SEFVEQATRIGRVACLPIIADADHGYGNAINAMRTVAELERAGVAALTLEDTLLPPK---YGHKTTDLIP
PRPB_ECOLI      DDVLTDIRRITDVCSLPLLVDADIGFGSSANVARTVKSMIKAGAAGLHIEDQVGAKRCGH--RPNKAIVS
OADC_CHRSD      SEFVEQATRIGRVTRLPVIADADHGYGNALNVMRTITELERAGVAALTIEDTLLP---AQYGHKSTDLIP
OADC_PSE14      SEFVEQATRIGRVAQLPVIADADHGYGNALNVMRTVVELERAGISALTIEDTLLP---AQFGRKSTDLIS
OADC_PSEU2      SEFVEQATRIGRVAQLPVIADADHGYGNALNVMRTVVELERAGISALTIEDTLLP---AQFGRKSTDLIS
OADC_PSEFS      SEFVEQATRIGRVAQLPFIADADHGYGNALNVMRTVEELERAGVAALTIEDTLLP---AQFGRKSTDLIS
OADC1_PSEPF     SEFAEQATRIGRVAQLPVIADADHGYGNALNVMRTIVELERAGVAALTIEDTLLP---AQFGRKSTDLIT
OADC_PSESM      SEFVEQATRIGRVAQLPVIADADHGYGNALNVMRTVVELERAGISALTIEDTLLP---AQFGRKSTDLIS
OADC_PSEAE      SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGRKSTDLIC
OADC_PSEAB      SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGRKSTDLIC
OADC_PSEA8      SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGRKSTDLIC
OADC_PSEA7      SEFVEQATRIGRVARLPVIADADHGYGNALNVMRTVVELERAGIAALTIEDTLLP---AQFGRKSTDLIC
OADC_MARMS      SEFTEQATRIGRVARLPIIADADHGYGNALNVMRTIVELERAGVAALTIEDTLLP---AKYGHKSTDLIP
OADC_RHOPA      TELAEQVRRMSRAAALPVVVDADHGYGNALNVRRTVXXXXXXXXXXXTIEDTLLPQAY----GEAKPLVS
OADC_RHOPT      TELAEQVRRMSRAAALPVVVDADHGYGNALNVRRTVXXXXXXXXXXXTIEDTLLPQAY----GEAKPLVS
OADC2_PSEPF     DEYVEQVSRVGRASQIPIIGDADHGFGNALNVMRTVTELQKAGVAALTLEDTHLP---AKYDEQSHVLIX
GLMU_DEIRA      ----------------------------------------------------------------------
GLMU_METVS      ----------------------------------------------------------------------
GLMU_METM5      ----------------------------------------------------------------------
GLMU_KOSOT      ----------------------------------------------------------------------
GLMU_DECAR      ----------------------------------------------------------------------
GLMU_METJA      ----------------------------------------------------------------------
GLMU_DEIGD      ----------------------------------------------------------------------
GLMU_BURPS      ----------------------------------------------------------------------
GLMU_BURP6      ----------------------------------------------------------------------
GLMU_BURP1      ----------------------------------------------------------------------
GLMU_BURP0      ----------------------------------------------------------------------
GLMU_BURMS      ----------------------------------------------------------------------
GLMU_BURMA      ----------------------------------------------------------------------
GLMU_BURM7      ----------------------------------------------------------------------
GLMU_STRMK      ----------------------------------------------------------------------
GLMU_SYMTH      ----------------------------------------------------------------------
GLMU_BLOPB      ----------------------------------------------------------------------
GLMU_CELJU      ----------------------------------------------------------------------
GLMU_XANCB      ----------------------------------------------------------------------
GLMU_ACHLI      ----------------------------------------------------------------------
GLMU_RHIE6      ----------------------------------------------------------------------
GLMU_METM7      ----------------------------------------------------------------------
GLMU_STRM5      ----------------------------------------------------------------------
GLMU_BURPP      ----------------------------------------------------------------------
GLMU_XYLFM      ----------------------------------------------------------------------
GLMU_XYLFA      ----------------------------------------------------------------------
GLMU_XYLFT      ----------------------------------------------------------------------
GLMU_XYLF2      ----------------------------------------------------------------------
GLMU_VIBCM      ----------------------------------------------------------------------
GLMU_VIBCH      ----------------------------------------------------------------------
GLMU_VIBC3      ----------------------------------------------------------------------
GLMU_TOLAT      ----------------------------------------------------------------------
GLMU_HALHL      ----------------------------------------------------------------------
GLMU_XANOR      ----------------------------------------------------------------------
GLMU_METMP      ----------------------------------------------------------------------
GLMU_CLOTH      ----------------------------------------------------------------------
GLMU_VIBFM      ----------------------------------------------------------------------
GLMU_VIBF1      ----------------------------------------------------------------------
GLMU_RHIEC      ----------------------------------------------------------------------
GLMU_RALEJ      ----------------------------------------------------------------------
GLMU_AZOSB      ----------------------------------------------------------------------
GLMU_ALISL      ----------------------------------------------------------------------
GLMU_XANOM      ----------------------------------------------------------------------
GLMU_RHILW      ----------------------------------------------------------------------
GLMU_MARAV      ----------------------------------------------------------------------
GLMU_GEOLS      ----------------------------------------------------------------------
GLMU_VIBVY      ----------------------------------------------------------------------
GLMU_VIBVU      ----------------------------------------------------------------------
GLMU_GLUDA      ----------------------------------------------------------------------
GLMU_BURP8      ----------------------------------------------------------------------
GLMU_AERHH      ----------------------------------------------------------------------
GLMU_JANMA      ----------------------------------------------------------------------
GLMU_EDWI9      ----------------------------------------------------------------------
GLMU_BURXL      ----------------------------------------------------------------------
GLMU_BURCH      ----------------------------------------------------------------------
GLMU_BURCA      ----------------------------------------------------------------------
GLMU_SHEAM      ----------------------------------------------------------------------
GLMU_ENTS8      ----------------------------------------------------------------------
GLMU_THISH      ----------------------------------------------------------------------
GLMU_SACD2      ----------------------------------------------------------------------
GLMU_HERAR      ----------------------------------------------------------------------
GLMU_THETN      ----------------------------------------------------------------------
GLMU_SPHWW      ----------------------------------------------------------------------
GLMU_SODGM      ----------------------------------------------------------------------
GLMU_SHEHH      ----------------------------------------------------------------------
GLMU_RHIL3      ----------------------------------------------------------------------
GLMU_PELCD      ----------------------------------------------------------------------
GLMU_BURTA      ----------------------------------------------------------------------
GLMU_ZYMMO      ----------------------------------------------------------------------
GLMU_SPHAL      ----------------------------------------------------------------------
GLMU_PHOPR      ----------------------------------------------------------------------
GLMU_HAHCH      ----------------------------------------------------------------------
GLMU_FERNB      ----------------------------------------------------------------------
GLMU_THEAB      ----------------------------------------------------------------------
GLMU_SERP5      ----------------------------------------------------------------------
GLMU_NITEU      ----------------------------------------------------------------------
GLMU_GEOSF      ----------------------------------------------------------------------
GLMU_ERWT9      ----------------------------------------------------------------------
GLMU_CLOTE      ----------------------------------------------------------------------
GLMU_BURA4      ----------------------------------------------------------------------
GLMU_BORA1      ----------------------------------------------------------------------
GLMU_AQUAE      ----------------------------------------------------------------------
GLMU_YERE8      ----------------------------------------------------------------------
GLMU_XANAC      ----------------------------------------------------------------------
GLMU_SYNWW      ----------------------------------------------------------------------
GLMU_DESAP      ----------------------------------------------------------------------
GLMU_BREBN      ----------------------------------------------------------------------
GMPPB_CAEEL     ----------------------------------------------------------------------
GLMU_XANC5      ----------------------------------------------------------------------
GLMU_STAES      ----------------------------------------------------------------------
GLMU_STAEQ      ----------------------------------------------------------------------
GLMU_STAEP      ----------------------------------------------------------------------
GLMU_SHESA      ----------------------------------------------------------------------
GLMU_RALME      ----------------------------------------------------------------------
GLMU_MANSM      ----------------------------------------------------------------------
GLMU_BURM1      ----------------------------------------------------------------------
Y1334_METJA     ----------------------------------------------------------------------
GLMU_SHEWM      ----------------------------------------------------------------------
GLMU_SHEPA      ----------------------------------------------------------------------
GLMU_SHEDO      ----------------------------------------------------------------------
GLMU_PROAC      ----------------------------------------------------------------------
GLMU_HAES1      ----------------------------------------------------------------------
STRD_STRGR      ----------------------------------------------------------------------
GLMU_YERPY      ----------------------------------------------------------------------
GLMU_YERPS      ----------------------------------------------------------------------
GLMU_YERPP      ----------------------------------------------------------------------
GLMU_YERPN      ----------------------------------------------------------------------
GLMU_YERPE      ----------------------------------------------------------------------
GLMU_YERPB      ----------------------------------------------------------------------
GLMU_YERPA      ----------------------------------------------------------------------
GLMU_YERP3      ----------------------------------------------------------------------
GLMU_SHEPW      ----------------------------------------------------------------------
GLMU_META3      ----------------------------------------------------------------------
GLMU_HAES2      ----------------------------------------------------------------------
GLMU_CHRVO      ----------------------------------------------------------------------
GLMU_BORPD      ----------------------------------------------------------------------
GLMU_STAHJ      ----------------------------------------------------------------------
GLMU_SHESH      ----------------------------------------------------------------------
GLMU_ROSDO      ----------------------------------------------------------------------
GLMU_PSYA2      ----------------------------------------------------------------------
GLMU_PSEA6      ----------------------------------------------------------------------
GLMU_GEOSL      ----------------------------------------------------------------------
GMPPB_CAEBR     ----------------------------------------------------------------------
GLMU_SHEFN      ----------------------------------------------------------------------
GLMU_PSYIN      ----------------------------------------------------------------------
GLMU_PECCP      ----------------------------------------------------------------------
GLMU_HAEPS      ----------------------------------------------------------------------
GLMU_THESQ      ----------------------------------------------------------------------
GLMU_THEP1      ----------------------------------------------------------------------
GLMU_PSE14      ----------------------------------------------------------------------
GLMU_ERWCT      ----------------------------------------------------------------------
GLMU_BORPE      ----------------------------------------------------------------------
GLMU_BORPA      ----------------------------------------------------------------------
GLMU_BORBR      ----------------------------------------------------------------------
GLMU_OCEIH      ----------------------------------------------------------------------
GLMU_GEOUR      ----------------------------------------------------------------------
GLMU_FRAP2      ----------------------------------------------------------------------
GLMU_CLOK5      ----------------------------------------------------------------------
GLMU_CLOK1      ----------------------------------------------------------------------
GLMU_CLOD6      ----------------------------------------------------------------------
GTAB_STAHJ      ----------------------------------------------------------------------
GLMU_THEMA      ----------------------------------------------------------------------
GLMU_STAAW      ----------------------------------------------------------------------
GLMU_STAAS      ----------------------------------------------------------------------
GLMU_STAAR      ----------------------------------------------------------------------
GLMU_STAAN      ----------------------------------------------------------------------
GLMU_STAAM      ----------------------------------------------------------------------
GLMU_STAAC      ----------------------------------------------------------------------
GLMU_STAAB      ----------------------------------------------------------------------
GLMU_STAA3      ----------------------------------------------------------------------
GLMU_SHESW      ----------------------------------------------------------------------
GLMU_SHEPC      ----------------------------------------------------------------------
GLMU_SHELP      ----------------------------------------------------------------------
GLMU_PASMU      ----------------------------------------------------------------------
GLMU_NOVAD      ----------------------------------------------------------------------
GLMU_HAEIN      ----------------------------------------------------------------------
GLMU_GEOMG      ----------------------------------------------------------------------
GLMU_DESVV      ----------------------------------------------------------------------
GLMU_DESVH      ----------------------------------------------------------------------
GLMU_COXBN      ----------------------------------------------------------------------
GALU_MYCPN      ----------------------------------------------------------------------
GTAB_BACSU      ----------------------------------------------------------------------
GTAB2_STAS1     ----------------------------------------------------------------------
GLMU_PSEU2      ----------------------------------------------------------------------
GLMU_PSEMY      ----------------------------------------------------------------------
GLMU_PSEAE      ----------------------------------------------------------------------
GLMU_PSEAB      ----------------------------------------------------------------------
GLMU_PSEA8      ----------------------------------------------------------------------
GLMU_PSEA7      ----------------------------------------------------------------------
GLMU_NITEC      ----------------------------------------------------------------------
GLMU_COLP3      ----------------------------------------------------------------------
GLMU_ALCBS      ----------------------------------------------------------------------
GLMU_ACTSZ      ----------------------------------------------------------------------
RFBF_SALTY      ----------------------------------------------------------------------
GLMU_SHESM      ----------------------------------------------------------------------
GLMU_METFK      ----------------------------------------------------------------------
GLMU_HAEI8      ----------------------------------------------------------------------
GLMU_COXB1      ----------------------------------------------------------------------
GLMU_CLONN      ----------------------------------------------------------------------
GLMU_STAA8      ----------------------------------------------------------------------
GLMU_PSEF5      ----------------------------------------------------------------------
GLMU_HAEIG      ----------------------------------------------------------------------
GLMU_HAEIE      ----------------------------------------------------------------------
GLMU_HAEDU      ----------------------------------------------------------------------
GLMU_COXB2      ----------------------------------------------------------------------
GLMU_CLOBB      ----------------------------------------------------------------------
GLMU_CLOBA      ----------------------------------------------------------------------
GLMU_ACISJ      ----------------------------------------------------------------------
GTAB1_STAS1     ----------------------------------------------------------------------
GLMU_SHESR      ----------------------------------------------------------------------
GLMU_SHEB5      ----------------------------------------------------------------------
GLMU_SALTY      ----------------------------------------------------------------------
GLMU_SALTI      ----------------------------------------------------------------------
GLMU_SALSV      ----------------------------------------------------------------------
GLMU_SALPK      ----------------------------------------------------------------------
GLMU_SALPB      ----------------------------------------------------------------------
GLMU_SALPA      ----------------------------------------------------------------------
GLMU_SALNS      ----------------------------------------------------------------------
GLMU_SALHS      ----------------------------------------------------------------------
GLMU_SALG2      ----------------------------------------------------------------------
GLMU_SALEP      ----------------------------------------------------------------------
GLMU_SALDC      ----------------------------------------------------------------------
GLMU_SALCH      ----------------------------------------------------------------------
GLMU_SALA4      ----------------------------------------------------------------------
GLMU_DESVM      ----------------------------------------------------------------------
GLMU_DESDG      ----------------------------------------------------------------------
GLMU_CHRSD      ----------------------------------------------------------------------
ISPD_BIFLD      ----------------------------------------------------------------------
GLMU_THEM4      ----------------------------------------------------------------------
GLMU_SHEB8      ----------------------------------------------------------------------
GLMU_SHEB2      ----------------------------------------------------------------------
GLMU_PHOLL      ----------------------------------------------------------------------
GLMU_MAGSA      ----------------------------------------------------------------------
GLMU_EXISA      ----------------------------------------------------------------------
GLMU_COXBU      ----------------------------------------------------------------------
GLMU_COXBR      ----------------------------------------------------------------------
GLMU_CLOPS      ----------------------------------------------------------------------
GLMU_AZOVD      ----------------------------------------------------------------------
GLGC_KOCRD      ----------------------------------------------------------------------
MPG1_SULAC      ----------------------------------------------------------------------
LICC_HAEIN      ----------------------------------------------------------------------
ISPD_BIFLO      ----------------------------------------------------------------------
ISPD_BIFLI      ----------------------------------------------------------------------
GLMU_VIBPA      ----------------------------------------------------------------------
GLMU_THEP3      ----------------------------------------------------------------------
GLMU_STAS1      ----------------------------------------------------------------------
GLMU_SHEB9      ----------------------------------------------------------------------
GLMU_EXIS2      ----------------------------------------------------------------------
GLMU_CLOP1      ----------------------------------------------------------------------
GLMU_AZOSE      ----------------------------------------------------------------------
GLMU_PSESM      ----------------------------------------------------------------------
GLMU_PSEPK      ----------------------------------------------------------------------
GLMU_PSEPG      ----------------------------------------------------------------------
GLMU_GEOSW      ----------------------------------------------------------------------
GLMU_CYAP7      ----------------------------------------------------------------------
GLMU_CLOPE      ----------------------------------------------------------------------
GLGC_CORGL      ----------------------------------------------------------------------
GLGC_CORGB      ----------------------------------------------------------------------
GLGC_CORA7      ----------------------------------------------------------------------
GALU2_PSEAE     ----------------------------------------------------------------------
EI2BG_HUMAN     ----------------------------------------------------------------------
GLMU_SHEON      ----------------------------------------------------------------------
GLMU_PSEE4      ----------------------------------------------------------------------
GLMU_PROM0      ----------------------------------------------------------------------
GLMU_PARL1      ----------------------------------------------------------------------
GLMU_MARMM      ----------------------------------------------------------------------
GLMU_GEOTN      ----------------------------------------------------------------------
GLMU_CALS8      ----------------------------------------------------------------------
GLMU_ACTPJ      ----------------------------------------------------------------------
GLMU_ACTP7      ----------------------------------------------------------------------
GLMU_ACTP2      ----------------------------------------------------------------------
GLGC_RHOBA      ----------------------------------------------------------------------
GLGC_ANADF      ----------------------------------------------------------------------
ACEA_KLULA      ERICDGTIEESEIIDYPIVADGDAGHGGLTAVFKLTKMFIERGAAGIHIEDQ--TSTNKKCGHAGRCVIP
GLMU_VIBHB      ----------------------------------------------------------------------
GLMU_PSEP1      ----------------------------------------------------------------------
GLMU_PROM9      ----------------------------------------------------------------------
GLMU_KLEP7      ----------------------------------------------------------------------
GLMU_KLEP3      ----------------------------------------------------------------------
GLMU_DESHY      ----------------------------------------------------------------------
GLGC_PROAC      ----------------------------------------------------------------------
GLGC_COREF      ----------------------------------------------------------------------
GALU_MYCGE      ----------------------------------------------------------------------
ACEA_EMENI      TTPKDQRHKVANVDYLPIIADADTGHGGLTAVMKLTKLFVERGAAGIHIEDQA-PGTKKCGHMAGKVLVP
YTDA_BACSU      ----------------------------------------------------------------------
MPG1_PICAN      ----------------------------------------------------------------------
GLMU_PSYCK      ----------------------------------------------------------------------
GLMU_PROMS      ----------------------------------------------------------------------
GLMU_NITOC      ----------------------------------------------------------------------
GLMU_LISMH      ----------------------------------------------------------------------
GLMU_LISMF      ----------------------------------------------------------------------
GLMU_LISMC      ----------------------------------------------------------------------
GLMU_DESHD      ----------------------------------------------------------------------
GLMU_CLOBM      ----------------------------------------------------------------------
GLMU_CLOB6      ----------------------------------------------------------------------
GLMU_CLOAB      ----------------------------------------------------------------------
GLMU_ACIBY      ----------------------------------------------------------------------
GLMU_ACIBC      ----------------------------------------------------------------------
GLGC_DECAR      ----------------------------------------------------------------------
GLGC_CORDI      ----------------------------------------------------------------------
GLGC_ANASK      ----------------------------------------------------------------------
GLGC_ANADE      ----------------------------------------------------------------------
GLGC_ANAD2      ----------------------------------------------------------------------
GALF_SALTY      ----------------------------------------------------------------------
GALF_SALTI      ----------------------------------------------------------------------
GALF_KLEPN      ----------------------------------------------------------------------
CAP4C_STRPN     ----------------------------------------------------------------------
ACEA_COCIM      -----NIDYLA-----PIIADADTGHGGLTAVMKLTKLFIERGAAGIHIEDQA-PGTKKCGHMAGKVLVP
GLMU_STRMU      ----------------------------------------------------------------------
GLMU_SHISS      ----------------------------------------------------------------------
GLMU_SHIFL      ----------------------------------------------------------------------
GLMU_SHIF8      ----------------------------------------------------------------------
GLMU_SHIDS      ----------------------------------------------------------------------
GLMU_SHIBS      ----------------------------------------------------------------------
GLMU_SHIB3      ----------------------------------------------------------------------
GLMU_PSYWF      ----------------------------------------------------------------------
GLMU_OCHA4      ----------------------------------------------------------------------
GLMU_LEGPH      ----------------------------------------------------------------------
GLMU_ESCF3      ----------------------------------------------------------------------
GLMU_ENT38      ----------------------------------------------------------------------
GLMU_ECOUT      ----------------------------------------------------------------------
GLMU_ECOSM      ----------------------------------------------------------------------
GLMU_ECOSE      ----------------------------------------------------------------------
GLMU_ECOLU      ----------------------------------------------------------------------
GLMU_ECOLI      ----------------------------------------------------------------------
GLMU_ECOLC      ----------------------------------------------------------------------
GLMU_ECOL6      ----------------------------------------------------------------------
GLMU_ECOL5      ----------------------------------------------------------------------
GLMU_ECOK1      ----------------------------------------------------------------------
GLMU_ECOHS      ----------------------------------------------------------------------
GLMU_ECODH      ----------------------------------------------------------------------
GLMU_ECOBW      ----------------------------------------------------------------------
GLMU_ECO8A      ----------------------------------------------------------------------
GLMU_ECO81      ----------------------------------------------------------------------
GLMU_ECO7I      ----------------------------------------------------------------------
GLMU_ECO5E      ----------------------------------------------------------------------
GLMU_ECO57      ----------------------------------------------------------------------
GLMU_ECO55      ----------------------------------------------------------------------
GLMU_ECO45      ----------------------------------------------------------------------
GLMU_ECO27      ----------------------------------------------------------------------
GLMU_ECO24      ----------------------------------------------------------------------
GLMU_CLOBL      ----------------------------------------------------------------------
GLMU_CLOBK      ----------------------------------------------------------------------
GLMU_CLOBH      ----------------------------------------------------------------------
GLMU_CLOB1      ----------------------------------------------------------------------
GLMU_BIFAA      ----------------------------------------------------------------------
GLMU_BACHK      ----------------------------------------------------------------------
GLMU_BACCZ      ----------------------------------------------------------------------
GLMU_BACCR      ----------------------------------------------------------------------
GLMU_BACCQ      ----------------------------------------------------------------------
GLMU_BACCN      ----------------------------------------------------------------------
GLMU_BACC7      ----------------------------------------------------------------------
GLMU_BACC4      ----------------------------------------------------------------------
GLMU_BACC3      ----------------------------------------------------------------------
GLMU_BACC2      ----------------------------------------------------------------------
GLMU_BACC1      ----------------------------------------------------------------------
GLMU_BACC0      ----------------------------------------------------------------------
GLMU_BACAN      ----------------------------------------------------------------------
GLMU_BACAH      ----------------------------------------------------------------------
GLMU_BACAC      ----------------------------------------------------------------------
GLMU_BACAA      ----------------------------------------------------------------------
GLMU_ACIBS      ----------------------------------------------------------------------
GALF_SHIFL      ----------------------------------------------------------------------
GALF_ECOLI      ----------------------------------------------------------------------
GALF_ECO57      ----------------------------------------------------------------------
EI2BG_RAT       ----------------------------------------------------------------------
EI2BG_MACFA     ----------------------------------------------------------------------
GLMU_THIDA      ----------------------------------------------------------------------
GLMU_THELT      ----------------------------------------------------------------------
GLMU_RHISN      ----------------------------------------------------------------------
GLMU_PSEHT      ----------------------------------------------------------------------
GLMU_PROM2      ----------------------------------------------------------------------
GLMU_MYXXD      ----------------------------------------------------------------------
GLMU_HELMI      ----------------------------------------------------------------------
GLMU_CAUCR      ----------------------------------------------------------------------
GLMU_CAUCN      ----------------------------------------------------------------------
GLMU_BDEBA      ----------------------------------------------------------------------
GLMU_ACIAC      ----------------------------------------------------------------------
EXON_RHIME      ----------------------------------------------------------------------
ACEA_PENMA      ----------------PIIADADTGHGGLTAVMKLTKLFVERGAAGIHIEDQA-PGTKKCGHMAGKVLVP
ACEA_NEUCR      ----DQREKLANIDYLPIVADADTGHGGLTAVMKLTKLFIEKGAAGIHIEDQA-PGTKKCGHMAGKVLVP
GLMU_NEIMF      ----------------------------------------------------------------------
GLMU_NEIM0      ----------------------------------------------------------------------
GLMU_LISMO      ----------------------------------------------------------------------
GLMU_DIAST      ----------------------------------------------------------------------
GLMU_BACSK      ----------------------------------------------------------------------
GLGC_METCA      ----------------------------------------------------------------------
EI2BG_BOVIN     ----------------------------------------------------------------------
ACEA_GIBZE      ----------------PIVADADTGHGGLTAVMKLTKLFIEKGAAGIHIEDQA-PGTKKCGHMAGKVLVP
ACEA_ASPFU      ----------------PIIADADTGHGGLTAVMKLTKLFIERGAAGIHIEDQA-PGTKKCGHMAGKVLVP
GMPPB_DROPS     ----------------------------------------------------------------------
GLMU_RHOFD      ----------------------------------------------------------------------
GLMU_PSEU5      ----------------------------------------------------------------------
GLMU_PROMP      ----------------------------------------------------------------------
GLMU_PROMH      ----------------------------------------------------------------------
GLMU_LISW6      ----------------------------------------------------------------------
GLGC_MYXXD      ----------------------------------------------------------------------
ISPD_NOCFA      ----------------------------------------------------------------------
GTAB_STAES      ----------------------------------------------------------------------
GTAB_STAEQ      ----------------------------------------------------------------------
GLMU_NITMU      ----------------------------------------------------------------------
GLMU_NEIMB      ----------------------------------------------------------------------
GLMU_LACLS      ----------------------------------------------------------------------
GLMU_LACLM      ----------------------------------------------------------------------
GLMU_LACLA      ----------------------------------------------------------------------
GLMU_CLOBJ      ----------------------------------------------------------------------
GLMU_BRUSU      ----------------------------------------------------------------------
GLMU_BRUSI      ----------------------------------------------------------------------
GLMU_BRUME      ----------------------------------------------------------------------
GLMU_BRUMB      ----------------------------------------------------------------------
GLMU_BRUC2      ----------------------------------------------------------------------
GLMU_BRUAB      ----------------------------------------------------------------------
GLMU_BRUA2      ----------------------------------------------------------------------
GLMU_BRUA1      ----------------------------------------------------------------------
GLMU_AGRRK      ----------------------------------------------------------------------
GLMU_ACIF5      ----------------------------------------------------------------------
GLMU_ACIF2      ----------------------------------------------------------------------
ACEA_MAGGR      ----------------PIIADADTGHGGLTAVMKLTKLFIEKGAAGIHIEDQA-PGTKKCGHMAGKVLVP
HASC_STRPY      ----------------------------------------------------------------------
HASC2_STRP8     ----------------------------------------------------------------------
HASC2_STRP6     ----------------------------------------------------------------------
HASC2_STRP3     ----------------------------------------------------------------------
HASC2_STRP1     ----------------------------------------------------------------------
HASC1_STRP8     ----------------------------------------------------------------------
HASC1_STRP6     ----------------------------------------------------------------------
HASC1_STRP3     ----------------------------------------------------------------------
HASC1_STRP1     ----------------------------------------------------------------------
GTAB_STAAW      ----------------------------------------------------------------------
GTAB_STAAS      ----------------------------------------------------------------------
GTAB_STAAN      ----------------------------------------------------------------------
GTAB_STAAM      ----------------------------------------------------------------------
GTAB_STAAC      ----------------------------------------------------------------------
GTAB_STAAB      ----------------------------------------------------------------------
GTAB_STAA8      ----------------------------------------------------------------------
GTAB_STAA3      ----------------------------------------------------------------------
GLMU_SULNB      ----------------------------------------------------------------------
GLMU_PSEFS      ----------------------------------------------------------------------
GLMU_LISIN      ----------------------------------------------------------------------
GLMU_LEGPL      ----------------------------------------------------------------------
GLMU_LEGPC      ----------------------------------------------------------------------
GLMU_LEGPA      ----------------------------------------------------------------------
GLMU_HYPNA      ----------------------------------------------------------------------
GLMU_BACWK      ----------------------------------------------------------------------
GLMU_AGRVS      ----------------------------------------------------------------------
GLGC_NITOC      ----------------------------------------------------------------------
GLGC_NITEU      ----------------------------------------------------------------------
GLGC2_VIBPA     ----------------------------------------------------------------------
GALU_PSEAE      ----------------------------------------------------------------------
CAP3C_STRPN     ----------------------------------------------------------------------
ACEA_LEPMC      ----------------PIIADADTGHGGLTAIMKLTKLFIEKGAAGIHIEDQA-PGTKKCGHMAGKVLVP
SPSI_BACSU      ----------------------------------------------------------------------
GTAB_STAAR      ----------------------------------------------------------------------
GMPPB_HUMAN     ----------------------------------------------------------------------
GMPPB_DICDI     ----------------------------------------------------------------------
GLMU_ENTFA      ----------------------------------------------------------------------
GLMU_BARHE      ----------------------------------------------------------------------
GLMU_ALTMD      ----------------------------------------------------------------------
GLGC_ARTAT      ----------------------------------------------------------------------
ACEA_YARLI      ----------------PIIADADTGHGGLTAVVKLTKMFIERGAAGIHIEDQ------------------
ACEA_PICPA      ----------------PIIADADTGHGGITAIIKLTKMFIERGAAGIHIEDQA-PGTKKCGHMAGKVLVP
ACEA_DEBHA      ----------------PIIADADTGHGGITAILKLTKLFVERGAAGIHIEDQ------------------
ACEA_COPCI      TPVIDYLR--------PIVADADTGHGGLTAVMKLTKMFVEKGAAGIHIEDQ------------------
ACEA_COPC7      TPVIDYLR--------PIVADADTGHGGLTAVMKLTKMFVEKGAAGIHIEDQ------------------
MOBA_YERPP      ----------------------------------------------------------------------
MOBA_YERPN      ----------------------------------------------------------------------
MOBA_YERPG      ----------------------------------------------------------------------
MOBA_YERPE      ----------------------------------------------------------------------
MOBA_YERPB      ----------------------------------------------------------------------
MOBA_YERPA      ----------------------------------------------------------------------
ISPD_SYNSC      ----------------------------------------------------------------------
GMPPB_MOUSE     ----------------------------------------------------------------------
GMPPB_DROME     ----------------------------------------------------------------------
GLMU_STRGC      ----------------------------------------------------------------------
GLMU_SALAR      ----------------------------------------------------------------------
GLMU_RHOS5      ----------------------------------------------------------------------
GLMU_RHIME      ----------------------------------------------------------------------
GLMU_PSEPF      ----------------------------------------------------------------------
GLMU_PELPD      ----------------------------------------------------------------------
GLMU_NITHX      ----------------------------------------------------------------------
GLMU_LACDB      ----------------------------------------------------------------------
GLMU_GRABC      ----------------------------------------------------------------------
GLMU_BIFLO      ----------------------------------------------------------------------
GLMU_BIFLI      ----------------------------------------------------------------------
GLMU_BACME      ----------------------------------------------------------------------
GLMU_BACHD      ----------------------------------------------------------------------
GLMU_ACIAD      ----------------------------------------------------------------------
GLGC_GEOMG      ----------------------------------------------------------------------
EI2BE_MOUSE     ----------------------------------------------------------------------
ACEA_CANAL      ----------------PIIADADTGHGGITAIIKLTKMFIERGAAGIHIEDQ------------------
SPLE_STAAU      KHVVAGMEIGAQIIAHP---NGEYNNGGFYKVKKIVRYAGQEDIAILHVEDKIHPKNRNF----------
MOBA_YERPY      ----------------------------------------------------------------------
MOBA_YERP3      ----------------------------------------------------------------------
ISPD_PROMM      ----------------------------------------------------------------------
GLMU_WIGBR      ----------------------------------------------------------------------
GLMU_SYNS3      ----------------------------------------------------------------------
GLMU_RALPJ      ----------------------------------------------------------------------
GLMU_NEIGO      ----------------------------------------------------------------------
GLMU_NEIG1      ----------------------------------------------------------------------
GLMU_METPP      ----------------------------------------------------------------------
GLMU_CITK8      ----------------------------------------------------------------------
GLMU_BUCAP      ----------------------------------------------------------------------
GLMU_BIFLD      ----------------------------------------------------------------------
GLMU_BACLD      ----------------------------------------------------------------------
GLGC_NITMU      ----------------------------------------------------------------------
GLGC_LEIXX      ----------------------------------------------------------------------
GLGC_DEIDV      ----------------------------------------------------------------------
EI2BE_RABIT     ----------------------------------------------------------------------
ACEA_PICJA      ----------------PIIADADTGHGGITAIIKLTKLFIERGAAGIHIEDQ------------------
ACEA_CANTR      ----------------PIIADADTGHGGITAIIKLTKLFIERGAAGIHIEDQ------------------
GMPPB_XENTR     ----------------------------------------------------------------------
GLMU_STRPG      ----------------------------------------------------------------------
GLMU_STRPF      ----------------------------------------------------------------------
GLMU_STRPC      ----------------------------------------------------------------------
GLMU_STRPB      ----------------------------------------------------------------------
GLMU_STRP6      ----------------------------------------------------------------------
GLMU_STRP3      ----------------------------------------------------------------------
GLMU_LAWIP      ----------------------------------------------------------------------
GLMU_BAUCH      ----------------------------------------------------------------------
GLMU_ANAVT      ----------------------------------------------------------------------
GLGC_RHOE4      ----------------------------------------------------------------------
GLGC_MAGSA      ----------------------------------------------------------------------
GLGC_JANSC      ----------------------------------------------------------------------
GLGC_DEIGD      ----------------------------------------------------------------------
GLGC_CORJK      ----------------------------------------------------------------------
GLGC_ARTCA      ----------------------------------------------------------------------
ACEA_MYCLE      -----------------IIADADTGHGGDSHVRNLIRRFVEIGVPGYHIEDQ------------------


                         +         .         .         .         .         *         .:210
query           IDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSKADEIVTFAR
PEPM_MYTED      IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
PEPM_TETPY      INEFVAKIKACKDTQQDADFQVVARVEAFIAGWGLEEALKRAEAYRNAGADAILMHSKLKEPSEIEAFMK
PEPM_STRVR      IGEFSGKIKACKDTQRDPGFVVVARTEALISNLPMEEALTRAHAYVEAVADGLFIHSRMSTPQQIAEFMR
PEPM_STRHY      VAEFCGKIRACKDAQRDPDFVVVARTEALISKLPMXXXXXXXXXXXXXXXXXXFIHSRMNTPQQIATFME
CPPM_STRHY      TEEMTGKIEAAVEAREDEDFTIIARTDAR-ESFGLDEAIRRSREYVAAGADCIFLEAMLD-VEEMKRVRD
PRPB_BACHD      KEEMEQKIQAIK--KVAPTLVIVARTDAR-ANEGLNGAIERANVYIEAGADAIFPEA-LQSAEEFRLVAE
PRPB2_CORGL     TDIMVRRIAAAVNERRDEQFVICARTDA--AGEGIDSAIERAKAYADAGADMIFTEALYSPAD----FEK
PRPB_AERPE      PEDMVKKIIAAVGARR--DALIVARTDAR-GVEGFEKAVERAQLYVEAGAD-IIFPEALTSLEEFREFAR
PRPB_BACSU      IKEM--XXXXXXXXXXXPSLIVVARTDAR-AQEGLDAAIKRSEAYIEAGADAIFPEA-LQAENEFRQFAE
PRPB1_CORGL     TDXXXXXXXXXXXXXXDPNFVICARTDA--AGEGIDAAIERAKAYLDAGADMIFTEALHSEAD--FRYFR
OADC_RHOPB      IEEGFGKIKAALDARGDPTLVIVGRTGAL-AITSLEDAIERAQAYEAAGVDALFFTAVKTRA--------
CPPM_ARATH      AEEHAAKIASARDAIGDSDFFLVARVRATSAKSGLEDAIARVNLYMEAGADASFVEAPRDD-DELKEIGK
OADC_RHOP5      LAEGQGKINAALDARGDPSLVIIGRTGAL-AITSLDDAIERAQAYQAAGVDAL-----------------
OADC_BRAJA      LEEGVGKMKAALSGRSDPTLVIMGRTGA-AAITSLDDTIRRAQAYEATGVDALFFTGIKSRAE-------
OADC_PSEU5      MFEAVGKIRAALEARVDPEMAIIGRTNAGVIGF--EEVIARAQAYEKAGADAICIASQLSKPLMLVTY--
OADC_BRASO      LDEGVGKVKAALDGRGDSSLVILGRTGA-VSITSLDDAIARARVYETCGVDG-LFFTGITTRDQLDAIAA
OADC_BRASB      LAEGIGKVKAALEGRGDPALVILGRTGA-VSVTSLDDAIARARAYEACGVDG-LFFTGITARDQLDAIAA
PRPB_VIBCH      QQEMVDRVKAAVDARINPEFVIMARTDAL-AVEGMDSAIERAIACVEAGADMIFAMTELKQYEQFSTALR
PDP_DIACA       AEEHALKIAAAREAIGDSDFFLVARTDAR-APHGLEEGIRRANLYKEAGADATFVEAP-ANVDELKEVSA
OADC1_PSEPW     VEEGVGKIRAALEARVDSSLSIIARTNAGVL--STEEIIVRTQSYQKAGADAI-----------------
OADC_RHOPS      REEGLGKIKAALDARLDPSLVIVGRTGA-CAITSLDDAIDRAVAYQAAGVDAL-----------------
OADC_PSEPG      VEEGVGKIRAALEARVDSSLSIIARTNAGVL--STEEIIVRTQSYQKAGADAI-----------------
OADC_PSEE4      VEEGVGKIRAALEARVDSALAIIARTNAGVL--TTEEIIVRTQSYQKAGADGI-----------------
OADC_PSEPK      VEEGVGKIRAALEARVDSSLSIIARTNAGVL--STEEIIVRTQSYQKAGADGI-----------------
OADC_PSEP1      VEEGVGKIRAALEARVDSSLSIIARTNAGVL--STEEIIVRTQSYQKAGADGI-----------------
OADC_RHOP2      SEEGLGKINAALDARLDPSLVIIGRTGACSIS-SLDDAIERAVAYEAAGVDA-LFFTGVKARDQLQAISA
OADC_PSEMY      IEEGVGKILAALEARVDPELSIIARTHAGVL--EVDEVIRRTRAYEAAGADGICL---------------
OADC_BURXL      FDXXXXXXXXXXXXXGDSDLLVLGRTSAATLN-GIEDAVARFKAFEAAGVDAIFL---------------
OADC_PSEF5      VAEGVGKIRAALEARVDPELAIIARTNAGIL--PVQEIISRTQQYERAGADAI-----------------
PRPB_SALTY      KEEMVDRIRAAVDARTDPNFVIMARTDAL-AVEGLEAALDRAQAYVDAGAD-MLFPEAITELSMYRRFAD
OADC2_PSEPW     EEEAAAKIYAARFSRSDDSLSIIARTN--VAATTLEDSIARTAAYEKAGADAICL---------------
OADC_AZOVD      LDEAVGKIRAALEARIDPQLSIIARTNA--EQLSVEETIGRAKAYQAAGADGI-----------------
PRPB_ECOLI      KEEMVDRIRAAVDAKTDPDFVIMARTDAL-AVEGLDAAIERAQAYVEAGAE-MLFPEAITELAMYRQFAD
OADC_CHRSD      LDEGVGKMRAALEARIDPAMAIIARTNA--GQLDDEAAVERVCAYQAAGVDAICL---------------
OADC_PSE14      TAEGVGKIRAALEARVDPEMSIFARTNAAII--PVQEAISRVQQYQAAGADGITI---------------
OADC_PSEU2      TAEGVGKIRAALEARVDPEMSIFARTNAAII--PVQEAISRVQQYQAAGADGITI---------------
OADC_PSEFS      IEEGIGKVRAALEARVDPELSIIARTNAGVL--PTEAVIERTLAYQKAGADGICMVG-VADFEHLEQIAE
OADC1_PSEPF     VAEGVGKIRAALEARVDSEMAIIARTNAGIL--PNQEIISRTKQYQAAGADGI-----------------
OADC_PSESM      TAEGVGKIRAALEARVDPEMSIFARTNAAII--PVQEAISRVQQYQAAGADGITI---------------
OADC_PSEAE      VEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGICL---------------
OADC_PSEAB      VEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGICL---------------
OADC_PSEA8      VEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGICL---------------
OADC_PSEA7      VEEGVGKIRAALEARVDPALTIIARTNAELI--DVDAVIQRTLAYQEAGADGICL---------------
OADC_MARMS      VEEAVGKLKAALEARIDPIMSIIARTNA--GQLSTEETISRVKAYQAVGVDGI-----------------
OADC_RHOPA      REEGLGKIKAALDARRDPNLVIIGRTGA-CSITSLDDAIERALAYQAAGVDALFFTGVKTRA--------
OADC_RHOPT      REEGLGKITAALDARRDPNLVIIGRTGA-CSITSLDDAIERALAYQAAGVDALFFTGVKTRA--------
OADC2_PSEPF     XXXXXXXXXXXXXXXSDDALSIIARTN--VAVTTLDDSIARTAAYQKAGADAICL---------------
GLMU_DEIRA      ----------------------------------------------------------------------
GLMU_METVS      ----------------------------------------------------------------------
GLMU_METM5      ----------------------------------------------------------------------
GLMU_KOSOT      ----------------------------------------------------------------------
GLMU_DECAR      ----------------------------------------------------------------------
GLMU_METJA      ----------------------------------------------------------------------
GLMU_DEIGD      ----------------------------------------------------------------------
GLMU_BURPS      ----------------------------------------------------------------------
GLMU_BURP6      ----------------------------------------------------------------------
GLMU_BURP1      ----------------------------------------------------------------------
GLMU_BURP0      ----------------------------------------------------------------------
GLMU_BURMS      ----------------------------------------------------------------------
GLMU_BURMA      ----------------------------------------------------------------------
GLMU_BURM7      ----------------------------------------------------------------------
GLMU_STRMK      ----------------------------------------------------------------------
GLMU_SYMTH      ----------------------------------------------------------------------
GLMU_BLOPB      ----------------------------------------------------------------------
GLMU_CELJU      ----------------------------------------------------------------------
GLMU_XANCB      ----------------------------------------------------------------------
GLMU_ACHLI      ----------------------------------------------------------------------
GLMU_RHIE6      ----------------------------------------------------------------------
GLMU_METM7      ----------------------------------------------------------------------
GLMU_STRM5      ----------------------------------------------------------------------
GLMU_BURPP      ----------------------------------------------------------------------
GLMU_XYLFM      ----------------------------------------------------------------------
GLMU_XYLFA      ----------------------------------------------------------------------
GLMU_XYLFT      ----------------------------------------------------------------------
GLMU_XYLF2      ----------------------------------------------------------------------
GLMU_VIBCM      ----------------------------------------------------------------------
GLMU_VIBCH      ----------------------------------------------------------------------
GLMU_VIBC3      ----------------------------------------------------------------------
GLMU_TOLAT      ----------------------------------------------------------------------
GLMU_HALHL      ----------------------------------------------------------------------
GLMU_XANOR      ----------------------------------------------------------------------
GLMU_METMP      ----------------------------------------------------------------------
GLMU_CLOTH      ----------------------------------------------------------------------
GLMU_VIBFM      ----------------------------------------------------------------------
GLMU_VIBF1      ----------------------------------------------------------------------
GLMU_RHIEC      ----------------------------------------------------------------------
GLMU_RALEJ      ----------------------------------------------------------------------
GLMU_AZOSB      ----------------------------------------------------------------------
GLMU_ALISL      ----------------------------------------------------------------------
GLMU_XANOM      ----------------------------------------------------------------------
GLMU_RHILW      ----------------------------------------------------------------------
GLMU_MARAV      ----------------------------------------------------------------------
GLMU_GEOLS      ----------------------------------------------------------------------
GLMU_VIBVY      ----------------------------------------------------------------------
GLMU_VIBVU      ----------------------------------------------------------------------
GLMU_GLUDA      ----------------------------------------------------------------------
GLMU_BURP8      ----------------------------------------------------------------------
GLMU_AERHH      ----------------------------------------------------------------------
GLMU_JANMA      ----------------------------------------------------------------------
GLMU_EDWI9      ----------------------------------------------------------------------
GLMU_BURXL      ----------------------------------------------------------------------
GLMU_BURCH      ----------------------------------------------------------------------
GLMU_BURCA      ----------------------------------------------------------------------
GLMU_SHEAM      ----------------------------------------------------------------------
GLMU_ENTS8      ----------------------------------------------------------------------
GLMU_THISH      ----------------------------------------------------------------------
GLMU_SACD2      ----------------------------------------------------------------------
GLMU_HERAR      ----------------------------------------------------------------------
GLMU_THETN      ----------------------------------------------------------------------
GLMU_SPHWW      ----------------------------------------------------------------------
GLMU_SODGM      ----------------------------------------------------------------------
GLMU_SHEHH      ----------------------------------------------------------------------
GLMU_RHIL3      ----------------------------------------------------------------------
GLMU_PELCD      ----------------------------------------------------------------------
GLMU_BURTA      ----------------------------------------------------------------------
GLMU_ZYMMO      ----------------------------------------------------------------------
GLMU_SPHAL      ----------------------------------------------------------------------
GLMU_PHOPR      ----------------------------------------------------------------------
GLMU_HAHCH      ----------------------------------------------------------------------
GLMU_FERNB      ----------------------------------------------------------------------
GLMU_THEAB      ----------------------------------------------------------------------
GLMU_SERP5      ----------------------------------------------------------------------
GLMU_NITEU      ----------------------------------------------------------------------
GLMU_GEOSF      ----------------------------------------------------------------------
GLMU_ERWT9      ----------------------------------------------------------------------
GLMU_CLOTE      ----------------------------------------------------------------------
GLMU_BURA4      ----------------------------------------------------------------------
GLMU_BORA1      ----------------------------------------------------------------------
GLMU_AQUAE      ----------------------------------------------------------------------
GLMU_YERE8      ----------------------------------------------------------------------
GLMU_XANAC      ----------------------------------------------------------------------
GLMU_SYNWW      ----------------------------------------------------------------------
GLMU_DESAP      ----------------------------------------------------------------------
GLMU_BREBN      ----------------------------------------------------------------------
GMPPB_CAEEL     ----------------------------------------------------------------------
GLMU_XANC5      ----------------------------------------------------------------------
GLMU_STAES      ----------------------------------------------------------------------
GLMU_STAEQ      ----------------------------------------------------------------------
GLMU_STAEP      ----------------------------------------------------------------------
GLMU_SHESA      ----------------------------------------------------------------------
GLMU_RALME      ----------------------------------------------------------------------
GLMU_MANSM      ----------------------------------------------------------------------
GLMU_BURM1      ----------------------------------------------------------------------
Y1334_METJA     ----------------------------------------------------------------------
GLMU_SHEWM      ----------------------------------------------------------------------
GLMU_SHEPA      ----------------------------------------------------------------------
GLMU_SHEDO      ----------------------------------------------------------------------
GLMU_PROAC      ----------------------------------------------------------------------
GLMU_HAES1      ----------------------------------------------------------------------
STRD_STRGR      ----------------------------------------------------------------------
GLMU_YERPY      ----------------------------------------------------------------------
GLMU_YERPS      ----------------------------------------------------------------------
GLMU_YERPP      ----------------------------------------------------------------------
GLMU_YERPN      ----------------------------------------------------------------------
GLMU_YERPE      ----------------------------------------------------------------------
GLMU_YERPB      ----------------------------------------------------------------------
GLMU_YERPA      ----------------------------------------------------------------------
GLMU_YERP3      ----------------------------------------------------------------------
GLMU_SHEPW      ----------------------------------------------------------------------
GLMU_META3      ----------------------------------------------------------------------
GLMU_HAES2      ----------------------------------------------------------------------
GLMU_CHRVO      ----------------------------------------------------------------------
GLMU_BORPD      ----------------------------------------------------------------------
GLMU_STAHJ      ----------------------------------------------------------------------
GLMU_SHESH      ----------------------------------------------------------------------
GLMU_ROSDO      ----------------------------------------------------------------------
GLMU_PSYA2      ----------------------------------------------------------------------
GLMU_PSEA6      ----------------------------------------------------------------------
GLMU_GEOSL      ----------------------------------------------------------------------
GMPPB_CAEBR     ----------------------------------------------------------------------
GLMU_SHEFN      ----------------------------------------------------------------------
GLMU_PSYIN      ----------------------------------------------------------------------
GLMU_PECCP      ----------------------------------------------------------------------
GLMU_HAEPS      ----------------------------------------------------------------------
GLMU_THESQ      ----------------------------------------------------------------------
GLMU_THEP1      ----------------------------------------------------------------------
GLMU_PSE14      ----------------------------------------------------------------------
GLMU_ERWCT      ----------------------------------------------------------------------
GLMU_BORPE      ----------------------------------------------------------------------
GLMU_BORPA      ----------------------------------------------------------------------
GLMU_BORBR      ----------------------------------------------------------------------
GLMU_OCEIH      ----------------------------------------------------------------------
GLMU_GEOUR      ----------------------------------------------------------------------
GLMU_FRAP2      ----------------------------------------------------------------------
GLMU_CLOK5      ----------------------------------------------------------------------
GLMU_CLOK1      ----------------------------------------------------------------------
GLMU_CLOD6      ----------------------------------------------------------------------
GTAB_STAHJ      ----------------------------------------------------------------------
GLMU_THEMA      ----------------------------------------------------------------------
GLMU_STAAW      ----------------------------------------------------------------------
GLMU_STAAS      ----------------------------------------------------------------------
GLMU_STAAR      ----------------------------------------------------------------------
GLMU_STAAN      ----------------------------------------------------------------------
GLMU_STAAM      ----------------------------------------------------------------------
GLMU_STAAC      ----------------------------------------------------------------------
GLMU_STAAB      ----------------------------------------------------------------------
GLMU_STAA3      ----------------------------------------------------------------------
GLMU_SHESW      ----------------------------------------------------------------------
GLMU_SHEPC      ----------------------------------------------------------------------
GLMU_SHELP      ----------------------------------------------------------------------
GLMU_PASMU      ----------------------------------------------------------------------
GLMU_NOVAD      ----------------------------------------------------------------------
GLMU_HAEIN      ----------------------------------------------------------------------
GLMU_GEOMG      ----------------------------------------------------------------------
GLMU_DESVV      ----------------------------------------------------------------------
GLMU_DESVH      ----------------------------------------------------------------------
GLMU_COXBN      ----------------------------------------------------------------------
GALU_MYCPN      ----------------------------------------------------------------------
GTAB_BACSU      ----------------------------------------------------------------------
GTAB2_STAS1     ----------------------------------------------------------------------
GLMU_PSEU2      ----------------------------------------------------------------------
GLMU_PSEMY      ----------------------------------------------------------------------
GLMU_PSEAE      ----------------------------------------------------------------------
GLMU_PSEAB      ----------------------------------------------------------------------
GLMU_PSEA8      ----------------------------------------------------------------------
GLMU_PSEA7      ----------------------------------------------------------------------
GLMU_NITEC      ----------------------------------------------------------------------
GLMU_COLP3      ----------------------------------------------------------------------
GLMU_ALCBS      ----------------------------------------------------------------------
GLMU_ACTSZ      ----------------------------------------------------------------------
RFBF_SALTY      ----------------------------------------------------------------------
GLMU_SHESM      ----------------------------------------------------------------------
GLMU_METFK      ----------------------------------------------------------------------
GLMU_HAEI8      ----------------------------------------------------------------------
GLMU_COXB1      ----------------------------------------------------------------------
GLMU_CLONN      ----------------------------------------------------------------------
GLMU_STAA8      ----------------------------------------------------------------------
GLMU_PSEF5      ----------------------------------------------------------------------
GLMU_HAEIG      ----------------------------------------------------------------------
GLMU_HAEIE      ----------------------------------------------------------------------
GLMU_HAEDU      ----------------------------------------------------------------------
GLMU_COXB2      ----------------------------------------------------------------------
GLMU_CLOBB      ----------------------------------------------------------------------
GLMU_CLOBA      ----------------------------------------------------------------------
GLMU_ACISJ      ----------------------------------------------------------------------
GTAB1_STAS1     ----------------------------------------------------------------------
GLMU_SHESR      ----------------------------------------------------------------------
GLMU_SHEB5      ----------------------------------------------------------------------
GLMU_SALTY      ----------------------------------------------------------------------
GLMU_SALTI      ----------------------------------------------------------------------
GLMU_SALSV      ----------------------------------------------------------------------
GLMU_SALPK      ----------------------------------------------------------------------
GLMU_SALPB      ----------------------------------------------------------------------
GLMU_SALPA      ----------------------------------------------------------------------
GLMU_SALNS      ----------------------------------------------------------------------
GLMU_SALHS      ----------------------------------------------------------------------
GLMU_SALG2      ----------------------------------------------------------------------
GLMU_SALEP      ----------------------------------------------------------------------
GLMU_SALDC      ----------------------------------------------------------------------
GLMU_SALCH      ----------------------------------------------------------------------
GLMU_SALA4      ----------------------------------------------------------------------
GLMU_DESVM      ----------------------------------------------------------------------
GLMU_DESDG      ----------------------------------------------------------------------
GLMU_CHRSD      ----------------------------------------------------------------------
ISPD_BIFLD      ----------------------------------------------------------------------
GLMU_THEM4      ----------------------------------------------------------------------
GLMU_SHEB8      ----------------------------------------------------------------------
GLMU_SHEB2      ----------------------------------------------------------------------
GLMU_PHOLL      ----------------------------------------------------------------------
GLMU_MAGSA      ----------------------------------------------------------------------
GLMU_EXISA      ----------------------------------------------------------------------
GLMU_COXBU      ----------------------------------------------------------------------
GLMU_COXBR      ----------------------------------------------------------------------
GLMU_CLOPS      ----------------------------------------------------------------------
GLMU_AZOVD      ----------------------------------------------------------------------
GLGC_KOCRD      ----------------------------------------------------------------------
MPG1_SULAC      ----------------------------------------------------------------------
LICC_HAEIN      ----------------------------------------------------------------------
ISPD_BIFLO      ----------------------------------------------------------------------
ISPD_BIFLI      ----------------------------------------------------------------------
GLMU_VIBPA      ----------------------------------------------------------------------
GLMU_THEP3      ----------------------------------------------------------------------
GLMU_STAS1      ----------------------------------------------------------------------
GLMU_SHEB9      ----------------------------------------------------------------------
GLMU_EXIS2      ----------------------------------------------------------------------
GLMU_CLOP1      ----------------------------------------------------------------------
GLMU_AZOSE      ----------------------------------------------------------------------
GLMU_PSESM      ----------------------------------------------------------------------
GLMU_PSEPK      ----------------------------------------------------------------------
GLMU_PSEPG      ----------------------------------------------------------------------
GLMU_GEOSW      ----------------------------------------------------------------------
GLMU_CYAP7      ----------------------------------------------------------------------
GLMU_CLOPE      ----------------------------------------------------------------------
GLGC_CORGL      ----------------------------------------------------------------------
GLGC_CORGB      ----------------------------------------------------------------------
GLGC_CORA7      ----------------------------------------------------------------------
GALU2_PSEAE     ----------------------------------------------------------------------
EI2BG_HUMAN     ----------------------------------------------------------------------
GLMU_SHEON      ----------------------------------------------------------------------
GLMU_PSEE4      ----------------------------------------------------------------------
GLMU_PROM0      ----------------------------------------------------------------------
GLMU_PARL1      ----------------------------------------------------------------------
GLMU_MARMM      ----------------------------------------------------------------------
GLMU_GEOTN      ----------------------------------------------------------------------
GLMU_CALS8      ----------------------------------------------------------------------
GLMU_ACTPJ      ----------------------------------------------------------------------
GLMU_ACTP7      ----------------------------------------------------------------------
GLMU_ACTP2      ----------------------------------------------------------------------
GLGC_RHOBA      ----------------------------------------------------------------------
GLGC_ANADF      ----------------------------------------------------------------------
ACEA_KLULA      VQEHINRLITCRMAALGSDLILVARTDSEAATLLSSTADSR-DHYFILGASNPAVKGKLNKADDLQTIEK
GLMU_VIBHB      ----------------------------------------------------------------------
GLMU_PSEP1      ----------------------------------------------------------------------
GLMU_PROM9      ----------------------------------------------------------------------
GLMU_KLEP7      ----------------------------------------------------------------------
GLMU_KLEP3      ----------------------------------------------------------------------
GLMU_DESHY      ----------------------------------------------------------------------
GLGC_PROAC      ----------------------------------------------------------------------
GLGC_COREF      ----------------------------------------------------------------------
GALU_MYCGE      ----------------------------------------------------------------------
ACEA_EMENI      ISEHINRLVAIR-AQADTDLLAIARTDS------------------------------------------
YTDA_BACSU      ----------------------------------------------------------------------
MPG1_PICAN      ----------------------------------------------------------------------
GLMU_PSYCK      ----------------------------------------------------------------------
GLMU_PROMS      ----------------------------------------------------------------------
GLMU_NITOC      ----------------------------------------------------------------------
GLMU_LISMH      ----------------------------------------------------------------------
GLMU_LISMF      ----------------------------------------------------------------------
GLMU_LISMC      ----------------------------------------------------------------------
GLMU_DESHD      ----------------------------------------------------------------------
GLMU_CLOBM      ----------------------------------------------------------------------
GLMU_CLOB6      ----------------------------------------------------------------------
GLMU_CLOAB      ----------------------------------------------------------------------
GLMU_ACIBY      ----------------------------------------------------------------------
GLMU_ACIBC      ----------------------------------------------------------------------
GLGC_DECAR      ----------------------------------------------------------------------
GLGC_CORDI      ----------------------------------------------------------------------
GLGC_ANASK      ----------------------------------------------------------------------
GLGC_ANADE      ----------------------------------------------------------------------
GLGC_ANAD2      ----------------------------------------------------------------------
GALF_SALTY      ----------------------------------------------------------------------
GALF_SALTI      ----------------------------------------------------------------------
GALF_KLEPN      ----------------------------------------------------------------------
CAP4C_STRPN     ----------------------------------------------------------------------
ACEA_COCIM      ISEHINRLVAIR-AQADTDLLAIARTDS------------------------------------------
GLMU_STRMU      ----------------------------------------------------------------------
GLMU_SHISS      ----------------------------------------------------------------------
GLMU_SHIFL      ----------------------------------------------------------------------
GLMU_SHIF8      ----------------------------------------------------------------------
GLMU_SHIDS      ----------------------------------------------------------------------
GLMU_SHIBS      ----------------------------------------------------------------------
GLMU_SHIB3      ----------------------------------------------------------------------
GLMU_PSYWF      ----------------------------------------------------------------------
GLMU_OCHA4      ----------------------------------------------------------------------
GLMU_LEGPH      ----------------------------------------------------------------------
GLMU_ESCF3      ----------------------------------------------------------------------
GLMU_ENT38      ----------------------------------------------------------------------
GLMU_ECOUT      ----------------------------------------------------------------------
GLMU_ECOSM      ----------------------------------------------------------------------
GLMU_ECOSE      ----------------------------------------------------------------------
GLMU_ECOLU      ----------------------------------------------------------------------
GLMU_ECOLI      ----------------------------------------------------------------------
GLMU_ECOLC      ----------------------------------------------------------------------
GLMU_ECOL6      ----------------------------------------------------------------------
GLMU_ECOL5      ----------------------------------------------------------------------
GLMU_ECOK1      ----------------------------------------------------------------------
GLMU_ECOHS      ----------------------------------------------------------------------
GLMU_ECODH      ----------------------------------------------------------------------
GLMU_ECOBW      ----------------------------------------------------------------------
GLMU_ECO8A      ----------------------------------------------------------------------
GLMU_ECO81      ----------------------------------------------------------------------
GLMU_ECO7I      ----------------------------------------------------------------------
GLMU_ECO5E      ----------------------------------------------------------------------
GLMU_ECO57      ----------------------------------------------------------------------
GLMU_ECO55      ----------------------------------------------------------------------
GLMU_ECO45      ----------------------------------------------------------------------
GLMU_ECO27      ----------------------------------------------------------------------
GLMU_ECO24      ----------------------------------------------------------------------
GLMU_CLOBL      ----------------------------------------------------------------------
GLMU_CLOBK      ----------------------------------------------------------------------
GLMU_CLOBH      ----------------------------------------------------------------------
GLMU_CLOB1      ----------------------------------------------------------------------
GLMU_BIFAA      ----------------------------------------------------------------------
GLMU_BACHK      ----------------------------------------------------------------------
GLMU_BACCZ      ----------------------------------------------------------------------
GLMU_BACCR      ----------------------------------------------------------------------
GLMU_BACCQ      ----------------------------------------------------------------------
GLMU_BACCN      ----------------------------------------------------------------------
GLMU_BACC7      ----------------------------------------------------------------------
GLMU_BACC4      ----------------------------------------------------------------------
GLMU_BACC3      ----------------------------------------------------------------------
GLMU_BACC2      ----------------------------------------------------------------------
GLMU_BACC1      ----------------------------------------------------------------------
GLMU_BACC0      ----------------------------------------------------------------------
GLMU_BACAN      ----------------------------------------------------------------------
GLMU_BACAH      ----------------------------------------------------------------------
GLMU_BACAC      ----------------------------------------------------------------------
GLMU_BACAA      ----------------------------------------------------------------------
GLMU_ACIBS      ----------------------------------------------------------------------
GALF_SHIFL      ----------------------------------------------------------------------
GALF_ECOLI      ----------------------------------------------------------------------
GALF_ECO57      ----------------------------------------------------------------------
EI2BG_RAT       ----------------------------------------------------------------------
EI2BG_MACFA     ----------------------------------------------------------------------
GLMU_THIDA      ----------------------------------------------------------------------
GLMU_THELT      ----------------------------------------------------------------------
GLMU_RHISN      ----------------------------------------------------------------------
GLMU_PSEHT      ----------------------------------------------------------------------
GLMU_PROM2      ----------------------------------------------------------------------
GLMU_MYXXD      ----------------------------------------------------------------------
GLMU_HELMI      ----------------------------------------------------------------------
GLMU_CAUCR      ----------------------------------------------------------------------
GLMU_CAUCN      ----------------------------------------------------------------------
GLMU_BDEBA      ----------------------------------------------------------------------
GLMU_ACIAC      ----------------------------------------------------------------------
EXON_RHIME      ----------------------------------------------------------------------
ACEA_PENMA      ISEHINRLVAIR-AQADTDLLAIARTDS------------------------------------------
ACEA_NEUCR      IQEHINRLVAIR-AQADSDLLCIARTDA------------------------------------------
GLMU_NEIMF      ----------------------------------------------------------------------
GLMU_NEIM0      ----------------------------------------------------------------------
GLMU_LISMO      ----------------------------------------------------------------------
GLMU_DIAST      ----------------------------------------------------------------------
GLMU_BACSK      ----------------------------------------------------------------------
GLGC_METCA      ----------------------------------------------------------------------
EI2BG_BOVIN     ----------------------------------------------------------------------
ACEA_GIBZE      IQEHINRLVAIR-AQADSDLLAIARTDA------------------------------------------
ACEA_ASPFU      ISEHINRLVAIR-AQADTDLLAIARTDS------------------------------------------
GMPPB_DROPS     ----------------------------------------------------------------------
GLMU_RHOFD      ----------------------------------------------------------------------
GLMU_PSEU5      ----------------------------------------------------------------------
GLMU_PROMP      ----------------------------------------------------------------------
GLMU_PROMH      ----------------------------------------------------------------------
GLMU_LISW6      ----------------------------------------------------------------------
GLGC_MYXXD      ----------------------------------------------------------------------
ISPD_NOCFA      ----------------------------------------------------------------------
GTAB_STAES      ----------------------------------------------------------------------
GTAB_STAEQ      ----------------------------------------------------------------------
GLMU_NITMU      ----------------------------------------------------------------------
GLMU_NEIMB      ----------------------------------------------------------------------
GLMU_LACLS      ----------------------------------------------------------------------
GLMU_LACLM      ----------------------------------------------------------------------
GLMU_LACLA      ----------------------------------------------------------------------
GLMU_CLOBJ      ----------------------------------------------------------------------
GLMU_BRUSU      ----------------------------------------------------------------------
GLMU_BRUSI      ----------------------------------------------------------------------
GLMU_BRUME      ----------------------------------------------------------------------
GLMU_BRUMB      ----------------------------------------------------------------------
GLMU_BRUC2      ----------------------------------------------------------------------
GLMU_BRUAB      ----------------------------------------------------------------------
GLMU_BRUA2      ----------------------------------------------------------------------
GLMU_BRUA1      ----------------------------------------------------------------------
GLMU_AGRRK      ----------------------------------------------------------------------
GLMU_ACIF5      ----------------------------------------------------------------------
GLMU_ACIF2      ----------------------------------------------------------------------
ACEA_MAGGR      ISEHINRLVAIR-AQADVDLLAIARTDA------------------------------------------
HASC_STRPY      ----------------------------------------------------------------------
HASC2_STRP8     ----------------------------------------------------------------------
HASC2_STRP6     ----------------------------------------------------------------------
HASC2_STRP3     ----------------------------------------------------------------------
HASC2_STRP1     ----------------------------------------------------------------------
HASC1_STRP8     ----------------------------------------------------------------------
HASC1_STRP6     ----------------------------------------------------------------------
HASC1_STRP3     ----------------------------------------------------------------------
HASC1_STRP1     ----------------------------------------------------------------------
GTAB_STAAW      ----------------------------------------------------------------------
GTAB_STAAS      ----------------------------------------------------------------------
GTAB_STAAN      ----------------------------------------------------------------------
GTAB_STAAM      ----------------------------------------------------------------------
GTAB_STAAC      ----------------------------------------------------------------------
GTAB_STAAB      ----------------------------------------------------------------------
GTAB_STAA8      ----------------------------------------------------------------------
GTAB_STAA3      ----------------------------------------------------------------------
GLMU_SULNB      ----------------------------------------------------------------------
GLMU_PSEFS      ----------------------------------------------------------------------
GLMU_LISIN      ----------------------------------------------------------------------
GLMU_LEGPL      ----------------------------------------------------------------------
GLMU_LEGPC      ----------------------------------------------------------------------
GLMU_LEGPA      ----------------------------------------------------------------------
GLMU_HYPNA      ----------------------------------------------------------------------
GLMU_BACWK      ----------------------------------------------------------------------
GLMU_AGRVS      ----------------------------------------------------------------------
GLGC_NITOC      ----------------------------------------------------------------------
GLGC_NITEU      ----------------------------------------------------------------------
GLGC2_VIBPA     ----------------------------------------------------------------------
GALU_PSEAE      ----------------------------------------------------------------------
CAP3C_STRPN     ----------------------------------------------------------------------
ACEA_LEPMC      ISEHINRLVAIR-AQADTDLLAVARTDS------------------------------------------
SPSI_BACSU      ----------------------------------------------------------------------
GTAB_STAAR      ----------------------------------------------------------------------
GMPPB_HUMAN     ----------------------------------------------------------------------
GMPPB_DICDI     ----------------------------------------------------------------------
GLMU_ENTFA      ----------------------------------------------------------------------
GLMU_BARHE      ----------------------------------------------------------------------
GLMU_ALTMD      ----------------------------------------------------------------------
GLGC_ARTAT      ----------------------------------------------------------------------
ACEA_YARLI      ----------------------------------------------------------------------
ACEA_PICPA      VQEHINRLVAIRTSAFQSDLIAVARTDS------------------------------------------
ACEA_DEBHA      ----------------------------------------------------------------------
ACEA_COPCI      ----------------------------------------------------------------------
ACEA_COPC7      ----------------------------------------------------------------------
MOBA_YERPP      ----------------------------------------------------------------------
MOBA_YERPN      ----------------------------------------------------------------------
MOBA_YERPG      ----------------------------------------------------------------------
MOBA_YERPE      ----------------------------------------------------------------------
MOBA_YERPB      ----------------------------------------------------------------------
MOBA_YERPA      ----------------------------------------------------------------------
ISPD_SYNSC      ----------------------------------------------------------------------
GMPPB_MOUSE     ----------------------------------------------------------------------
GMPPB_DROME     ----------------------------------------------------------------------
GLMU_STRGC      ----------------------------------------------------------------------
GLMU_SALAR      ----------------------------------------------------------------------
GLMU_RHOS5      ----------------------------------------------------------------------
GLMU_RHIME      ----------------------------------------------------------------------
GLMU_PSEPF      ----------------------------------------------------------------------
GLMU_PELPD      ----------------------------------------------------------------------
GLMU_NITHX      ----------------------------------------------------------------------
GLMU_LACDB      ----------------------------------------------------------------------
GLMU_GRABC      ----------------------------------------------------------------------
GLMU_BIFLO      ----------------------------------------------------------------------
GLMU_BIFLI      ----------------------------------------------------------------------
GLMU_BACME      ----------------------------------------------------------------------
GLMU_BACHD      ----------------------------------------------------------------------
GLMU_ACIAD      ----------------------------------------------------------------------
GLGC_GEOMG      ----------------------------------------------------------------------
EI2BE_MOUSE     ----------------------------------------------------------------------
ACEA_CANAL      ----------------------------------------------------------------------
SPLE_STAAU      -KDYTGILKIASEAKENERISIVGYPEPYINKFQMYES--------------------------------
MOBA_YERPY      ----------------------------------------------------------------------
MOBA_YERP3      ----------------------------------------------------------------------
ISPD_PROMM      ----------------------------------------------------------------------
GLMU_WIGBR      ----------------------------------------------------------------------
GLMU_SYNS3      ----------------------------------------------------------------------
GLMU_RALPJ      ----------------------------------------------------------------------
GLMU_NEIGO      ----------------------------------------------------------------------
GLMU_NEIG1      ----------------------------------------------------------------------
GLMU_METPP      ----------------------------------------------------------------------
GLMU_CITK8      ----------------------------------------------------------------------
GLMU_BUCAP      ----------------------------------------------------------------------
GLMU_BIFLD      ----------------------------------------------------------------------
GLMU_BACLD      ----------------------------------------------------------------------
GLGC_NITMU      ----------------------------------------------------------------------
GLGC_LEIXX      ----------------------------------------------------------------------
GLGC_DEIDV      ----------------------------------------------------------------------
EI2BE_RABIT     ----------------------------------------------------------------------
ACEA_PICJA      ----------------------------------------------------------------------
ACEA_CANTR      ----------------------------------------------------------------------
GMPPB_XENTR     ----------------------------------------------------------------------
GLMU_STRPG      ----------------------------------------------------------------------
GLMU_STRPF      ----------------------------------------------------------------------
GLMU_STRPC      ----------------------------------------------------------------------
GLMU_STRPB      ----------------------------------------------------------------------
GLMU_STRP6      ----------------------------------------------------------------------
GLMU_STRP3      ----------------------------------------------------------------------
GLMU_LAWIP      ----------------------------------------------------------------------
GLMU_BAUCH      ----------------------------------------------------------------------
GLMU_ANAVT      ----------------------------------------------------------------------
GLGC_RHOE4      ----------------------------------------------------------------------
GLGC_MAGSA      ----------------------------------------------------------------------
GLGC_JANSC      ----------------------------------------------------------------------
GLGC_DEIGD      ----------------------------------------------------------------------
GLGC_CORJK      ----------------------------------------------------------------------
GLGC_ARTCA      ----------------------------------------------------------------------
ACEA_MYCLE      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAASSMQAVAREIHDSQTLVNVEDRIATVNE
PEPM_MYTED      AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
PEPM_TETPY      EWKNRSPVIIVPTNYHTVPTDTFRKWGVNMVIWANHNMRACVSAMQETSRRIYEDESLVNVEPKVAKVKE
PEPM_STRVR      QWDGSAPILIAPTTYHRPSLDDFAALGIAGCIWANHSMRAAFSAMRDVCQQIRADRGIFGVEERVAPLKE
PEPM_STRHY      RWEGSTPVLIAPTTYHTPSVDDFAALGIAGCIWANHSMRAAFAAMRDVCQRIRTDRGIYGIEDQVAPLKE
CPPM_STRHY      EI--DAPLLANMVEGGKTPTKELESIGYNLAIYPLSGWMAAASVLRKLFTELREAGTTQKFWDDMGLKMS
PRPB_BACHD      NVS--APLLANMTEFGKTPAGGLQNAGFQMVIYPVTSLRVAAKAYERIFQLIKDEGTQEAGIEDMQTRKE
PRPB2_CORGL     RAAVDIPLLANMTEFGKTPAQLLEDIGYNAVIYPVTLLRIAMGQVEQALGDIANTGIQTDWVDRMQHRSR
PRPB_AERPE      R--VKAPLLANMTEFGKTPVDQFREAGYKIVIFPVTTFRASLKASETVLREIMEKGTQKDILDKLYTRTE
PRPB_BACSU      RIP--VPLLANMTEFGKTPADEFEDMGFHMVIYPVTSLRAAAKACERMKEGLHDMQTRKELYDTIS----
PRPB1_CORGL     HAIPDALLLANMTEFGKTSADVLEEIGYNAVIYPVTTLRIAMGQVEQALAEIKEHGTQEGWLDRMQHRSR
OADC_RHOPB      ----------------------------------------------------------------------
CPPM_ARATH      RTKGYRVCNMIEGGVTPLHTDELKEMGFHLIVHPLTALYASTRALVDVLKTLKENGSTRDHLQKMATFEE
OADC_RHOP5      ----------------------------------------------------------------------
OADC_BRAJA      ----------------------------------------------------------------------
OADC_PSEU5      ----------------------------------------------------------------------
OADC_BRASO      --ATNLPIVL------------------------------------------------------------
OADC_BRASB      --ATTLPIVL------------------------------------------------------------
PRPB_VIBCH      SATGKVPILANITEFGQTPLEQLAAVNVDMVLYPLSAFRAMNKAAENVYRHL------------------
PDP_DIACA       KTKGRIANMIEGGKTPLHTPEEFKEMGFHLIAHSLTAVYATARALVNIMKILKEKGTTRDDLDQMATFSE
OADC1_PSEPW     ----------------------------------------------------------------------
OADC_RHOPS      ----------------------------------------------------------------------
OADC_PSEPG      ----------------------------------------------------------------------
OADC_PSEE4      ----------------------------------------------------------------------
OADC_PSEPK      ----------------------------------------------------------------------
OADC_PSEP1      ----------------------------------------------------------------------
OADC_RHOP2      --ATRLPIVL------------------------------------------------------------
OADC_PSEMY      ----------------------------------------------------------------------
OADC_BURXL      ----------------------------------------------------------------------
OADC_PSEF5      ----------------------------------------------------------------------
PRPB_SALTY      --VAQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEKVYTVLRQEGTQKNVIDIMQTRNE
OADC2_PSEPW     ----------------------------------------------------------------------
OADC_AZOVD      ----------------------------------------------------------------------
PRPB_ECOLI      --AVQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNE
OADC_CHRSD      ----------------------------------------------------------------------
OADC_PSE14      ----------------------------------------------------------------------
OADC_PSEU2      ----------------------------------------------------------------------
OADC_PSEFS      NLT--VPLMLVT---YGNPNDAKRLASLGVVVVAGHAIKATYDSLRAQRQLTHSTDNLSATE--------
OADC1_PSEPF     ----------------------------------------------------------------------
OADC_PSESM      ----------------------------------------------------------------------
OADC_PSEAE      ----------------------------------------------------------------------
OADC_PSEAB      ----------------------------------------------------------------------
OADC_PSEA8      ----------------------------------------------------------------------
OADC_PSEA7      ----------------------------------------------------------------------
OADC_MARMS      ----------------------------------------------------------------------
OADC_RHOPA      ----------------------------------------------------------------------
OADC_RHOPT      ----------------------------------------------------------------------
OADC2_PSEPF     ----------------------------------------------------------------------
GLMU_DEIRA      ----------------------------------------------------------------------
GLMU_METVS      ----------------------------------------------------------------------
GLMU_METM5      ----------------------------------------------------------------------
GLMU_KOSOT      ----------------------------------------------------------------------
GLMU_DECAR      ----------------------------------------------------------------------
GLMU_METJA      ----------------------------------------------------------------------
GLMU_DEIGD      ----------------------------------------------------------------------
GLMU_BURPS      ----------------------------------------------------------------------
GLMU_BURP6      ----------------------------------------------------------------------
GLMU_BURP1      ----------------------------------------------------------------------
GLMU_BURP0      ----------------------------------------------------------------------
GLMU_BURMS      ----------------------------------------------------------------------
GLMU_BURMA      ----------------------------------------------------------------------
GLMU_BURM7      ----------------------------------------------------------------------
GLMU_STRMK      ----------------------------------------------------------------------
GLMU_SYMTH      ----------------------------------------------------------------------
GLMU_BLOPB      ----------------------------------------------------------------------
GLMU_CELJU      ----------------------------------------------------------------------
GLMU_XANCB      ----------------------------------------------------------------------
GLMU_ACHLI      ----------------------------------------------------------------------
GLMU_RHIE6      ----------------------------------------------------------------------
GLMU_METM7      ----------------------------------------------------------------------
GLMU_STRM5      ----------------------------------------------------------------------
GLMU_BURPP      ----------------------------------------------------------------------
GLMU_XYLFM      ----------------------------------------------------------------------
GLMU_XYLFA      ----------------------------------------------------------------------
GLMU_XYLFT      ----------------------------------------------------------------------
GLMU_XYLF2      ----------------------------------------------------------------------
GLMU_VIBCM      ----------------------------------------------------------------------
GLMU_VIBCH      ----------------------------------------------------------------------
GLMU_VIBC3      ----------------------------------------------------------------------
GLMU_TOLAT      ----------------------------------------------------------------------
GLMU_HALHL      ----------------------------------------------------------------------
GLMU_XANOR      ----------------------------------------------------------------------
GLMU_METMP      ----------------------------------------------------------------------
GLMU_CLOTH      ----------------------------------------------------------------------
GLMU_VIBFM      ----------------------------------------------------------------------
GLMU_VIBF1      ----------------------------------------------------------------------
GLMU_RHIEC      ----------------------------------------------------------------------
GLMU_RALEJ      ----------------------------------------------------------------------
GLMU_AZOSB      ----------------------------------------------------------------------
GLMU_ALISL      ----------------------------------------------------------------------
GLMU_XANOM      ----------------------------------------------------------------------
GLMU_RHILW      ----------------------------------------------------------------------
GLMU_MARAV      ----------------------------------------------------------------------
GLMU_GEOLS      ----------------------------------------------------------------------
GLMU_VIBVY      ----------------------------------------------------------------------
GLMU_VIBVU      ----------------------------------------------------------------------
GLMU_GLUDA      ----------------------------------------------------------------------
GLMU_BURP8      ----------------------------------------------------------------------
GLMU_AERHH      ----------------------------------------------------------------------
GLMU_JANMA      ----------------------------------------------------------------------
GLMU_EDWI9      ----------------------------------------------------------------------
GLMU_BURXL      ----------------------------------------------------------------------
GLMU_BURCH      ----------------------------------------------------------------------
GLMU_BURCA      ----------------------------------------------------------------------
GLMU_SHEAM      ----------------------------------------------------------------------
GLMU_ENTS8      ----------------------------------------------------------------------
GLMU_THISH      ----------------------------------------------------------------------
GLMU_SACD2      ----------------------------------------------------------------------
GLMU_HERAR      ----------------------------------------------------------------------
GLMU_THETN      ----------------------------------------------------------------------
GLMU_SPHWW      ----------------------------------------------------------------------
GLMU_SODGM      ----------------------------------------------------------------------
GLMU_SHEHH      ----------------------------------------------------------------------
GLMU_RHIL3      ----------------------------------------------------------------------
GLMU_PELCD      ----------------------------------------------------------------------
GLMU_BURTA      ----------------------------------------------------------------------
GLMU_ZYMMO      ----------------------------------------------------------------------
GLMU_SPHAL      ----------------------------------------------------------------------
GLMU_PHOPR      ----------------------------------------------------------------------
GLMU_HAHCH      ----------------------------------------------------------------------
GLMU_FERNB      ----------------------------------------------------------------------
GLMU_THEAB      ----------------------------------------------------------------------
GLMU_SERP5      ----------------------------------------------------------------------
GLMU_NITEU      ----------------------------------------------------------------------
GLMU_GEOSF      ----------------------------------------------------------------------
GLMU_ERWT9      ----------------------------------------------------------------------
GLMU_CLOTE      ----------------------------------------------------------------------
GLMU_BURA4      ----------------------------------------------------------------------
GLMU_BORA1      ----------------------------------------------------------------------
GLMU_AQUAE      ----------------------------------------------------------------------
GLMU_YERE8      ----------------------------------------------------------------------
GLMU_XANAC      ----------------------------------------------------------------------
GLMU_SYNWW      ----------------------------------------------------------------------
GLMU_DESAP      ----------------------------------------------------------------------
GLMU_BREBN      ----------------------------------------------------------------------
GMPPB_CAEEL     ----------------------------------------------------------------------
GLMU_XANC5      ----------------------------------------------------------------------
GLMU_STAES      ----------------------------------------------------------------------
GLMU_STAEQ      ----------------------------------------------------------------------
GLMU_STAEP      ----------------------------------------------------------------------
GLMU_SHESA      ----------------------------------------------------------------------
GLMU_RALME      ----------------------------------------------------------------------
GLMU_MANSM      ----------------------------------------------------------------------
GLMU_BURM1      ----------------------------------------------------------------------
Y1334_METJA     ----------------------------------------------------------------------
GLMU_SHEWM      ----------------------------------------------------------------------
GLMU_SHEPA      ----------------------------------------------------------------------
GLMU_SHEDO      ----------------------------------------------------------------------
GLMU_PROAC      ----------------------------------------------------------------------
GLMU_HAES1      ----------------------------------------------------------------------
STRD_STRGR      ----------------------------------------------------------------------
GLMU_YERPY      ----------------------------------------------------------------------
GLMU_YERPS      ----------------------------------------------------------------------
GLMU_YERPP      ----------------------------------------------------------------------
GLMU_YERPN      ----------------------------------------------------------------------
GLMU_YERPE      ----------------------------------------------------------------------
GLMU_YERPB      ----------------------------------------------------------------------
GLMU_YERPA      ----------------------------------------------------------------------
GLMU_YERP3      ----------------------------------------------------------------------
GLMU_SHEPW      ----------------------------------------------------------------------
GLMU_META3      ----------------------------------------------------------------------
GLMU_HAES2      ----------------------------------------------------------------------
GLMU_CHRVO      ----------------------------------------------------------------------
GLMU_BORPD      ----------------------------------------------------------------------
GLMU_STAHJ      ----------------------------------------------------------------------
GLMU_SHESH      ----------------------------------------------------------------------
GLMU_ROSDO      ----------------------------------------------------------------------
GLMU_PSYA2      ----------------------------------------------------------------------
GLMU_PSEA6      ----------------------------------------------------------------------
GLMU_GEOSL      ----------------------------------------------------------------------
GMPPB_CAEBR     ----------------------------------------------------------------------
GLMU_SHEFN      ----------------------------------------------------------------------
GLMU_PSYIN      ----------------------------------------------------------------------
GLMU_PECCP      ----------------------------------------------------------------------
GLMU_HAEPS      ----------------------------------------------------------------------
GLMU_THESQ      ----------------------------------------------------------------------
GLMU_THEP1      ----------------------------------------------------------------------
GLMU_PSE14      ----------------------------------------------------------------------
GLMU_ERWCT      ----------------------------------------------------------------------
GLMU_BORPE      ----------------------------------------------------------------------
GLMU_BORPA      ----------------------------------------------------------------------
GLMU_BORBR      ----------------------------------------------------------------------
GLMU_OCEIH      ----------------------------------------------------------------------
GLMU_GEOUR      ----------------------------------------------------------------------
GLMU_FRAP2      ----------------------------------------------------------------------
GLMU_CLOK5      ----------------------------------------------------------------------
GLMU_CLOK1      ----------------------------------------------------------------------
GLMU_CLOD6      ----------------------------------------------------------------------
GTAB_STAHJ      ----------------------------------------------------------------------
GLMU_THEMA      ----------------------------------------------------------------------
GLMU_STAAW      ----------------------------------------------------------------------
GLMU_STAAS      ----------------------------------------------------------------------
GLMU_STAAR      ----------------------------------------------------------------------
GLMU_STAAN      ----------------------------------------------------------------------
GLMU_STAAM      ----------------------------------------------------------------------
GLMU_STAAC      ----------------------------------------------------------------------
GLMU_STAAB      ----------------------------------------------------------------------
GLMU_STAA3      ----------------------------------------------------------------------
GLMU_SHESW      ----------------------------------------------------------------------
GLMU_SHEPC      ----------------------------------------------------------------------
GLMU_SHELP      ----------------------------------------------------------------------
GLMU_PASMU      ----------------------------------------------------------------------
GLMU_NOVAD      ----------------------------------------------------------------------
GLMU_HAEIN      ----------------------------------------------------------------------
GLMU_GEOMG      ----------------------------------------------------------------------
GLMU_DESVV      ----------------------------------------------------------------------
GLMU_DESVH      ----------------------------------------------------------------------
GLMU_COXBN      ----------------------------------------------------------------------
GALU_MYCPN      ----------------------------------------------------------------------
GTAB_BACSU      ----------------------------------------------------------------------
GTAB2_STAS1     ----------------------------------------------------------------------
GLMU_PSEU2      ----------------------------------------------------------------------
GLMU_PSEMY      ----------------------------------------------------------------------
GLMU_PSEAE      ----------------------------------------------------------------------
GLMU_PSEAB      ----------------------------------------------------------------------
GLMU_PSEA8      ----------------------------------------------------------------------
GLMU_PSEA7      ----------------------------------------------------------------------
GLMU_NITEC      ----------------------------------------------------------------------
GLMU_COLP3      ----------------------------------------------------------------------
GLMU_ALCBS      ----------------------------------------------------------------------
GLMU_ACTSZ      ----------------------------------------------------------------------
RFBF_SALTY      ----------------------------------------------------------------------
GLMU_SHESM      ----------------------------------------------------------------------
GLMU_METFK      ----------------------------------------------------------------------
GLMU_HAEI8      ----------------------------------------------------------------------
GLMU_COXB1      ----------------------------------------------------------------------
GLMU_CLONN      ----------------------------------------------------------------------
GLMU_STAA8      ----------------------------------------------------------------------
GLMU_PSEF5      ----------------------------------------------------------------------
GLMU_HAEIG      ----------------------------------------------------------------------
GLMU_HAEIE      ----------------------------------------------------------------------
GLMU_HAEDU      ----------------------------------------------------------------------
GLMU_COXB2      ----------------------------------------------------------------------
GLMU_CLOBB      ----------------------------------------------------------------------
GLMU_CLOBA      ----------------------------------------------------------------------
GLMU_ACISJ      ----------------------------------------------------------------------
GTAB1_STAS1     ----------------------------------------------------------------------
GLMU_SHESR      ----------------------------------------------------------------------
GLMU_SHEB5      ----------------------------------------------------------------------
GLMU_SALTY      ----------------------------------------------------------------------
GLMU_SALTI      ----------------------------------------------------------------------
GLMU_SALSV      ----------------------------------------------------------------------
GLMU_SALPK      ----------------------------------------------------------------------
GLMU_SALPB      ----------------------------------------------------------------------
GLMU_SALPA      ----------------------------------------------------------------------
GLMU_SALNS      ----------------------------------------------------------------------
GLMU_SALHS      ----------------------------------------------------------------------
GLMU_SALG2      ----------------------------------------------------------------------
GLMU_SALEP      ----------------------------------------------------------------------
GLMU_SALDC      ----------------------------------------------------------------------
GLMU_SALCH      ----------------------------------------------------------------------
GLMU_SALA4      ----------------------------------------------------------------------
GLMU_DESVM      ----------------------------------------------------------------------
GLMU_DESDG      ----------------------------------------------------------------------
GLMU_CHRSD      ----------------------------------------------------------------------
ISPD_BIFLD      ----------------------------------------------------------------------
GLMU_THEM4      ----------------------------------------------------------------------
GLMU_SHEB8      ----------------------------------------------------------------------
GLMU_SHEB2      ----------------------------------------------------------------------
GLMU_PHOLL      ----------------------------------------------------------------------
GLMU_MAGSA      ----------------------------------------------------------------------
GLMU_EXISA      ----------------------------------------------------------------------
GLMU_COXBU      ----------------------------------------------------------------------
GLMU_COXBR      ----------------------------------------------------------------------
GLMU_CLOPS      ----------------------------------------------------------------------
GLMU_AZOVD      ----------------------------------------------------------------------
GLGC_KOCRD      ----------------------------------------------------------------------
MPG1_SULAC      ----------------------------------------------------------------------
LICC_HAEIN      ----------------------------------------------------------------------
ISPD_BIFLO      ----------------------------------------------------------------------
ISPD_BIFLI      ----------------------------------------------------------------------
GLMU_VIBPA      ----------------------------------------------------------------------
GLMU_THEP3      ----------------------------------------------------------------------
GLMU_STAS1      ----------------------------------------------------------------------
GLMU_SHEB9      ----------------------------------------------------------------------
GLMU_EXIS2      ----------------------------------------------------------------------
GLMU_CLOP1      ----------------------------------------------------------------------
GLMU_AZOSE      ----------------------------------------------------------------------
GLMU_PSESM      ----------------------------------------------------------------------
GLMU_PSEPK      ----------------------------------------------------------------------
GLMU_PSEPG      ----------------------------------------------------------------------
GLMU_GEOSW      ----------------------------------------------------------------------
GLMU_CYAP7      ----------------------------------------------------------------------
GLMU_CLOPE      ----------------------------------------------------------------------
GLGC_CORGL      ----------------------------------------------------------------------
GLGC_CORGB      ----------------------------------------------------------------------
GLGC_CORA7      ----------------------------------------------------------------------
GALU2_PSEAE     ----------------------------------------------------------------------
EI2BG_HUMAN     ----------------------------------------------------------------------
GLMU_SHEON      ----------------------------------------------------------------------
GLMU_PSEE4      ----------------------------------------------------------------------
GLMU_PROM0      ----------------------------------------------------------------------
GLMU_PARL1      ----------------------------------------------------------------------
GLMU_MARMM      ----------------------------------------------------------------------
GLMU_GEOTN      ----------------------------------------------------------------------
GLMU_CALS8      ----------------------------------------------------------------------
GLMU_ACTPJ      ----------------------------------------------------------------------
GLMU_ACTP7      ----------------------------------------------------------------------
GLMU_ACTP2      ----------------------------------------------------------------------
GLGC_RHOBA      ----------------------------------------------------------------------
GLGC_ANADF      ----------------------------------------------------------------------
ACEA_KLULA      EWLAKADVKL----FHEVFADAAKAAGKDQSVKVNPLSETSIYEMQALAKEL------------------
GLMU_VIBHB      ----------------------------------------------------------------------
GLMU_PSEP1      ----------------------------------------------------------------------
GLMU_PROM9      ----------------------------------------------------------------------
GLMU_KLEP7      ----------------------------------------------------------------------
GLMU_KLEP3      ----------------------------------------------------------------------
GLMU_DESHY      ----------------------------------------------------------------------
GLGC_PROAC      ----------------------------------------------------------------------
GLGC_COREF      ----------------------------------------------------------------------
GALU_MYCGE      ----------------------------------------------------------------------
ACEA_EMENI      ----------------------------------------------------------------------
YTDA_BACSU      ----------------------------------------------------------------------
MPG1_PICAN      ----------------------------------------------------------------------
GLMU_PSYCK      ----------------------------------------------------------------------
GLMU_PROMS      ----------------------------------------------------------------------
GLMU_NITOC      ----------------------------------------------------------------------
GLMU_LISMH      ----------------------------------------------------------------------
GLMU_LISMF      ----------------------------------------------------------------------
GLMU_LISMC      ----------------------------------------------------------------------
GLMU_DESHD      ----------------------------------------------------------------------
GLMU_CLOBM      ----------------------------------------------------------------------
GLMU_CLOB6      ----------------------------------------------------------------------
GLMU_CLOAB      ----------------------------------------------------------------------
GLMU_ACIBY      ----------------------------------------------------------------------
GLMU_ACIBC      ----------------------------------------------------------------------
GLGC_DECAR      ----------------------------------------------------------------------
GLGC_CORDI      ----------------------------------------------------------------------
GLGC_ANASK      ----------------------------------------------------------------------
GLGC_ANADE      ----------------------------------------------------------------------
GLGC_ANAD2      ----------------------------------------------------------------------
GALF_SALTY      ----------------------------------------------------------------------
GALF_SALTI      ----------------------------------------------------------------------
GALF_KLEPN      ----------------------------------------------------------------------
CAP4C_STRPN     ----------------------------------------------------------------------
ACEA_COCIM      ----------------------------------------------------------------------
GLMU_STRMU      ----------------------------------------------------------------------
GLMU_SHISS      ----------------------------------------------------------------------
GLMU_SHIFL      ----------------------------------------------------------------------
GLMU_SHIF8      ----------------------------------------------------------------------
GLMU_SHIDS      ----------------------------------------------------------------------
GLMU_SHIBS      ----------------------------------------------------------------------
GLMU_SHIB3      ----------------------------------------------------------------------
GLMU_PSYWF      ----------------------------------------------------------------------
GLMU_OCHA4      ----------------------------------------------------------------------
GLMU_LEGPH      ----------------------------------------------------------------------
GLMU_ESCF3      ----------------------------------------------------------------------
GLMU_ENT38      ----------------------------------------------------------------------
GLMU_ECOUT      ----------------------------------------------------------------------
GLMU_ECOSM      ----------------------------------------------------------------------
GLMU_ECOSE      ----------------------------------------------------------------------
GLMU_ECOLU      ----------------------------------------------------------------------
GLMU_ECOLI      ----------------------------------------------------------------------
GLMU_ECOLC      ----------------------------------------------------------------------
GLMU_ECOL6      ----------------------------------------------------------------------
GLMU_ECOL5      ----------------------------------------------------------------------
GLMU_ECOK1      ----------------------------------------------------------------------
GLMU_ECOHS      ----------------------------------------------------------------------
GLMU_ECODH      ----------------------------------------------------------------------
GLMU_ECOBW      ----------------------------------------------------------------------
GLMU_ECO8A      ----------------------------------------------------------------------
GLMU_ECO81      ----------------------------------------------------------------------
GLMU_ECO7I      ----------------------------------------------------------------------
GLMU_ECO5E      ----------------------------------------------------------------------
GLMU_ECO57      ----------------------------------------------------------------------
GLMU_ECO55      ----------------------------------------------------------------------
GLMU_ECO45      ----------------------------------------------------------------------
GLMU_ECO27      ----------------------------------------------------------------------
GLMU_ECO24      ----------------------------------------------------------------------
GLMU_CLOBL      ----------------------------------------------------------------------
GLMU_CLOBK      ----------------------------------------------------------------------
GLMU_CLOBH      ----------------------------------------------------------------------
GLMU_CLOB1      ----------------------------------------------------------------------
GLMU_BIFAA      ----------------------------------------------------------------------
GLMU_BACHK      ----------------------------------------------------------------------
GLMU_BACCZ      ----------------------------------------------------------------------
GLMU_BACCR      ----------------------------------------------------------------------
GLMU_BACCQ      ----------------------------------------------------------------------
GLMU_BACCN      ----------------------------------------------------------------------
GLMU_BACC7      ----------------------------------------------------------------------
GLMU_BACC4      ----------------------------------------------------------------------
GLMU_BACC3      ----------------------------------------------------------------------
GLMU_BACC2      ----------------------------------------------------------------------
GLMU_BACC1      ----------------------------------------------------------------------
GLMU_BACC0      ----------------------------------------------------------------------
GLMU_BACAN      ----------------------------------------------------------------------
GLMU_BACAH      ----------------------------------------------------------------------
GLMU_BACAC      ----------------------------------------------------------------------
GLMU_BACAA      ----------------------------------------------------------------------
GLMU_ACIBS      ----------------------------------------------------------------------
GALF_SHIFL      ----------------------------------------------------------------------
GALF_ECOLI      ----------------------------------------------------------------------
GALF_ECO57      ----------------------------------------------------------------------
EI2BG_RAT       ----------------------------------------------------------------------
EI2BG_MACFA     ----------------------------------------------------------------------
GLMU_THIDA      ----------------------------------------------------------------------
GLMU_THELT      ----------------------------------------------------------------------
GLMU_RHISN      ----------------------------------------------------------------------
GLMU_PSEHT      ----------------------------------------------------------------------
GLMU_PROM2      ----------------------------------------------------------------------
GLMU_MYXXD      ----------------------------------------------------------------------
GLMU_HELMI      ----------------------------------------------------------------------
GLMU_CAUCR      ----------------------------------------------------------------------
GLMU_CAUCN      ----------------------------------------------------------------------
GLMU_BDEBA      ----------------------------------------------------------------------
GLMU_ACIAC      ----------------------------------------------------------------------
EXON_RHIME      ----------------------------------------------------------------------
ACEA_PENMA      ----------------------------------------------------------------------
ACEA_NEUCR      ----------------------------------------------------------------------
GLMU_NEIMF      ----------------------------------------------------------------------
GLMU_NEIM0      ----------------------------------------------------------------------
GLMU_LISMO      ----------------------------------------------------------------------
GLMU_DIAST      ----------------------------------------------------------------------
GLMU_BACSK      ----------------------------------------------------------------------
GLGC_METCA      ----------------------------------------------------------------------
EI2BG_BOVIN     ----------------------------------------------------------------------
ACEA_GIBZE      ----------------------------------------------------------------------
ACEA_ASPFU      ----------------------------------------------------------------------
GMPPB_DROPS     ----------------------------------------------------------------------
GLMU_RHOFD      ----------------------------------------------------------------------
GLMU_PSEU5      ----------------------------------------------------------------------
GLMU_PROMP      ----------------------------------------------------------------------
GLMU_PROMH      ----------------------------------------------------------------------
GLMU_LISW6      ----------------------------------------------------------------------
GLGC_MYXXD      ----------------------------------------------------------------------
ISPD_NOCFA      ----------------------------------------------------------------------
GTAB_STAES      ----------------------------------------------------------------------
GTAB_STAEQ      ----------------------------------------------------------------------
GLMU_NITMU      ----------------------------------------------------------------------
GLMU_NEIMB      ----------------------------------------------------------------------
GLMU_LACLS      ----------------------------------------------------------------------
GLMU_LACLM      ----------------------------------------------------------------------
GLMU_LACLA      ----------------------------------------------------------------------
GLMU_CLOBJ      ----------------------------------------------------------------------
GLMU_BRUSU      ----------------------------------------------------------------------
GLMU_BRUSI      ----------------------------------------------------------------------
GLMU_BRUME      ----------------------------------------------------------------------
GLMU_BRUMB      ----------------------------------------------------------------------
GLMU_BRUC2      ----------------------------------------------------------------------
GLMU_BRUAB      ----------------------------------------------------------------------
GLMU_BRUA2      ----------------------------------------------------------------------
GLMU_BRUA1      ----------------------------------------------------------------------
GLMU_AGRRK      ----------------------------------------------------------------------
GLMU_ACIF5      ----------------------------------------------------------------------
GLMU_ACIF2      ----------------------------------------------------------------------
ACEA_MAGGR      ----------------------------------------------------------------------
HASC_STRPY      ----------------------------------------------------------------------
HASC2_STRP8     ----------------------------------------------------------------------
HASC2_STRP6     ----------------------------------------------------------------------
HASC2_STRP3     ----------------------------------------------------------------------
HASC2_STRP1     ----------------------------------------------------------------------
HASC1_STRP8     ----------------------------------------------------------------------
HASC1_STRP6     ----------------------------------------------------------------------
HASC1_STRP3     ----------------------------------------------------------------------
HASC1_STRP1     ----------------------------------------------------------------------
GTAB_STAAW      ----------------------------------------------------------------------
GTAB_STAAS      ----------------------------------------------------------------------
GTAB_STAAN      ----------------------------------------------------------------------
GTAB_STAAM      ----------------------------------------------------------------------
GTAB_STAAC      ----------------------------------------------------------------------
GTAB_STAAB      ----------------------------------------------------------------------
GTAB_STAA8      ----------------------------------------------------------------------
GTAB_STAA3      ----------------------------------------------------------------------
GLMU_SULNB      ----------------------------------------------------------------------
GLMU_PSEFS      ----------------------------------------------------------------------
GLMU_LISIN      ----------------------------------------------------------------------
GLMU_LEGPL      ----------------------------------------------------------------------
GLMU_LEGPC      ----------------------------------------------------------------------
GLMU_LEGPA      ----------------------------------------------------------------------
GLMU_HYPNA      ----------------------------------------------------------------------
GLMU_BACWK      ----------------------------------------------------------------------
GLMU_AGRVS      ----------------------------------------------------------------------
GLGC_NITOC      ----------------------------------------------------------------------
GLGC_NITEU      ----------------------------------------------------------------------
GLGC2_VIBPA     ----------------------------------------------------------------------
GALU_PSEAE      ----------------------------------------------------------------------
CAP3C_STRPN     ----------------------------------------------------------------------
ACEA_LEPMC      ----------------------------------------------------------------------
SPSI_BACSU      ----------------------------------------------------------------------
GTAB_STAAR      ----------------------------------------------------------------------
GMPPB_HUMAN     ----------------------------------------------------------------------
GMPPB_DICDI     ----------------------------------------------------------------------
GLMU_ENTFA      ----------------------------------------------------------------------
GLMU_BARHE      ----------------------------------------------------------------------
GLMU_ALTMD      ----------------------------------------------------------------------
GLGC_ARTAT      ----------------------------------------------------------------------
ACEA_YARLI      ----------------------------------------------------------------------
ACEA_PICPA      ----------------------------------------------------------------------
ACEA_DEBHA      ----------------------------------------------------------------------
ACEA_COPCI      ----------------------------------------------------------------------
ACEA_COPC7      ----------------------------------------------------------------------
MOBA_YERPP      ----------------------------------------------------------------------
MOBA_YERPN      ----------------------------------------------------------------------
MOBA_YERPG      ----------------------------------------------------------------------
MOBA_YERPE      ----------------------------------------------------------------------
MOBA_YERPB      ----------------------------------------------------------------------
MOBA_YERPA      ----------------------------------------------------------------------
ISPD_SYNSC      ----------------------------------------------------------------------
GMPPB_MOUSE     ----------------------------------------------------------------------
GMPPB_DROME     ----------------------------------------------------------------------
GLMU_STRGC      ----------------------------------------------------------------------
GLMU_SALAR      ----------------------------------------------------------------------
GLMU_RHOS5      ----------------------------------------------------------------------
GLMU_RHIME      ----------------------------------------------------------------------
GLMU_PSEPF      ----------------------------------------------------------------------
GLMU_PELPD      ----------------------------------------------------------------------
GLMU_NITHX      ----------------------------------------------------------------------
GLMU_LACDB      ----------------------------------------------------------------------
GLMU_GRABC      ----------------------------------------------------------------------
GLMU_BIFLO      ----------------------------------------------------------------------
GLMU_BIFLI      ----------------------------------------------------------------------
GLMU_BACME      ----------------------------------------------------------------------
GLMU_BACHD      ----------------------------------------------------------------------
GLMU_ACIAD      ----------------------------------------------------------------------
GLGC_GEOMG      ----------------------------------------------------------------------
EI2BE_MOUSE     ----------------------------------------------------------------------
ACEA_CANAL      ----------------------------------------------------------------------
SPLE_STAAU      ----------------------------------------------------------------------
MOBA_YERPY      ----------------------------------------------------------------------
MOBA_YERP3      ----------------------------------------------------------------------
ISPD_PROMM      ----------------------------------------------------------------------
GLMU_WIGBR      ----------------------------------------------------------------------
GLMU_SYNS3      ----------------------------------------------------------------------
GLMU_RALPJ      ----------------------------------------------------------------------
GLMU_NEIGO      ----------------------------------------------------------------------
GLMU_NEIG1      ----------------------------------------------------------------------
GLMU_METPP      ----------------------------------------------------------------------
GLMU_CITK8      ----------------------------------------------------------------------
GLMU_BUCAP      ----------------------------------------------------------------------
GLMU_BIFLD      ----------------------------------------------------------------------
GLMU_BACLD      ----------------------------------------------------------------------
GLGC_NITMU      ----------------------------------------------------------------------
GLGC_LEIXX      ----------------------------------------------------------------------
GLGC_DEIDV      ----------------------------------------------------------------------
EI2BE_RABIT     ----------------------------------------------------------------------
ACEA_PICJA      ----------------------------------------------------------------------
ACEA_CANTR      ----------------------------------------------------------------------
GMPPB_XENTR     ----------------------------------------------------------------------
GLMU_STRPG      ----------------------------------------------------------------------
GLMU_STRPF      ----------------------------------------------------------------------
GLMU_STRPC      ----------------------------------------------------------------------
GLMU_STRPB      ----------------------------------------------------------------------
GLMU_STRP6      ----------------------------------------------------------------------
GLMU_STRP3      ----------------------------------------------------------------------
GLMU_LAWIP      ----------------------------------------------------------------------
GLMU_BAUCH      ----------------------------------------------------------------------
GLMU_ANAVT      ----------------------------------------------------------------------
GLGC_RHOE4      ----------------------------------------------------------------------
GLGC_MAGSA      ----------------------------------------------------------------------
GLGC_JANSC      ----------------------------------------------------------------------
GLGC_DEIGD      ----------------------------------------------------------------------
GLGC_CORJK      ----------------------------------------------------------------------
GLGC_ARTCA      ----------------------------------------------------------------------
ACEA_MYCLE      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IFRLQDADEYSAAEKIYLTGGQAPSSAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGI
PEPM_MYTED      IFRLQRDDELVQAEDKYL----------------------------------------------------
PEPM_TETPY      VFRLQGEDELKQADKKYL----------------------------------------------------
PEPM_STRVR      IFGLLDYESLEQDENRYT---QAPDLAPV-----------------------------------------
PEPM_STRHY      IFGLFDYEGLEKDENCYT---QAPDLAAV-----------------------------------------
CPPM_STRHY      FAELFEVFEYSKISEL------------------------------------------------------
PRPB_BACHD      LYETISYDDFEALDK-------------------------------------------------------
PRPB2_CORGL     LYELLRYNEYNAFDQQVFT---------------------------------------------------
PRPB_AERPE      FYDLIGYHDY------------------------------------------------------------
PRPB_BACSU      ----------------------------------------------------------------------
PRPB1_CORGL     LYELLRYEDYNVFDQHIFT---------------------------------------------------
OADC_RHOPB      ----------------------------------------------------------------------
CPPM_ARATH      FNSLVDLDSWFELEARY-----------------------------------------------------
OADC_RHOP5      ----------------------------------------------------------------------
OADC_BRAJA      ----------------------------------------------------------------------
OADC_PSEU5      ----------------------------------------------------------------------
OADC_BRASO      ----------------------------------------------------------------------
OADC_BRASB      ----------------------------------------------------------------------
PRPB_VIBCH      ----------------------------------------------------------------------
PDP_DIACA       FNELISLESWYEME--------------------------------------------------------
OADC1_PSEPW     ----------------------------------------------------------------------
OADC_RHOPS      ----------------------------------------------------------------------
OADC_PSEPG      ----------------------------------------------------------------------
OADC_PSEE4      ----------------------------------------------------------------------
OADC_PSEPK      ----------------------------------------------------------------------
OADC_PSEP1      ----------------------------------------------------------------------
OADC_RHOP2      ----------------------------------------------------------------------
OADC_PSEMY      ----------------------------------------------------------------------
OADC_BURXL      ----------------------------------------------------------------------
OADC_PSEF5      ----------------------------------------------------------------------
PRPB_SALTY      LY--ESINYYQFEEKL------------------------------------------------------
OADC2_PSEPW     ----------------------------------------------------------------------
OADC_AZOVD      ----------------------------------------------------------------------
PRPB_ECOLI      LY--ESINYYQYEEKL------------------------------------------------------
OADC_CHRSD      ----------------------------------------------------------------------
OADC_PSE14      ----------------------------------------------------------------------
OADC_PSEU2      ----------------------------------------------------------------------
OADC_PSEFS      ----------------------------------------------------------------------
OADC1_PSEPF     ----------------------------------------------------------------------
OADC_PSESM      ----------------------------------------------------------------------
OADC_PSEAE      ----------------------------------------------------------------------
OADC_PSEAB      ----------------------------------------------------------------------
OADC_PSEA8      ----------------------------------------------------------------------
OADC_PSEA7      ----------------------------------------------------------------------
OADC_MARMS      ----------------------------------------------------------------------
OADC_RHOPA      ----------------------------------------------------------------------
OADC_RHOPT      ----------------------------------------------------------------------
OADC2_PSEPF     ----------------------------------------------------------------------
GLMU_DEIRA      -----------------MTEQTRPLDVVILAAGQGTRMNSAL---PKVLHPVAGRPMVAWAVKAARDLGA
GLMU_METVS      --------------------------AVILCAGSGTRLYPITENRPKPMIPIAGKPILEHIIEKIENHVE
GLMU_METM5      --------------------------AIILCAGKGTRLHPITESRPKPMIPIAGKPILEHIIEKIENH-V
GLMU_KOSOT      -------------------------TAIILAAGLGKRMKS---EIPKVVHSILGLPMINWVLRAVKKAGI
GLMU_DECAR      ---------------------------VILAAGQGKRMHS---NLPKVLHPIAGKPLAQHVIDTARQLSP
GLMU_METJA      --------------------------AIILCAGKGERLRPLTENRPKPMIPIAGKPILQHIIEKVEDL-V
GLMU_DEIGD      -----------------MTHKERPLDVVILAAGQGTRMKSAL---PKVLHPVAGRPMXXXXXXXXXXLGA
GLMU_BURPS      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLSHVIDTARALAP
GLMU_BURP6      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLSHVIDTARALAP
GLMU_BURP1      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLSHVIDTARALAP
GLMU_BURP0      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLSHVIDTARALAP
GLMU_BURMS      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLSHVIDTARALAP
GLMU_BURMA      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLSHVIDTARALAP
GLMU_BURM7      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLSHVIDTARALAP
GLMU_STRMK      -----------------------PLHVIILAAGAGKRMKSVL---PKVLQPIAGQPMLAHVIDAARELQP
GLMU_SYMTH      -------------------------TAVLLAAGHGTRMKS---DLIKVMHPLAGKPMIGHIVDNVRRAGL
GLMU_BLOPB      -------------------------SAIILAAGRGN---RMLSDTPKVLYQIGGKFMLQHLIDSVMQVGV
GLMU_CELJU      ---------------------------LILAAGKGTRMRS---DLPKVLHPIGGKPLVQHVVDTARQVGG
GLMU_XANCB      -----------------------PLHVVILAAGEGKRMRSAL---PKVLQPLAGQPMLAHVIATARELQP
GLMU_ACHLI      --------------------------ALVLAAGKGTRMKS---DIPKVAFPILRKPMIEYIVENIEKSSV
GLMU_RHIE6      --------------------------AVILAAGDSTRMKS---SKSKVLHPVAGRPMIAHVVEAVASAGI
GLMU_METM7      --------------------------AIILCAGKGTRLYPITESRPKPMIPIAGKPILEHIIEKIENYVE
GLMU_STRM5      -----------------------PLHVIILAAGAGKRMKSVL---PKVLQPIAGQPMLAHVIAAARELEP
GLMU_BURPP      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGQPLLAHVIDTARTLKP
GLMU_XYLFM      -----------------------PLHIVILAAGEGKRMKSAL---PKVLHPIAGKPMLAHVITTARALTP
GLMU_XYLFA      -----------------------PLHIVILAAGEGKRMKSAL---PKVLHPIAGKPMLAHVITAAQALTP
GLMU_XYLFT      -----------------------PLHIVILAAGEGKRMKSAL---PKVLHPIAGKPMLAHVITTARALTP
GLMU_XYLF2      -----------------------PLHIVILAAGEGKRMKSAL---PKVLHPIAGKPMLAHVITTARALTP
GLMU_VIBCM      -------------------------STVILAAGKGTRMHS---NMPKVLHTLAGKPMVKHVIDTCNNLGA
GLMU_VIBCH      -------------------------STVILAAGKGTRMHS---NMPKVLHTLAGKPMVKHVIDTCNNLGA
GLMU_VIBC3      -------------------------STVILAAGKGTRMHS---NMPKVLHTLAGKPMVKHVIDTCNNLGA
GLMU_TOLAT      ---------------------------VILAAGKGTRMRS---SLPKVLHPVAGRPMVSHVIDTARSLNA
GLMU_HALHL      ---------------------RAPVAVVILAAGKGTRMRSA---QPKVLQPLAGRPLLAHVLDTALALGP
GLMU_XANOR      -----------------------PLHVVILAAGEGKRMRS---SLPKVLQPLAGQPMLAHVIATARQLQP
GLMU_METMP      --------------------------AIILCAGKGTRLHPITESRPKPMIPIAGKPXXXXXXXXXXXXXX
GLMU_CLOTH      --------------------------AVILAAGEGKRMKS---KKAKVVHEIQGIPLVEWVYRSVKNAGI
GLMU_VIBFM      -------------------------SAVILAAGKGTRMYS---NKPKVLHTLAGKPMAKHVIDTCEGLGA
GLMU_VIBF1      -------------------------SAVILAAGKGTRMYS---NKPKVLHTLAGKPMAKHVIDTCEGLGA
GLMU_RHIEC      --------------------------AVILAAGDSTRMKS---SKSKVLHPVAGRPMIAHVVEAVASAGI
GLMU_RALEJ      ---------------------------VILAAGMGKRMHS---DLPKVLHPVAGRPMLAHVIDTARTLSP
GLMU_AZOSB      ---------------------------VILAAGQGKRMRSVL---PKVLQPLAGKPMLSHVLDAARTLAA
GLMU_ALISL      -------------------------SAVILAAGKGTRMYS---NKPKVLHTLAGKPMAKHVIDTCEGLGA
GLMU_XANOM      -----------------------PLHVVILAAGEGKRMRS---SLPKVLQPLAGQPMLAHVIATARQLQP
GLMU_RHILW      --------------------------AVILAAGDSTRMKS---SKSKVLHPVAGRPMIAHVVEAVASAGI
GLMU_MARAV      ----------------------SPLHVVILAAGQGSRMKS---SLPKVLHPVAGKAMLHHVVDTAKQLGA
GLMU_GEOLS      ----------------------AISAALILAAGKGTRMKSALV---KVLHELAGRPMLGWPLAAAREAGA
GLMU_VIBVY      -------------------------SAVILAAGKGTRMYS---NMPKVLHTLAGKPMVKHVIDTCTGLGA
GLMU_VIBVU      -------------------------SAVILAAGKGTRMYS---NMPKVLHTLAGKPMVKHVIDTCTGLGA
GLMU_GLUDA      -----------------------PATAVILAAGMGTRMKS---DRPKVMHPLAGQPMLRYLLDNAASV-F
GLMU_BURP8      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLAHVIDTARTLNP
GLMU_AERHH      -------------------------NVVILAAGKGTRMRS---SLPKVLHPVANKPMVSHVIETARKVGA
GLMU_JANMA      ---------------------------VILAAGMGKRMQSAL---PKVLHPLAGKPLLSHVIDTARQLSP
GLMU_EDWI9      ----------------------SPLSVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDSALTLGA
GLMU_BURXL      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLAHVIDTARTLKP
GLMU_BURCH      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLSHVIDTARTLQP
GLMU_BURCA      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLSHVIDTARTLQP
GLMU_SHEAM      -------------------------NVVILAAGKGTRMRS---DLPKVLHSVAHKPMVQHVIDTARELNA
GLMU_ENTS8      -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKPMVQHVIDAAKHVGA
GLMU_THISH      -----------------------PTSILILAAGQGTRMRS---SLPKVLQPLAGRPLLSHVLDTARSLDP
GLMU_SACD2      ---------------------------IILAAGKGTRMRS---DKPKVLHTLAGKPFLEHVLDRSAELNA
GLMU_HERAR      ---------------------------VILAAGMGKRMQSAL---PKVLHPLAGKPLLSHVIDTARQLSP
GLMU_THETN      --------------------------SVILAAGLGKRMKS---KYPKVVHKVCGKPMVKWVVEAAQEAGS
GLMU_SPHWW      -----------------------PFAALILAAGKGTRMKS---DLHKVLHPIAGKPMLGHLIAAVDRLGA
GLMU_SODGM      -------------------------SVVVLAAGKGSRMFSTL---PKVLHPLAGKAMVQHVIDTAMRLGA
GLMU_SHEHH      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHQVGS
GLMU_RHIL3      --------------------------AVILAAGDSTRMKS---SKSKVLHPVAGRPMIAHVVEAVASAGI
GLMU_PELCD      -------------------------AAVILAAGKGTRMKS---EQPKVLHPIAGKPMVTFPVAGALKHGC
GLMU_BURTA      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLSHVIDTARALAP
GLMU_ZYMMO      -----------------------PFSAVILAAGKGTRMRS---DTHKILHALAGRPLLGWVLDSLAPLSP
GLMU_SPHAL      -----------------------PIAAIVLAAGKGTRMKS---DLHKVLHPIAGRPMLLHLMASVDELSP
GLMU_PHOPR      -------------------------SAVILAAGKGTRMYS---NVPKVLHTLAGKPMAKHVIDTCSDLGA
GLMU_HAHCH      ---------------------------IILAAGQGTRMKS---ELPKVMHCVAGKPLVQHVIDTARRLEP
GLMU_FERNB      ---------------------------LILAAGLGKRMKS---KYPKVVHKILGKPMINWVVD--LGKAF
GLMU_THEAB      ---------------------------LILAAGLGKRMNS---KYPKVIHKILGKPMINWVIDTAKSFG-
GLMU_SERP5      -------------------------SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGA
GLMU_NITEU      ---------------------------VILAAGMGK---RMCSSLPKVLHPLAGKPILSHVLDIARTLSP
GLMU_GEOSF      ----------------------AKVAAIVLAAGKGTRMKS---ELVKVMHPLSGMPMISWPVNVVREAGA
GLMU_ERWT9      -----------------------PMSVVILAAGKGTRMYS---DLPKVLHLLAGKPMVQHVIDAARELNA
GLMU_CLOTE      --------------------------AILLAAGEGKRMKSAT---PKVLHKVCGKEMVNHVIDALREANI
GLMU_BURA4      ---------------------------VILAAGTGKRMRSAL---PKVLHPLAGRPLLSHVIATARTLQP
GLMU_BORA1      -------------------------NVVILAAGLGKRMQS---DLPKVLHTLAGQPMLGHVLESARDLQP
GLMU_AQUAE      --------------------------AVILAAGLGTRFKS---EKPKVLHEILGKPMLWYVITNVRNGRI
GLMU_YERE8      -------------------------SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGA
GLMU_XANAC      -----------------------PLHVLILAAGEGKRMRS---SLPKVLQPLAGQPMLAHVIATARQLQP
GLMU_SYNWW      -------------------------SAVILAAGKGLRMRS---DLPKVAHRVAGKPIILHVIQAVKEAGI
GLMU_DESAP      -------------------------AAVVLAAGRGTRMKSR---RPKVLHRVAGRPMVGYVMEAVREAGA
GLMU_BREBN      --------------------------AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVQHVVDTMASMQV
GMPPB_CAEEL     --------------------------ALILVGGYGTRLRPLTLTQPKPLVEFANKPMMLHQMEALAEVGV
GLMU_XANC5      -----------------------PLHVVILAAGEGKRMRS---SLPKVLQPLAGQPMLAHVIATARQLQP
GLMU_STAES      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLNNVKQAGV
GLMU_STAEQ      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLNNVKQAGV
GLMU_STAEP      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLNNVKQAGV
GLMU_SHESA      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHSIGS
GLMU_RALME      ---------------------------VILAAGMGKRMNSAL---PKVLHPVAGQPMLSHVLDTARTLSP
GLMU_MANSM      -------------------------SVVILAAGKGTRMYS---DLPKVLHKIAGKPMVKHVIDTAKQLSA
GLMU_BURM1      ---------------------------VILAAGTGKRMRSAL---PKVLHPVAGRPLLSHVIATARTLQP
Y1334_METJA     --------------------------AVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVEAGV
GLMU_SHEWM      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHNVGS
GLMU_SHEPA      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAYQVGS
GLMU_SHEDO      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTANSLGS
GLMU_PROAC      ------------------------AAVIVLAAGGGTRMKST---KSKLLHEVAGRPMLSWAIGAARGLNP
GLMU_HAES1      -------------------------SVVILAAGKGTRMYS---DLPKVLHKIAGKPMVKHVIDTAKKLSA
STRD_STRGR      --------------------------ALVLAGGTGTRLRPITHTSAKQLVPVANKPVLFYGLEAIRAAGI
GLMU_YERPY      -------------------------SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGA
GLMU_YERPS      -------------------------SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGA
GLMU_YERPP      -------------------------SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGA
GLMU_YERPN      -------------------------SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGA
GLMU_YERPE      -------------------------SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGA
GLMU_YERPB      -------------------------SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGA
GLMU_YERPA      -------------------------SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGA
GLMU_YERP3      -------------------------SVVILAAGKGTRMYS---DLPKVLHPLAGKPMVQHVIDAAMKLGA
GLMU_SHEPW      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHEVGS
GLMU_META3      --------------------------AVILCAGKGTRLMPLTENIPKPMLPVGGAPILERIINKI-DKLV
GLMU_HAES2      -------------------------SVVILAAGKGTRMYS---DLPKVLHKIAGKPMVKHVIDTAKKLSA
GLMU_CHRVO      -------------------------SIVILAAGKGKRMYS---SLPKVLHPIGGEPMLARVIRTARALNP
GLMU_BORPD      -------------------------NVVILAAGLGKRMQS---DLPKVLHSLAGKPMLEHVLDSASQLEP
GLMU_STAHJ      -------------------------NAVILAAGKGTRMKS---NKYKVLHKVAGKSMVEHVLTNVKNAGV
GLMU_SHESH      -------------------------NVVILAAGKGTRMRS---ELPKVLHPIAHKSMVQHVIDTAHSVGS
GLMU_ROSDO      ------------------------TALVILAAGKGTRMNS---DLPKVLHPLAGAPLLIHAMQSGASLGP
GLMU_PSYA2      ----------------------SPLSVIILAAGKGTRMQSA---KPKVLQTLAGKSLLGHVLDTCHQLTV
GLMU_PSEA6      -------------------------SVVILAAGKGTRMKS---SMPKVLHPIGAKPMVQRIIDTVHQLGA
GLMU_GEOSL      -------------------------AAIILAAGKGTRMKS---GIVKVMHPLAGAPMVAWPVAVARQAGA
GMPPB_CAEBR     --------------------------ALILVGGYGTRLRPLTLTQPKPLVEFANKPMMLHQMEALAAVGV
GLMU_SHEFN      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTANSLGS
GLMU_PSYIN      -------------------------SVVILAAGKGT---RMCSELPKVLHKIADKPMVQHVIDTVKSIGA
GLMU_PECCP      -------------------------SVVILAAGKGTRMYS---DLPKVLHKLAGKPMVQHVIDAAMTTGA
GLMU_HAEPS      -------------------------SVVILAAGKGTRMYS---DLPKVLHPIAGKPMVKHVIDTAKQLSA
GLMU_THESQ      --------------------------ALVLAAGKGTRMKSKI---PKVLHPLSGKPMIEWVVE-TAGKVA
GLMU_THEP1      --------------------------ALVLAAGKGTRMKSKI---PKVLHPLSGKPMIEWVVE-TAGKVA
GLMU_PSE14      ---------------------------VILAAGQGTRMRSAL---PKVLHPVAGNSMLGHVIHSARQLSP
GLMU_ERWCT      -------------------------SVVILAAGKGTRMYS---DLPKVLHKLAGKPMVQHVIDAAMTTGA
GLMU_BORPE      -------------------------NVVILAAGLGKRMQS---DLPKVLHTLAGRPMLDHVIGSARQLQP
GLMU_BORPA      -------------------------NVVILAAGLGKRMQS---DLPKVLHTLAGRPMLDHVIGSARQLQP
GLMU_BORBR      -------------------------NVVILAAGLGKRMQS---DLPKVLHTLAGRPMLDHVIGSARQLQP
GLMU_OCEIH      --------------------------AVILAAGQGTRMKSKLH---KMLHPVAGRPMVQHVVDQLQQVNL
GLMU_GEOUR      -------------------------AAVILAAGKGTRMKS---NIVKVMHPLGGLPMVSWPVNTAREAGA
GLMU_FRAP2      -------------------------AVVILAAGKGSRMNS---NKPKVLQTLTGKTLIRHVLSRVEPLNP
GLMU_CLOK5      --------------------------AIILAAGEGKRMKS---SKPKVLHKICGKEMINVVIDVVKKAQI
GLMU_CLOK1      --------------------------AIILAAGEGKRMKS---SKPKVLHKICGKEMINVVIDVVKKAQI
GLMU_CLOD6      --------------------------AIILAAGKGTRMKS---KYPKVIHKVCGKEMVNHIIDVSKKSGV
GTAB_STAHJ      --------------------------AIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASRAGI
GLMU_THEMA      --------------------------ALVLAAGKGTRMKSKI---PKVLHPLSGRPMIEWVIE-TAGKVA
GLMU_STAAW      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLESVKGSGV
GLMU_STAAS      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLESVKGSGV
GLMU_STAAR      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLESVKGSGV
GLMU_STAAN      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLESVKGSGV
GLMU_STAAM      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLESVKGSGV
GLMU_STAAC      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLESVKGSGV
GLMU_STAAB      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLESVKGSGV
GLMU_STAA3      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLESVKGSGV
GLMU_SHESW      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHSIGS
GLMU_SHEPC      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHSIGS
GLMU_SHELP      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHQLGS
GLMU_PASMU      -------------------------SIVILAAGKGTRMYS---DLPKVLHKIAGKPMVKHVIDTVKSIHA
GLMU_NOVAD      ----------------------SPLAIIVLAAGKGTRMKS---DLHKVLHPIAGRPMLMHLMASAAELSP
GLMU_HAEIN      -------------------------SAVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGS
GLMU_GEOMG      -------------------------AAIILAAGKGTRMKS---DLVKVMHPLAGAPMVAWPVEAARQAGT
GLMU_DESVV      ------------------------TGALILAAGKGTRMHS---DKPKVLQTILGEPMLRFVMDALAPVFG
GLMU_DESVH      ------------------------TGALILAAGKGTRMHS---DKPKVLQTILGEPMLRFVMDALAPVFG
GLMU_COXBN      -------------------------SVIILAAGQGKRMASST---PKILHPLGGIPLLERVVNTARLLNP
GALU_MYCPN      --------------------------AVIPAAGLGTRLLPATKAIPKEMLPLVNKPTIQYIVEEAVASGI
GTAB_BACSU      --------------------------AIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGI
GTAB2_STAS1     --------------------------AIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGI
GLMU_PSEU2      ---------------------------VILAAGQGTRMRSAL---PKVLHPVAGNSMLGHVIHSARQLSP
GLMU_PSEMY      ---------------------------VILAAGQGTRMRSAL---PKVLHPVANKPMLGHVIDTARSLQP
GLMU_PSEAE      ---------------------------VILAAGQGTRMRSAL---PKVLHPIAGKPMLGHVIDCARQLQP
GLMU_PSEAB      ---------------------------VILAAGQGTRMRSAL---PKVLHPIAGKPMLGHVIDCARQLQP
GLMU_PSEA8      ---------------------------VILAAGQGTRMRSAL---PKVLHPIAGKPMLGHVIDCARQLQP
GLMU_PSEA7      ---------------------------VILAAGQGTRMRSAL---PKVLHPIAGKPMLGHVIDCARQLQP
GLMU_NITEC      ---------------------------VILAAGMGKRMRSTL---PKVLHPLAGKPILFHVLDTARILSP
GLMU_COLP3      -------------------------SVVILAAGKGTRMRS---SLPKVLHSVAEKPMVGHVIDSARQLGA
GLMU_ALCBS      -------------------------AVVILAAGKGTRMKSAL---PKVLHAVAGKPMVQHVVDAAASLEP
GLMU_ACTSZ      -------------------------SVVILAAGKGTRMYS---DLPKVLHKVAGKPMVKHVIDTAKQLSA
RFBF_SALTY      --------------------------AVILAGGLGTRLSEETIVKPKPMVEIGGKPILWHIMKMYSVHGI
GLMU_SHESM      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHSIGS
GLMU_METFK      ---------------------------VILAAGKGTRMNS---SKPKVLHALAGKPVLQHVLDTARRLNP
GLMU_HAEI8      -------------------------SAVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDIAHQLGS
GLMU_COXB1      -------------------------SVIILAAGQGKRMASST---PKILHPLGGIPLLERVVNTARLLNP
GLMU_CLONN      -------------------------SAVILAAGKGTRMKSAL---PKVLHKVCGKEMVNQVIDTLRKSDI
GLMU_STAA8      --------------------------AIILAAGKGTRMKS---KKYKVLHEVAGKPMVEHVLESVKGSGV
GLMU_PSEF5      ---------------------------VILAAGQGTRMRSAL---PKVLHPVAGNSMLGHVIHSARQLDP
GLMU_HAEIG      -------------------------SAVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGA
GLMU_HAEIE      -------------------------SAVILAAGKGTRMYS---DLPKVLHTIAGKPMVKHVIDTAHQLGA
GLMU_HAEDU      -----------------------PFSVVILAAGKGTRMYS---DLPKVLHPIAGKSMVKHVIDTVKQMDA
GLMU_COXB2      -------------------------SVIILAAGQGKRMASST---PKILHPLGGIPLLERVVNTARLLNP
GLMU_CLOBB      --------------------------ALVLAAGQGKRIKS---DLPKVLHKVCGKEMVNHVIDTIRKAGI
GLMU_CLOBA      --------------------------ALVLAAGQGKRIKS---DLPKVLHKVCGKEMVNHVIDTIRKAGI
GLMU_ACISJ      ---------------------------IIMAAGKGTRMKSRI---PKVLQRLAGRPLLHHVLGQAASLQA
GTAB1_STAS1     --------------------------AIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAVAAGI
GLMU_SHESR      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHCIGS
GLMU_SHEB5      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHKVGS
GLMU_SALTY      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALTI      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALSV      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALPK      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALPB      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALPA      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALNS      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALHS      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALG2      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALEP      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALDC      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALCH      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_SALA4      -------------------------SVVILAAGKGTRMYS---DIPKVLHTLAGKPMVQHVIDAATKLGA
GLMU_DESVM      ------------------------TGALILAAGKGTRMHS---DKPKVLQSILGEPMLRFVYDALEPLFG
GLMU_DESDG      -----------------MSSNQYTAGAVILAAGKGTRMYS---DKPKVLQPLLGEPMLRFVYRALDPLFS
GLMU_CHRSD      ---------------------------VILAAGQGTRMRSA---KPKVLHALAGKPLVSHVLDTAEQLGA
ISPD_BIFLD      -----------------------PVVAVVLAAGFGTRFDP---DNPKQLVSVGGKPIVCWSIDAFEHDRV
GLMU_THEM4      ---------------------------LILAAGLGKRMNS---KYPKVIHKIFNKPMINWVIETAKNFG-
GLMU_SHEB8      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHKVGS
GLMU_SHEB2      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHKVGS
GLMU_PHOLL      -------------------------SVVILAAGKGTRMYS---DLPKVLHLLAGKPMVQHVIDTAMALGA
GLMU_MAGSA      -------------------------AVIVLAAGMGTRMKS---SLPKVMHPLAGRPMVSHLLDTVSGLSP
GLMU_EXISA      --------------------------AVILAAGKGTRMKSKLY---KVLHPVLGKPMVEHVVDQLDQIGV
GLMU_COXBU      -------------------------SVIILAAGQGKRMASST---PKILHPLGGIPLLERVVNTARLLNP
GLMU_COXBR      -------------------------SVIILAAGQGKRMASST---PKILHPLGGIPLLERVVNTARLLNP
GLMU_CLOPS      --------------------------AIILAAGQGTRIKSKL---PKVLHKACGKEMVNHVIDAMRNAEI
GLMU_AZOVD      ---------------------------VILAAGQGTRMRSAL---PKVLHPVAGNSMLGHVVATARQLQP
GLGC_KOCRD      --------------------------AIVLAGGEGKRLMPLTEDRAKPAVPFAGYRLIDFALSNLVNSGY
MPG1_SULAC      -------------------------SAIVLAGGYATRLRPLSLTKPKALLPVLGKPLMDYTLYSLASSDV
LICC_HAEIN      -------------------------NAIILAAGLGSRFKDITQSTHKSLLDIHGTPNLERTLTFLRQANI
ISPD_BIFLO      -----------------------PVVAVVLAAGFGTRFDP---DNPKQLVSVGGKPIVCWSIDAFEHDRV
ISPD_BIFLI      -----------------------PVVAVVLAAGFGTRFDP---DNPKQLVSVGGKPIVCWSIDAFEHDRV
GLMU_VIBPA      -------------------------SAVILAAGKGTRMHS---NMPKVLHTLAGKPMVKHVIDTCTGLGA
GLMU_THEP3      ---------------------------LILAAGLGKRMKS---KHPKVVHKVCGKPMIEWVVDAVEEIGS
GLMU_STAS1      --------------------------AIVLAAGKGTRMKS---KKYKVLHDVAGKTMIEHVADNVKQSGI
GLMU_SHEB9      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHKVGS
GLMU_EXIS2      --------------------------AVILAAGKGTRMKSKLY---KVLHPVAGKPMVQHVVDQLTTLGV
GLMU_CLOP1      --------------------------AIILAAGQGTRIKSKL---PKVLHKACGKEMVNHVIDAMRNAEI
GLMU_AZOSE      ---------------------------VILAAGQGKRMRSAL---PKVLQPIAGRPMLEHVIAAAQALEA
GLMU_PSESM      ---------------------------VILAAGQGTRMRSAL---PKVLHPVAGNSMLGHVIHSARQLSP
GLMU_PSEPK      ---------------------------VILAAGQGTRMRSAL---PKVLHPVAGNSMLGHVIHSARQLQP
GLMU_PSEPG      ---------------------------VILAAGQGTRMRSAL---PKVLHPVAGNSMLGHVIHSARQLQP
GLMU_GEOSW      --------------------------AVILAAGQGTRMKS---KQYKVLHPVCGKPMVQHVVDQVLQLGI
GLMU_CYAP7      -------------------------AVAILAAGRGTRMKS---NLPKVLHPLGGRSLVERVLESCQLINP
GLMU_CLOPE      --------------------------AIILAAGQGTRIKSKL---PKVLHKACGKEMVNHVIDAMRNAEI
GLGC_CORGL      --------------------------AIVLAGGEGKRLFPLTEDRAKPAVPFGGTRLIDFVLSNLVNSGF
GLGC_CORGB      --------------------------AIVLAGGEGKRLFPLTEDRAKPAVPFGGTRLIDFVLSNLVNSGF
GLGC_CORA7      --------------------------AIVLAGGEGKRLFPLTEDRAKPAVPFGGSRLIDFVLSNLVNAGF
GALU2_PSEAE     ------------------------------AAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGL
EI2BG_HUMAN     --------------------------AVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGF
GLMU_SHEON      -------------------------NVVILAAGKGTRMRS---DLPKVLHPIAHKSMVQHVIDTAHSIGS
GLMU_PSEE4      ---------------------------VILAAGQGTRMRSAL---PKVLHPVAGNSMLGHVIHSARQLQP
GLMU_PROM0      -------------------------SVAILAAGKGTRMES---SLPKVLHKISGKSLLQRVIDSCVELKP
GLMU_PARL1      --------------------------AVILAAGKGTRMKSRL---PKVLHPIAGKPMLGHVLSAVSALGS
GLMU_MARMM      -------------------------SAIILAAGQGTRMKSKTV---KVLHKVAGRPMLDWAVALAGDCGA
GLMU_GEOTN      --------------------------AVILAAGQGTRMKSKLY---KVLHPVCGKPMVQHVVDQVSKLGV
GLMU_CALS8      ------------------------STFIILAAGEGKRMKSKYS---KVVQKIMGKPMILYIIDEIKNFED
GLMU_ACTPJ      -------------------------SVVILAAGKGTRMYS---DLPKVLHTVAGKPMVQHVIDTAKQIDA
GLMU_ACTP7      -------------------------SVVILAAGKGTRMYS---DLPKVLHTVAGKPMVQHVIDTAKQIDA
GLMU_ACTP2      -------------------------SVVILAAGKGTRMYS---DLPKVLHTVAGKPMVQHVIDTAKQIDA
GLGC_RHOBA      ---------------------------VILAGGRGSRLEPLTRDRAKPAVPIGGARIIDFVLSNCLNSDM
GLGC_ANADF      --------------------------AMILAGGEGRRLDPLTRERAKPAVPFGGRRIVDFVLSNFANSGV
ACEA_KLULA      ----------------------------------------------------------------------
GLMU_VIBHB      -------------------------SAVILAAGKGTRMYS---NMPKVLHTLAGKPMAKHVIDTCTGLGA
GLMU_PSEP1      ---------------------------VILAAGQGTRMRSAL---PKVLHPVAGNSMLGHVIHSARQLQP
GLMU_PROM9      -------------------------SVAILAAGKGTRMESSI---PKVLHKISGKSLLQRVIDSCVELNP
GLMU_KLEP7      -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKPMVQHVIDAANDLGA
GLMU_KLEP3      -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKPMVQHVIDAANDLGA
GLMU_DESHY      -------------------------AAVIMAAGKGTRMKSKL---PKVMHTLAGKPMLQHVLDCVRSVEI
GLGC_PROAC      --------------------------SIVLAGGEGKRLMPLTMDRAKPAVPFGGTRLIDFVLSNLANSGL
GLGC_COREF      --------------------------AIVLAGGEGKRLFPLTEDRAKPAVPFGGTRLIDFVLSNLVNAGY
GALU_MYCGE      --------------------------AVIPAAGLGVRLLPATKAIPKEMLPLVNKPTIQYIVEEAVKSGI
ACEA_EMENI      ----------------------------------------------------------------------
YTDA_BACSU      --------------------------AIIPAGGFGTRNLPVTKVIPKEMFPVGSKPVIHYLVEELKESGI
MPG1_PICAN      ---------------------------LILVGGYGTRLRPLTLSLPKPLVEFGNRPMILHQIEALANAGC
GLMU_PSYCK      -------------------------SVIILAAGKGTRMQSA---KPKVLQTLAGKSLLGHVLDTCHQLTV
GLMU_PROMS      -------------------------SVAILAAGKGTRMES---SLPKVLHKISGKSLLQRVIDSCAELKP
GLMU_NITOC      -------------------------SVIILAAGQGTRMHSTL---PKVLHQLAGRPLLSHVIATARQLNP
GLMU_LISMH      --------------------------AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDQISTLNV
GLMU_LISMF      --------------------------AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDQISTLNV
GLMU_LISMC      --------------------------AVVLAAGQGTRMKSKLY---KVLHPVCGKPMVEHVVDQISTLNV
GLMU_DESHD      -------------------------AAVIMAAGKGTRMKSKL---PKVMHTLAGKPMLQHVLDCVRSVEI
GLMU_CLOBM      --------------------------AIILAAGKGKRMKS---SMPKVVHKVCGKEMVNHVIDNVRKANI
GLMU_CLOB6      --------------------------AIILAAGKGKRMKS---SMPKVVHKVCGKEMINHVIDNVRKANI
GLMU_CLOAB      --------------------------ALILAAGKGKRMKS---DLPKVLHKVCDKEMVNHVIDTMRKSEL
GLMU_ACIBY      ------------------------TTVIILAAGKGTRMRS---QLPKVLQPLAGRPLLGHVIKTAKQLLA
GLMU_ACIBC      ------------------------TTVIILAAGKGTRMRS---QLPKVLQPLAGRPLLGHVIKTAKQLLA
GLGC_DECAR      --------------------------AIILAGGRGTRLKQLTDFRSKPAVPFAGKRILDFTLSNCVNSGI
GLGC_CORDI      --------------------------AIVLAGGEGKRLFPLTEDRAKPAVPFGGTRLIDFVLSNLVNAGY
GLGC_ANASK      --------------------------AMILAGGEGRRLDPLTRDRAKPAVPFGGRRIVDFVLSNMANSGI
GLGC_ANADE      --------------------------AMILAGGEGRRLDPLTRDRAKPAVPFGGRRIVDFVLSNMANSGI
GLGC_ANAD2      --------------------------AMILAGGEGRRLDPLTRDRAKPAVPFGGRRIVDFVLSNMANSGI
GALF_SALTY      --------------------------AVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGI
GALF_SALTI      --------------------------AVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGI
GALF_KLEPN      --------------------------AVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGI
CAP4C_STRPN     --------------------------AVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGI
ACEA_COCIM      ----------------------------------------------------------------------
GLMU_STRMU      --------------------------AIILAAGKGTRMKS---DLPKVLHQVAGLTMLEHVKRAVDTMNP
GLMU_SHISS      -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
GLMU_SHIFL      -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
GLMU_SHIF8      -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
GLMU_SHIDS      -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
GLMU_SHIBS      -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
GLMU_SHIB3      -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGKAMVQHVIDAANELGA
GLMU_PSYWF      -------------------------TTIILAAGKGTRMQSA---KPKVLQILADKPLLAHVLDTCQSISV
GLMU_OCHA4      --------------------------SIVLAAGEGTRMKS---NLPKVLHQVAGLPLVSHVVTAVQGTGK
GLMU_LEGPH      ---------------------------IILAAGQGKRMYS---DTPKVLHHLAGKPLLTHVVETAQQLNP
GLMU_ESCF3      -------------------------SVVILAAGKGTRMYS---DLPKVLHTLAGK