[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08803.1

[Show Plain Result]


## Summary of Sequence Search
    1::238
    4::231     4e-30  37%  244 aa  FABG_VIBHA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::233     9e-30  34%  246 aa  NODG_AZOBR RecName: Full=Nodulation protein G;
   35::266     2e-29  40%  278 aa  FIXR_BRAJA RecName: Full=Protein fixR;
   76::308     2e-29  39%  320 aa  FABG_CUPLA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::231     1e-28  35%  244 aa  FABG_SHIFL RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::231     1e-28  35%  244 aa  FABG_ECOLI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    6::234     1e-27  37%  247 aa  FABG_PSEAE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::234     1e-27  32%  246 aa  FABG_BACSU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::231     3e-27  35%  244 aa  FABG_BUCAP RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::229     1e-26  33%  242 aa  FABG_HAEIN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::237     1e-26  32%  248 aa  FABG_CHLTR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::234     6e-26  36%  246 aa  FABG_THEMA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    7::234     1e-25  37%  247 aa  FABG1_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::243     2e-25  36%  256 aa  BUDC_KLEPN RecName: Full=Acetoin(diacetyl) reductase;       
    3::232     2e-25  31%  244 aa  FABG_STAES RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::232     2e-25  31%  244 aa  FABG_STAEQ RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    7::228     3e-25  31%  241 aa  FABG_RICPR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   16::233     3e-25  32%  247 aa  FABG_MYCTU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   16::233     3e-25  32%  247 aa  FABG_MYCBO RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   24::240     4e-25  34%  255 aa  FABG_MYCS2 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::235     7e-25  33%  248 aa  PHAB_ACISR RecName: Full=Acetoacetyl-CoA reductase;       
    7::232     7e-25  35%  245 aa  NODG_RHIS3 RecName: Full=Nodulation protein G;
    3::233     9e-25  33%  246 aa  PHBB_RALEH RecName: Full=Acetoacetyl-CoA reductase;       
    1::234     9e-25  30%  246 aa  FABG_STAAW RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::234     9e-25  30%  246 aa  FABG_STAAS RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::234     9e-25  30%  246 aa  FABG_STAAR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::234     9e-25  30%  246 aa  FABG_STAAN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::234     9e-25  30%  246 aa  FABG_STAAM RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    1::234     9e-25  30%  246 aa  FABG_STAAC RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::237     1e-24  36%  248 aa  FABG_AQUAE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    7::243     2e-24  35%  263 aa  UCPA_SALTY RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
    7::243     2e-24  35%  263 aa  UCPA_SALTI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   24::240     2e-24  33%  255 aa  FABG_MYCAV RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::230     3e-24  35%  242 aa  YMFI_BACSU RecName: Full=Uncharacterized oxidoreductase ymfI;      
   91::316     3e-24  37%  328 aa  FABG2_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::231     4e-24  33%  244 aa  FABG_SALTY RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::231     4e-24  33%  244 aa  FABG_SALTI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::237     1e-23  31%  248 aa  FABG_CHLMU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    7::243     1e-23  34%  263 aa  UCPA_ECOLI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
    3::228     1e-23  35%  241 aa  PHBB_RHIME RecName: Full=Acetoacetyl-CoA reductase;       
    4::231     1e-23  32%  244 aa  FABG_VIBCH RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   78::303     1e-23  36%  315 aa  FABG3_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   83::308     1e-23  36%  320 aa  FABG1_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::244     2e-23  34%  257 aa  YXJF_BACSU RecName: Full=Uncharacterized oxidoreductase yxjF;      
   10::233     2e-23  38%  246 aa  DER_CHICK RecName: Full=D-erythrulose reductase;       
    7::243     3e-23  34%  263 aa  UCPA_ECO57 RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
    5::248     4e-23  38%  261 aa  ACT3_STRCO RecName: Full=Putative ketoacyl reductase;       
    8::231     5e-23  36%  244 aa  DCXR_BOVIN RecName: Full=L-xylulose reductase;         Short=XR;   
   23::257     8e-23  33%  273 aa  TRN1_DATST RecName: Full=Tropinone reductase 1;       
    5::232     8e-23  29%  245 aa  FABG_BUCBP RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   19::252     1e-22  32%  268 aa  TRNH_DATST RecName: Full=Tropinone reductase homolog;       
   15::246     1e-22  32%  260 aa  DHRS4_RABIT RecName: Full=Dehydrogenase/reductase SDR family member
    3::245     1e-22  33%  258 aa  BDHA_RHIME RecName: Full=D-beta-hydroxybutyrate dehydrogenase;     
    3::233     2e-22  33%  253 aa  YOHF_ECOLI RecName: Full=Uncharacterized oxidoreductase yohF;      
    3::228     2e-22  33%  242 aa  PHAB_PARDE RecName: Full=Acetoacetyl-CoA reductase;       
    7::248     2e-22  40%  261 aa  DHKR_STRCM RecName: Full=Monensin polyketide synthase putative
   14::252     4e-22  33%  267 aa  LVR_LEIAQ RecName: Full=Levodione reductase;       
   13::240     7e-22  32%  254 aa  KDUD_BACSU RecName: Full=2-dehydro-3-deoxy-D-gluconate
   80::305     7e-22  36%  317 aa  FABG5_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::228     9e-22  36%  258 aa  YLX6_SCHPO RecName: Full=Uncharacterized oxidoreductase C922.06;   
    5::189     2e-21  32%  230 aa  Y2049_STAEQ RecName: Full=Uncharacterized oxidoreductase SERP2049; 
    5::189     2e-21  32%  230 aa  Y2036_STAES RecName: Full=Uncharacterized oxidoreductase SE_2036;  
    2::190     2e-21  37%  241 aa  BUDC_KLETE RecName: Full=Acetoin(diacetyl) reductase;       
   11::244     3e-21  31%  260 aa  TRN2_DATST RecName: Full=Tropinone reductase 2;       
   55::232     4e-21  34%  245 aa  NODG_RHIME RecName: Full=Nodulation protein G;AltName:
   14::241     4e-21  38%  256 aa  GNO_GLUOX RecName: Full=Gluconate 5-dehydrogenase;       
   21::242     5e-21  36%  254 aa  FABG4_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   13::246     5e-21  31%  260 aa  DHRS4_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   11::239     6e-21  31%  253 aa  KDUD_DICD3 RecName: Full=2-dehydro-3-deoxy-D-gluconate
   11::244     8e-21  31%  260 aa  TRN2_HYONI RecName: Full=Tropinone reductase 2;       
    5::231     1e-20  31%  244 aa  FABG_BUCAI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::236     2e-20  34%  250 aa  HCDR_XANP2 RecName: Full=2-(R)-hydroxypropyl-CoM dehydrogenase;    
   13::238     2e-20  33%  251 aa  DCXR_CAEEL RecName: Full=Probable L-xylulose reductase;       
    4::237     3e-20  37%  247 aa  YGFF_ECOLI RecName: Full=Uncharacterized oxidoreductase ygfF;      
   52::233     3e-20  30%  246 aa  PHBB_CHRVI RecName: Full=Acetoacetyl-CoA reductase;       
   40::271     4e-20  34%  285 aa  YHXC_BACSU RecName: Full=Uncharacterized oxidoreductase yhxC;      
   76::228     4e-20  35%  241 aa  PHBB_ZOORA RecName: Full=Acetoacetyl-CoA reductase;       
    7::236     4e-20  32%  250 aa  CPNA_COMTE RecName: Full=Cyclopentanol dehydrogenase;       
    7::236     4e-20  32%  250 aa  CPNA_COMS9 RecName: Full=Cyclopentanol dehydrogenase;       
   55::228     1e-19  28%  241 aa  FABG_RICBR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    7::224     1e-19  29%  240 aa  FABG2_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   60::228     1e-19  31%  241 aa  FABG_RICTY RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::236     1e-19  31%  248 aa  FABG_CHLPN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   10::244     2e-19  34%  256 aa  RHLG_PSEAE RecName: Full=Rhamnolipids biosynthesis
   14::249     3e-19  36%  261 aa  DHB8_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
    8::231     3e-19  34%  244 aa  DCXR_RAT RecName: Full=L-xylulose reductase;         Short=XR;     
   12::244     3e-19  36%  260 aa  DHR11_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   14::247     3e-19  37%  259 aa  DHB8_CANFA RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
   12::246     3e-19  31%  259 aa  CMTB_PSEPU RecName: Full=2,3-dihydroxy-2,3-dihydro-p-cumate
   12::246     3e-19  31%  259 aa  CMTB_PSEP1 RecName: Full=2,3-dihydroxy-2,3-dihydro-p-cumate
    7::236     4e-19  35%  255 aa  DHR11_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
    1::245     4e-19  30%  258 aa  BUTA_STAAW RecName: Full=Acetoin(diacetyl) reductase;       
    1::245     4e-19  30%  258 aa  BUTA_STAAS RecName: Full=Acetoin(diacetyl) reductase;       
    1::245     4e-19  30%  258 aa  BUTA_STAAR RecName: Full=Acetoin(diacetyl) reductase;       
    1::245     4e-19  30%  258 aa  BUTA_STAAN RecName: Full=Acetoin(diacetyl) reductase;       
    1::245     4e-19  30%  258 aa  BUTA_STAAM RecName: Full=Acetoin(diacetyl) reductase;       
    1::245     4e-19  30%  258 aa  BUTA_STAAC RecName: Full=Acetoin(diacetyl) reductase;       
    2::236     6e-19  31%  254 aa  FADH_BACSU RecName: Full=Probable 2,4-dienoyl-CoA reductase;       
    7::236     6e-19  35%  255 aa  DHR11_CHICK RecName: Full=Dehydrogenase/reductase SDR family member
    3::244     6e-19  29%  257 aa  BUTA_STAEQ RecName: Full=Acetoin(diacetyl) reductase;       
    8::228     7e-19  32%  260 aa  HSD_MYCTU RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
    8::228     7e-19  32%  260 aa  HSD_MYCBO RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
   52::237     7e-19  31%  249 aa  BAIA1_EUBSP RecName: Full=Bile acid 7-dehydroxylase 1/3;       
    8::231     1e-18  34%  244 aa  DCXR_MOUSE RecName: Full=L-xylulose reductase;         Short=XR;   
   10::225     1e-18  35%  244 aa  CBR2_PIG RecName: Full=Carbonyl reductase [NADPH] 2;       
   82::237     1e-18  37%  548 aa  Y4VI_RHISN RecName: Full=Uncharacterized short-chain type
    6::240     1e-18  31%  253 aa  BACC2_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
    4::238     2e-18  34%  251 aa  YJDA_BACSU RecName: Full=Uncharacterized oxidoreductase yjdA;      
    6::248     3e-18  32%  263 aa  YVRD_BACSU RecName: Full=Uncharacterized oxidoreductase yvrD;      
   63::235     3e-18  33%  247 aa  Y1385_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb1385;   
   63::235     3e-18  33%  247 aa  Y1350_MYCTU RecName: Full=Uncharacterized oxidoreductase
  121::307     3e-18  35%  319 aa  FABG_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   46::275     4e-18  32%  289 aa  YHDF_BACSU RecName: Full=Uncharacterized oxidoreductase yhdF;      
   75::237     4e-18  33%  248 aa  Y182_METEA RecName: Full=Uncharacterized oxidoreductase
   38::270     4e-18  35%  288 aa  GRDH1_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog
   13::245     4e-18  30%  260 aa  DHRS4_PIG RecName: Full=Dehydrogenase/reductase SDR family member
    4::231     5e-18  32%  242 aa  FABG_ACTAC RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::231     5e-18  33%  244 aa  DCXR_MESAU RecName: Full=L-xylulose reductase;         Short=XR;   
    6::240     5e-18  35%  253 aa  BACC_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
    7::233     6e-18  30%  245 aa  BDH2_MOUSE RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
    5::235     8e-18  31%  248 aa  YKVO_BACSU RecName: Full=Uncharacterized oxidoreductase ykvO;      
   83::241     8e-18  34%  258 aa  BDHA_RALEH RecName: Full=D-beta-hydroxybutyrate dehydrogenase;     
   12::241     1e-17  36%  260 aa  DHR11_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   19::247     1e-17  28%  261 aa  YGCW_ECOLI RecName: Full=Uncharacterized oxidoreductase ygcW;      
   13::254     1e-17  35%  267 aa  SORD_KLEPN RecName: Full=Sorbitol-6-phosphate 2-dehydrogenase;     
   11::237     2e-17  33%  255 aa  Y3106_PSEAE RecName: Full=Uncharacterized oxidoreductase PA3106;   
   62::239     2e-17  35%  253 aa  KDUD_ECOLI RecName: Full=2-dehydro-3-deoxy-D-gluconate
    8::231     2e-17  33%  244 aa  DCXR_CAVPO RecName: Full=L-xylulose reductase;         Short=XR;   
   10::225     2e-17  32%  244 aa  CBR2_MOUSE RecName: Full=Carbonyl reductase [NADPH] 2;       
    7::221     2e-17  28%  231 aa  Y2778_STAA8 RecName: Full=Uncharacterized oxidoreductase
    7::221     2e-17  28%  231 aa  Y2488_STAAC RecName: Full=Uncharacterized oxidoreductase SACOL2488;
    7::221     2e-17  28%  231 aa  Y2422_STAA3 RecName: Full=Uncharacterized oxidoreductase
   55::228     2e-17  27%  241 aa  FABG_RICFE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    7::216     3e-17  29%  231 aa  Y2403_STAAW RecName: Full=Uncharacterized oxidoreductase MW2403;   
    7::216     3e-17  29%  231 aa  Y2370_STAAS RecName: Full=Uncharacterized oxidoreductase SAS2370;  
   11::203     4e-17  31%  259 aa  YQJQ_BACSU RecName: Full=Uncharacterized oxidoreductase yqjQ;      
    6::238     4e-17  31%  251 aa  Y325_THEMA RecName: Full=Uncharacterized oxidoreductase TM_0325;   
    7::216     4e-17  29%  231 aa  Y2478_STAAM RecName: Full=Uncharacterized oxidoreductase SAV2478;  
    7::216     4e-17  29%  231 aa  Y2266_STAAN RecName: Full=Uncharacterized oxidoreductase SA2266;   
    3::191     4e-17  34%  311 aa  RDH8_HUMAN RecName: Full=Retinol dehydrogenase 8;       
   15::255     4e-17  28%  303 aa  PECR_PONAB RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
    8::240     4e-17  32%  261 aa  DHG2_BACME RecName: Full=Glucose 1-dehydrogenase 2;       
   87::231     5e-17  34%  244 aa  NOG4_RHIME RecName: Full=Nodulation protein G;AltName:
   10::239     5e-17  30%  254 aa  IDNO_ECOLI RecName: Full=Gluconate 5-dehydrogenase;       
   10::239     5e-17  30%  254 aa  IDNO_ECOL6 RecName: Full=Gluconate 5-dehydrogenase;       
   10::234     5e-17  30%  248 aa  ENTA_ECOLI RecName: Full=2,3-dihydro-2,3-dihydroxybenzoate
    8::231     5e-17  32%  244 aa  DCXR_HUMAN RecName: Full=L-xylulose reductase;         Short=XR;   
   15::245     7e-17  31%  266 aa  TRNH1_ARATH RecName: Full=Tropinone reductase homolog At1g07440;   
    9::226     7e-17  36%  906 aa  FOX2_CANTR RecName: Full=Peroxisomal
   60::228     7e-17  29%  241 aa  FABG_RICCN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    3::216     7e-17  32%  236 aa  CBR4_XENTR RecName: Full=Carbonyl reductase family member 4;       
   81::258     9e-17  30%  292 aa  SPS19_YEAST RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase
   68::240     9e-17  27%  255 aa  HDHA_ECOLI RecName: Full=7-alpha-hydroxysteroid dehydrogenase;     
   68::240     9e-17  27%  255 aa  HDHA_ECO57 RecName: Full=7-alpha-hydroxysteroid dehydrogenase;     
  315::522     9e-17  34%  894 aa  FOX2_NEUCR RecName: Full=Peroxisomal
   52::237     9e-17  30%  249 aa  BAIA2_EUBSP RecName: Full=Bile acid 7-dehydroxylase 2;       
    7::221     1e-16  26%  231 aa  Y2567_STAAR RecName: Full=Uncharacterized oxidoreductase SAR2567;  
   15::255     1e-16  29%  303 aa  PECR_HUMAN RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
   42::275     1e-16  35%  291 aa  GRDH_DAUCA RecName: Full=Glucose and ribitol dehydrogenase;        
   58::236     2e-16  33%  249 aa  HCDS_XANP2 RecName: Full=2-(S)-hydroxypropyl-CoM dehydrogenase;    
    8::185     2e-16  38%  251 aa  Y484_MYCTU RecName: Full=Uncharacterized oxidoreductase
    5::240     2e-16  29%  267 aa  HDHA_CLOSO RecName: Full=NADP-dependent 7-alpha-hydroxysteroid
   65::244     2e-16  31%  257 aa  BUTA_STAES RecName: Full=Acetoin(diacetyl) reductase;       
    7::225     3e-16  30%  237 aa  YJGI_ECOLI RecName: Full=Uncharacterized oxidoreductase yjgI;      
   43::237     3e-16  32%  250 aa  LINC_PSEPA RecName: Full=2,5-dichloro-2,5-cyclohexadiene-1,4-diol
   12::248     3e-16  28%  262 aa  VIBA_VIBCH RecName: Full=Vibriobactin-specific
   10::188     3e-16  32%  284 aa  VDLC_HELPY RecName: Full=Probable short-chain type
    8::248     5e-16  33%  264 aa  YVAG_BACSU RecName: Full=Uncharacterized oxidoreductase yvaG;      
    3::238     5e-16  31%  280 aa  YUSZ_BACSU RecName: Full=Uncharacterized oxidoreductase yusZ;      
    6::241     5e-16  33%  254 aa  BACC_BACAM RecName: Full=Bacilysin biosynthesis oxidoreductase
   15::245     6e-16  28%  260 aa  DHRS4_RAT RecName: Full=Dehydrogenase/reductase SDR family member
   29::261     6e-16  31%  292 aa  DECR2_HUMAN RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
   36::268     6e-16  29%  300 aa  DECR2_DANRE RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
   51::189     8e-16  39%  201 aa  FABG6_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   15::245     8e-16  28%  260 aa  DHRS4_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   46::233     8e-16  32%  245 aa  BDH2_HUMAN RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
   52::233     1e-15  33%  255 aa  HSD_STREX RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
   40::271     1e-15  33%  289 aa  GRDH2_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog
   29::261     1e-15  31%  292 aa  DECR2_PONAB RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
    8::245     1e-15  31%  269 aa  XYLL_PSEPU RecName:
    3::217     1e-15  31%  237 aa  CBR4_DANRE RecName: Full=Carbonyl reductase family member 4;       
    4::195     2e-15  34%  249 aa  SDH_RHIRD RecName: Full=Serine 3-dehydrogenase;       
   43::272     2e-15  32%  286 aa  GS39_BACSU RecName: Full=General stress protein 39;       
   30::255     2e-15  28%  303 aa  PECR_RAT RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;    
    2::177     4e-15  33%  271 aa  VDLC_HELPJ RecName: Full=Probable short-chain type
   16::229     4e-15  34%  295 aa  ACR1_ACIBI RecName: Full=Fatty acyl-CoA reductase;       
   24::237     4e-15  34%  303 aa  ACR1_ACIAD RecName: Full=Fatty acyl-CoA reductase;       
    2::236     5e-15  34%  255 aa  YTKK_BACSU RecName: Full=Putative oxidoreductase ytkK;       
   13::241     5e-15  35%  267 aa  YM71_YEAST RecName: Full=Uncharacterized oxidoreductase YMR226C;   
   40::272     5e-15  33%  286 aa  YAY8_SCHPO RecName: Full=Uncharacterized oxidoreductase C4H3.08;   
  203::394     6e-15  33%  430 aa  MAS12_AGRRH RecName: Full=Agropine synthesis reductase;       
   74::233     8e-15  31%  245 aa  BDH2_BOVIN RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
   15::207     1e-14  30%  269 aa  YBBO_ECOLI RecName: Full=Uncharacterized oxidoreductase ybbO;      
   15::207     1e-14  30%  269 aa  YBBO_ECOL6 RecName: Full=Uncharacterized oxidoreductase ybbO;      
   84::240     1e-14  32%  278 aa  Y4LA_RHISN RecName: Full=Uncharacterized short-chain type
    7::193     1e-14  27%  234 aa  Y0419_STAS1 RecName: Full=Uncharacterized oxidoreductase SSP0419;  
  203::405     1e-14  33%  430 aa  MAS1_AGRT9 RecName: Full=Agropine synthesis reductase;       
  102::286     1e-14  32%  300 aa  GRDH_ORYSJ RecName: Full=Glucose and ribitol dehydrogenase homolog;
   15::245     1e-14  27%  260 aa  DHRS4_PONAB RecName: Full=Dehydrogenase/reductase SDR family member
   15::245     1e-14  27%  260 aa  DHRS4_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   63::243     2e-14  29%  273 aa  YXBG_BACSU RecName: Full=Uncharacterized oxidoreductase yxbG;      
    2::222     2e-14  28%  236 aa  FABG_SCHPO RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   60::292     2e-14  30%  335 aa  DECR_RAT RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial;   
   60::292     2e-14  30%  335 aa  DECR_MOUSE RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial; 
  104::281     3e-14  31%  294 aa  YGHA_ECOLI RecName: Full=Uncharacterized oxidoreductase yghA;      
  104::281     3e-14  31%  294 aa  YGHA_ECO57 RecName: Full=Uncharacterized oxidoreductase yghA;      
   64::250     3e-14  34%  272 aa  DHK1_STRVN RecName: Full=Granaticin polyketide synthase putative
    6::241     3e-14  29%  262 aa  DHGB_BACME RecName: Full=Glucose 1-dehydrogenase B;       
    7::247     3e-14  29%  261 aa  DHBA_BACSU RecName: Full=2,3-dihydro-2,3-dihydroxybenzoate
   84::240     4e-14  31%  281 aa  Y2146_BRAJA RecName: Full=Probable short-chain type
   25::261     4e-14  30%  292 aa  DECR2_RAT RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;     
   64::250     6e-14  32%  262 aa  VER1_ASPPA RecName: Full=Versicolorin reductase;       
    3::216     6e-14  27%  236 aa  CBR4_XENLA RecName: Full=Carbonyl reductase family member 4;       
   22::259     7e-14  32%  271 aa  SDR1_PICAB RecName: Full=Short-chain type dehydrogenase/reductase; 
    6::242     7e-14  28%  256 aa  DHSO_RHOSH RecName: Full=Sorbitol dehydrogenase;       
   54::243     7e-14  29%  326 aa  DHRS7_DROME RecName: Full=Dehydrogenase/reductase SDR family
    8::221     7e-14  33%  258 aa  DHG2_BACSU RecName: Full=Glucose 1-dehydrogenase 2;       
    1::235     9e-14  26%  250 aa  FABL_BACSU RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    4::195     1e-13  33%  249 aa  SDH_AGRT5 RecName: Full=Serine 3-dehydrogenase;       
  100::254     2e-13  32%  302 aa  PECR_CAVPO RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
   14::247     2e-13  29%  259 aa  DHB8_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 8;       
    8::224     3e-13  33%  261 aa  DHGA_BACME RecName: Full=Glucose 1-dehydrogenase A;       
    8::191     3e-13  35%  276 aa  BPHB_PSES1 RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
    8::249     3e-13  30%  261 aa  BEND_ACIAD RecName:
   73::242     4e-13  32%  255 aa  SOU1_SCHPO RecName: Full=Sorbose reductase sou1;       
    6::192     4e-13  33%  312 aa  RDH8_BOVIN RecName: Full=Retinol dehydrogenase 8;       
    8::224     4e-13  30%  261 aa  DHG3_BACME RecName: Full=Glucose 1-dehydrogenase 3;       
   82::285     4e-13  33%  381 aa  DHB2_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 2;       
    9::209     4e-13  32%  277 aa  BPHB_BURXL RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
    7::185     5e-13  30%  292 aa  YQ53_SCHPO RecName: Full=Uncharacterized oxidoreductase C162.03;   
   86::240     5e-13  30%  261 aa  DHG_BACSU RecName: Full=Glucose 1-dehydrogenase;       
   81::290     5e-13  34%  387 aa  DHB2_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 2;        
   88::255     6e-13  25%  303 aa  PECR_MOUSE RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
   13::243     6e-13  33%  261 aa  HCD2_RAT RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;     
    8::224     6e-13  30%  261 aa  DHG4_BACME RecName: Full=Glucose 1-dehydrogenase 4;       
   61::248     6e-13  30%  260 aa  DHB8_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
   82::270     6e-13  33%  381 aa  DHB2_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 2;        
    3::224     8e-13  29%  259 aa  YWFH_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
   28::271     8e-13  26%  283 aa  T4HR_MAGGR RecName: Full=Tetrahydroxynaphthalene reductase;        
   66::252     8e-13  31%  264 aa  STCU_EMENI RecName: Full=Versicolorin reductase;       
    9::191     8e-13  39%  277 aa  BPHB_PSEPU RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
    1::189     1e-12  29%  259 aa  NAHB_PSEU8 RecName: Full=1,2-dihydroxy-1,2-dihydronaphthalene
    1::189     1e-12  29%  259 aa  NAHB_PSEPU RecName: Full=1,2-dihydroxy-1,2-dihydronaphthalene
   48::131     1e-12  40%  134 aa  DHB8_CALJA RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
    3::217     1e-12  28%  237 aa  CBR4_BOVIN RecName: Full=Carbonyl reductase family member 4;       
    6::240     1e-12  26%  253 aa  Y4MP_RHISN RecName: Full=Uncharacterized short-chain type
    7::228     1e-12  29%  246 aa  Y1627_STAS1 RecName: Full=Uncharacterized oxidoreductase SSP1627;  
   14::247     1e-12  31%  259 aa  DHB8_PIG RecName: Full=Estradiol 17-beta-dehydrogenase 8;       
   30::268     2e-12  26%  272 aa  THR1_GLOLA RecName: Full=Trihydroxynaphthalene reductase;       
    3::203     2e-12  32%  328 aa  DHB1_PANTR RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
    7::191     2e-12  31%  344 aa  DHB1_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 1;       
  107::262     3e-12  31%  313 aa  YXEK_CAEEL RecName: Full=Uncharacterized oxidoreductase F53C11.3;  
    4::186     3e-12  30%  248 aa  Y4EK_RHISN RecName: Full=Uncharacterized short-chain type
  103::236     3e-12  36%  257 aa  MOAE_KLEAE RecName: Full=Protein moaE;
   36::254     3e-12  28%  331 aa  KDSR_BOVIN RecName: Full=3-ketodihydrosphingosine reductase;       
   55::241     3e-12  33%  339 aa  DHRS7_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   60::239     3e-12  30%  270 aa  DHB14_HUMAN RecName: Full=17-beta-hydroxysteroid dehydrogenase 14; 
    7::194     4e-12  31%  344 aa  DHB1_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
    3::203     4e-12  31%  328 aa  DHB1_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
    5::264     5e-12  32%  277 aa  LIMC_RHOER RecName: Full=(-)-trans-carveol dehydrogenase;       
   93::226     5e-12  33%  900 aa  FOX2_YEAST RecName: Full=Peroxisomal
  145::286     7e-12  33%  299 aa  YHXD_BACSU RecName: Full=Uncharacterized oxidoreductase yhxD;      
   57::190     7e-12  27%  231 aa  Y0585_STAHJ RecName: Full=Uncharacterized oxidoreductase SH0585;   
   36::254     7e-12  29%  332 aa  KDSR_HUMAN RecName: Full=3-ketodihydrosphingosine reductase;       
   55::243     7e-12  33%  338 aa  DHRS7_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
    7::230     7e-12  31%  249 aa  DHK2_STRVN RecName: Full=Granaticin polyketide synthase putative
    3::194     9e-12  33%  263 aa  YIV6_YEAST RecName: Full=Uncharacterized oxidoreductase YIR036C;   
    8::236     9e-12  26%  250 aa  LINX_PSEPA RecName: Full=2,5-dichloro-2,5-cyclohexadiene-1,4-diol
   56::291     9e-12  29%  344 aa  BDH_BOVIN RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
   66::225     1e-11  30%  736 aa  DHB4_HUMAN RecName: Full=Peroxisomal multifunctional enzyme type 2;
    8::191     1e-11  30%  281 aa  BPHB_COMTE RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
   59::252     1e-11  28%  320 aa  DHB12_XENTR RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   57::250     1e-11  32%  318 aa  DH12B_XENLA RecName: Full=Estradiol 17-beta-dehydrogenase 12-B;    
   57::250     1e-11  30%  318 aa  DH12A_XENLA RecName: Full=Estradiol 17-beta-dehydrogenase 12-A;    
   52::244     2e-11  27%  312 aa  DHB12_ANAPL RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   12::249     3e-11  28%  262 aa  MTDH_AGABI RecName: Full=NADP-dependent mannitol dehydrogenase;    
   11::262     3e-11  27%  278 aa  UXUB_BACSU RecName: Full=Uncharacterized oxidoreductase uxuB;      
    1::231     3e-11  32%  255 aa  HCD2_DROME RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   92::225     3e-11  33%  735 aa  DHB4_MOUSE RecName: Full=Peroxisomal multifunctional enzyme type 2;
   36::254     4e-11  28%  332 aa  KDSR_MOUSE RecName: Full=3-ketodihydrosphingosine reductase;       
   84::243     4e-11  35%  261 aa  HCD2_HUMAN RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   92::225     4e-11  33%  735 aa  DHB4_RAT RecName: Full=Peroxisomal multifunctional enzyme type 2;  
    3::216     4e-11  24%  236 aa  CBR4_MOUSE RecName: Full=Carbonyl reductase family member 4;       
   22::248     7e-11  30%  261 aa  YQC8_SCHPO RecName: Full=Uncharacterized oxidoreductase C1739.08c; 
   84::192     7e-11  31%  238 aa  YOXD_BACSU RecName: Full=Uncharacterized oxidoreductase yoxD;      
   13::230     7e-11  36%  252 aa  YCIK_ECOLI RecName: Full=Uncharacterized oxidoreductase yciK;      
  203::405     7e-11  32%  430 aa  MAS11_AGRRH RecName: Full=Agropine synthesis reductase;       
   56::242     7e-11  31%  323 aa  DRS7B_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   17::264     7e-11  25%  278 aa  ARDH_PICST RecName: Full=D-arabinitol 2-dehydrogenase
  106::261     1e-10  30%  309 aa  YVX3_CAEEL RecName: Full=Uncharacterized oxidoreductase T05C12.3;  
   15::230     1e-10  28%  249 aa  RIDH_KLEAE RecName: Full=Ribitol 2-dehydrogenase;       
   63::188     1e-10  33%  287 aa  HETN_ANASP RecName: Full=Ketoacyl reductase hetN;       
   40::228     1e-10  28%  323 aa  DRS7B_XENLA RecName: Full=Dehydrogenase/reductase SDR family member
  124::292     1e-10  31%  335 aa  DECR_HUMAN RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial; 
    9::207     1e-10  30%  275 aa  BPHB_PSEPS RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
   83::292     2e-10  28%  386 aa  DHI2_MOUSE RecName: Full=Corticosteroid 11-beta-dehydrogenase
   53::239     2e-10  27%  343 aa  BDH_RAT RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
  114::268     2e-10  28%  282 aa  ARDH_CANTR RecName: Full=D-arabinitol 2-dehydrogenase
    4::136     2e-10  38%  248 aa  YDFG_SHIFL RecName: Full=NADP-dependent L-serine/L-allo-threonine
    4::196     2e-10  30%  248 aa  YDFG_SALTY RecName: Full=NADP-dependent L-serine/L-allo-threonine
    4::196     2e-10  30%  248 aa  YDFG_SALTI RecName: Full=NADP-dependent L-serine/L-allo-threonine
   52::238     2e-10  26%  256 aa  Y019_THEMA RecName: Full=Uncharacterized oxidoreductase TM_0019;   
   13::243     2e-10  32%  261 aa  HCD2_MOUSE RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   40::228     2e-10  28%  309 aa  DRS7B_XENTR RecName: Full=Dehydrogenase/reductase SDR family member
   83::292     2e-10  29%  400 aa  DHI2_RAT RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme
  106::261     3e-10  28%  309 aa  YWC4_CAEEL RecName: Full=Uncharacterized oxidoreductase W01C9.4;   
    3::185     3e-10  34%  254 aa  YIV5_YEAST RecName: Full=Uncharacterized oxidoreductase YIR035C;   
   39::274     3e-10  30%  331 aa  RDH13_HUMAN RecName: Full=Retinol dehydrogenase 13;       
   40::209     3e-10  29%  300 aa  DHB11_PONAB RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
   53::239     3e-10  25%  343 aa  BDH_MOUSE RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
   49::239     4e-10  32%  317 aa  DHRS7_ANOGA RecName: Full=Dehydrogenase/reductase SDR family
    3::216     4e-10  25%  236 aa  CBR4_RAT RecName: Full=Carbonyl reductase family member 4;       
    4::228     5e-10  26%  248 aa  Y432_LISMO RecName: Full=Uncharacterized oxidoreductase Lmo0432;   
  128::265     5e-10  29%  285 aa  Y048_HAEIN RecName: Full=Uncharacterized oxidoreductase HI0048;    
   68::255     5e-10  28%  330 aa  HSDL1_HUMAN RecName: Full=Hydroxysteroid dehydrogenase-like protein
   40::209     5e-10  29%  298 aa  DHB11_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 11;        
   40::209     5e-10  29%  300 aa  DHB11_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
   25::261     5e-10  28%  292 aa  DECR2_MOUSE RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
    3::217     5e-10  25%  237 aa  CBR4_HUMAN RecName: Full=Carbonyl reductase family member 4;       
    4::136     6e-10  34%  248 aa  YDFG_ECOL6 RecName: Full=NADP-dependent L-serine/L-allo-threonine
   63::192     6e-10  29%  253 aa  Y5909_MYXXD RecName: Full=Uncharacterized oxidoreductase MXAN_5909;
    4::228     6e-10  26%  248 aa  Y452_LISIN RecName: Full=Uncharacterized oxidoreductase Lin0452;   
   52::187     6e-10  31%  275 aa  TODD_PSEP1 RecName: Full=Cis-toluene dihydrodiol dehydrogenase;    
   52::187     6e-10  31%  275 aa  BNZE_PSEPU RecName: Full=Cis-1,2-dihydrobenzene-1,2-diol
   42::158     8e-10  32%  236 aa  YI78_SCHPO RecName: Full=Uncharacterized oxidoreductase
    6::192     8e-10  34%  265 aa  PGDH_CAVPO RecName: Full=15-hydroxyprostaglandin dehydrogenase
   68::255     1e-09  27%  331 aa  HSDL1_CHICK RecName: Full=Hydroxysteroid dehydrogenase-like protein
   72::222     1e-09  28%  312 aa  DRS7C_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
    8::125     1e-09  32%  166 aa  CSGA_MYXXA RecName: Full=C-factor;AltName: Full=C signal;
  113::267     1e-09  26%  281 aa  ARDH_CANAL RecName: Full=D-arabinitol 2-dehydrogenase
   59::251     1e-09  27%  319 aa  DH12A_DANRE RecName: Full=Estradiol 17-beta-dehydrogenase 12-A;    
   56::239     1e-09  28%  343 aa  BDH_HUMAN RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
   36::251     2e-09  25%  280 aa  SOU2_CANAL RecName: Full=Sorbose reductase homolog SOU2;       
   36::268     2e-09  23%  281 aa  SOU1_CANAL RecName: Full=Sorbose reductase SOU1;       
    1::222     2e-09  31%  240 aa  FOLM_KLEP7 RecName: Full=Dihydrofolate reductase folM;       
   56::244     2e-09  29%  325 aa  DRS7B_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   85::221     2e-09  31%  261 aa  DHG_BACME RecName: Full=Glucose 1-dehydrogenase;       
   76::221     2e-09  30%  261 aa  DHG1_BACME RecName: Full=Glucose 1-dehydrogenase 1;       
    4::136     2e-09  33%  248 aa  YDFG_ECO57 RecName: Full=NADP-dependent L-serine/L-allo-threonine
    1::228     2e-09  26%  247 aa  YB45_SCHPO RecName: Full=Uncharacterized oxidoreductase C30D10.05c;
   34::211     2e-09  27%  317 aa  RDH16_HUMAN RecName: Full=Retinol dehydrogenase 16;       
   68::255     2e-09  27%  330 aa  HSDL1_PONAB RecName: Full=Hydroxysteroid dehydrogenase-like protein
   15::244     2e-09  25%  258 aa  DHRS2_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
    4::136     3e-09  33%  248 aa  YDFG_ECOLI RecName: Full=NADP-dependent L-serine/L-allo-threonine
    6::201     3e-09  31%  246 aa  Y7799_EMENI RecName: Full=Uncharacterized oxidoreductase AN7799;   
   13::243     3e-09  26%  256 aa  MTDH_UROFA RecName: Full=Probable NADP-dependent mannitol
   68::255     3e-09  28%  330 aa  HSDL1_BOVIN RecName: Full=Hydroxysteroid dehydrogenase-like protein
   56::244     3e-09  29%  325 aa  DRS7B_PONAB RecName: Full=Dehydrogenase/reductase SDR family member
    7::189     3e-09  31%  252 aa  DLTE_BACSU RecName: Full=Uncharacterized oxidoreductase dltE;      
   40::209     4e-09  29%  298 aa  DHB11_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
    7::194     7e-09  31%  259 aa  YI13_SCHPO RecName: Full=Uncharacterized oxidoreductase C521.03;   
   35::227     7e-09  30%  308 aa  YD114_YEAST RecName: Full=Uncharacterized oxidoreductase YDL114W;  
   63::243     7e-09  31%  261 aa  HCD2_BOVIN RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   30::209     7e-09  28%  313 aa  DR9C7_MOUSE RecName: Full=Short chain dehydrogenase/reductase
   83::292     7e-09  29%  427 aa  DHI2_SHEEP RecName: Full=Corticosteroid 11-beta-dehydrogenase
   82::253     7e-09  29%  266 aa  DCXR_TRIRE RecName: Full=L-xylulose reductase;         Short=XR;   
   26::215     9e-09  28%  318 aa  RDH1_HUMAN RecName: Full=11-cis retinol dehydrogenase;       
    6::237     9e-09  30%  269 aa  PGDH_MOUSE RecName: Full=15-hydroxyprostaglandin dehydrogenase
   52::220     1e-08  33%  324 aa  MKAR_MALGO RecName: Full=3-ketoacyl-CoA reductase;       
   11::228     1e-08  30%  270 aa  HCAB_ECOLU RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     1e-08  30%  270 aa  HCAB_ECO8A RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     1e-08  31%  270 aa  HCAB_ECO7I RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   91::221     1e-08  28%  311 aa  DRS7C_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   56::244     1e-08  31%  325 aa  DRS7B_RAT RecName: Full=Dehydrogenase/reductase SDR family member
   37::209     1e-08  29%  300 aa  DHB13_RAT RecName: Full=17-beta hydroxysteroid dehydrogenase 13;   
   53::289     1e-08  27%  312 aa  DHB12_MACFA RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   53::289     1e-08  26%  312 aa  DHB12_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   53::264     1e-08  25%  312 aa  DHB12_BOVIN RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   34::222     2e-08  23%  316 aa  RDH7_MOUSE RecName: Full=Retinol dehydrogenase 7;       
   11::228     2e-08  30%  270 aa  HCAB_SHISS RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     2e-08  30%  270 aa  HCAB_SHIBS RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     2e-08  31%  270 aa  HCAB_ECOSM RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     2e-08  30%  270 aa  HCAB_ECOSE RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     2e-08  30%  270 aa  HCAB_ECOLI RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     2e-08  30%  270 aa  HCAB_ECOLC RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     2e-08  30%  270 aa  HCAB_ECOHS RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     2e-08  30%  270 aa  HCAB_ECODH RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     2e-08  30%  270 aa  HCAB_ECOBW RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     2e-08  30%  270 aa  HCAB_ECO55 RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     2e-08  30%  270 aa  HCAB_ECO24 RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   36::221     2e-08  26%  311 aa  DRS7C_XENTR RecName: Full=Dehydrogenase/reductase SDR family member
   72::221     2e-08  28%  311 aa  DRS7C_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   40::209     2e-08  31%  300 aa  DHB13_HUMAN RecName: Full=17-beta hydroxysteroid dehydrogenase 13; 
   36::209     2e-08  32%  286 aa  DHI1L_XENTR RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
   37::209     2e-08  29%  304 aa  DHB13_MOUSE RecName: Full=17-beta hydroxysteroid dehydrogenase 13; 
   34::213     3e-08  24%  317 aa  RDH7_RAT RecName: Full=Retinol dehydrogenase 7;       
    5::186     3e-08  26%  243 aa  BZRD_BACSU RecName: Full=Benzil reductase;         EC=1.1.1.n7;
    9::111     3e-08  38%  129 aa  YUSR_BACSU RecName: Full=Short-chain dehydrogenase/reductase
   34::213     3e-08  24%  317 aa  RDH3_RAT RecName: Full=Retinol dehydrogenase 3;       
    6::190     3e-08  33%  266 aa  PGDH_MACFA RecName: Full=15-hydroxyprostaglandin dehydrogenase
    6::190     3e-08  33%  266 aa  PGDH_HUMAN RecName: Full=15-hydroxyprostaglandin dehydrogenase
   68::248     3e-08  26%  330 aa  HSDL1_RAT RecName: Full=Hydroxysteroid dehydrogenase-like protein
   30::209     3e-08  26%  313 aa  DR9C7_BOVIN RecName: Full=Short chain dehydrogenase/reductase
  176::248     3e-08  41%  271 aa  DHMA_FLAS1 RecName: Full=N-acylmannosamine 1-dehydrogenase;        
   83::288     3e-08  28%  406 aa  DHI2_RABIT RecName: Full=Corticosteroid 11-beta-dehydrogenase
   47::231     3e-08  30%  306 aa  DHB3_RAT RecName: Full=Testosterone 17-beta-dehydrogenase 3;       
   39::241     5e-08  31%  334 aa  RDH13_MOUSE RecName: Full=Retinol dehydrogenase 13;       
   40::239     5e-08  31%  316 aa  RDH12_MOUSE RecName: Full=Retinol dehydrogenase 12;       
   68::248     5e-08  27%  330 aa  HSDL1_MOUSE RecName: Full=Hydroxysteroid dehydrogenase-like protein
   11::228     5e-08  30%  270 aa  HCAB_SHIFL RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     5e-08  30%  270 aa  HCAB_SHIF8 RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     5e-08  30%  270 aa  HCAB_ECO5E RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   11::228     5e-08  30%  270 aa  HCAB_ECO57 RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   38::229     5e-08  26%  309 aa  DRS7B_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
   30::209     5e-08  26%  313 aa  DR9C7_HUMAN RecName: Full=Short chain dehydrogenase/reductase
   31::208     6e-08  27%  230 aa  DR4L2_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   40::209     6e-08  27%  300 aa  DHB11_MACFA RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
   51::243     6e-08  27%  311 aa  DH12B_DANRE RecName: Full=Estradiol 17-beta-dehydrogenase 12-B;    
    9::185     6e-08  30%  280 aa  BPHB_RHOGO RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
    8::235     8e-08  25%  248 aa  Y4EL_RHISN RecName: Full=Uncharacterized short-chain type
   50::239     8e-08  31%  315 aa  STDH2_CAEEL RecName: Full=Putative steroid dehydrogenase 2;        
   91::223     8e-08  30%  441 aa  MFEA_DICDI RecName: Full=Peroxisomal multifunctional enzyme A;     
   51::235     8e-08  28%  310 aa  DHB3_HUMAN RecName: Full=Testosterone 17-beta-dehydrogenase 3;     
   60::235     8e-08  26%  339 aa  BDH_CHICK RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
    1::198     1e-07  28%  296 aa  YAEB_SCHPO RecName: Full=Uncharacterized oxidoreductase C23D3.11;  
    7::196     1e-07  27%  253 aa  Y945_MYCTU RecName: Full=Uncharacterized oxidoreductase
   50::239     1e-07  31%  314 aa  STDH1_CAEEL RecName: Full=Putative steroid dehydrogenase 1;        
   34::213     1e-07  24%  317 aa  RDH2_RAT RecName: Full=Retinol dehydrogenase 2;       
   99::227     1e-07  27%  318 aa  DS7CB_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
   51::241     1e-07  31%  316 aa  DHRS7_DICDI RecName: Full=Dehydrogenase/reductase SDR family
   40::239     1e-07  32%  316 aa  RDH12_HUMAN RecName: Full=Retinol dehydrogenase 12;       
   40::239     1e-07  30%  316 aa  RDH12_BOVIN RecName: Full=Retinol dehydrogenase 12;       
   39::238     1e-07  32%  316 aa  RDH11_MOUSE RecName: Full=Retinol dehydrogenase 11;       
   42::241     1e-07  31%  318 aa  RDH11_HUMAN RecName: Full=Retinol dehydrogenase 11;       
   27::217     1e-07  29%  288 aa  DHI1_RAT RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme
   31::221     1e-07  29%  292 aa  DHI1_MOUSE RecName: Full=Corticosteroid 11-beta-dehydrogenase
   53::245     1e-07  27%  312 aa  DHB12_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
    9::273     2e-07  34%  288 aa  PTR1_LEIMA RecName: Full=Pteridine reductase 1;       
   77::255     2e-07  27%  353 aa  MKAR_ASPTN RecName: Full=3-ketoacyl-CoA reductase;       
   95::271     2e-07  28%  334 aa  KDSR_DICDI RecName: Full=3-ketodihydrosphingosine reductase;       
   34::213     2e-07  25%  317 aa  H17B6_MOUSE RecName: Full=Hydroxysteroid 17-beta dehydrogenase 6;  
   11::225     2e-07  29%  271 aa  TSC10_CANAL RecName: Full=3-ketodihydrosphingosine reductase TSC10;
  193::274     2e-07  41%  289 aa  PTR1_LEITA RecName: Full=Pteridine reductase 1;       
   83::292     2e-07  28%  404 aa  DHI2_BOVIN RecName: Full=Corticosteroid 11-beta-dehydrogenase
  109::191     3e-07  35%  286 aa  YBPE_SCHPO RecName: Full=Uncharacterized oxidoreductase C16H5.14c; 
   45::257     3e-07  34%  334 aa  RDH14_MOUSE RecName: Full=Retinol dehydrogenase 14;       
   59::249     3e-07  25%  332 aa  MKAR_NEUCR RecName: Full=3-ketoacyl-CoA reductase;       
   12::148     3e-07  32%  417 aa  HSDL2_XENLA RecName: Full=Hydroxysteroid dehydrogenase-like protein
   82::221     3e-07  27%  270 aa  DHB14_BOVIN RecName: Full=17-beta-hydroxysteroid dehydrogenase 14; 
   56::244     4e-07  26%  325 aa  DRS7B_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   31::192     4e-07  32%  292 aa  DHI1_HUMAN RecName: Full=Corticosteroid 11-beta-dehydrogenase
   85::188     4e-07  41%  254 aa  ADH_DROLE RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   67::257     5e-07  26%  340 aa  MKAR_PODAN RecName: Full=3-ketoacyl-CoA reductase;       
   56::192     5e-07  27%  280 aa  HCAB_PHOLL RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   53::245     5e-07  26%  312 aa  DHB12_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 12;        
    2::234     5e-07  26%  249 aa  BZRD_BACCE RecName: Full=Benzil reductase;         EC=1.1.1.n7;
    6::192     7e-07  31%  266 aa  PGDH_BOVIN RecName: Full=15-hydroxyprostaglandin dehydrogenase
   87::190     7e-07  37%  256 aa  ADH_ZAPTU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   69::259     9e-07  28%  342 aa  MKAR_CHAGB RecName: Full=3-ketoacyl-CoA reductase;       
   34::223     9e-07  25%  319 aa  DHRS9_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   31::192     9e-07  32%  291 aa  DHI1_SAISC RecName: Full=Corticosteroid 11-beta-dehydrogenase
   21::264     9e-07  25%  285 aa  ABA2_ARATH RecName: Full=Xanthoxin dehydrogenase;       
  104::214     1e-06  33%  341 aa  Y1570_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb1570;   
  104::214     1e-06  33%  341 aa  Y1543_MYCTU RecName: Full=Uncharacterized oxidoreductase
   12::148     1e-06  32%  417 aa  HSDL2_XENTR RecName: Full=Hydroxysteroid dehydrogenase-like protein
    3::140     1e-06  35%  277 aa  CBR1_MOUSE RecName: Full=Carbonyl reductase [NADPH] 1;       
   44::259     1e-06  33%  336 aa  RDH14_HUMAN RecName: Full=Retinol dehydrogenase 14;       
   70::248     1e-06  28%  346 aa  MKAR_EMENI RecName: Full=3-ketoacyl-CoA reductase;       
   50::275     1e-06  27%  316 aa  LE767_CAEEL RecName: Full=Putative steroid dehydrogenase let-767;  
   31::192     1e-06  30%  292 aa  DHI1_MESAU RecName: Full=Corticosteroid 11-beta-dehydrogenase
    6::140     1e-06  38%  289 aa  CBR1_PIG RecName: Full=Carbonyl reductase [NADPH] 1;       
   69::194     2e-06  28%  346 aa  MKAR_KLULA RecName: Full=3-ketoacyl-CoA reductase;       
   34::213     2e-06  24%  317 aa  H17B6_RAT RecName: Full=Hydroxysteroid 17-beta dehydrogenase 6;    
   43::222     2e-06  28%  240 aa  FOLM_ENT38 RecName: Full=Dihydrofolate reductase folM;       
   68::188     2e-06  33%  254 aa  ADH_DROVI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   68::188     2e-06  33%  254 aa  ADH_DROFL RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   68::188     2e-06  33%  254 aa  ADH2_DROMN RecName: Full=Alcohol dehydrogenase 2;       
   85::188     2e-06  36%  254 aa  ADH1_DROMT RecName: Full=Alcohol dehydrogenase 1;       
   56::317     2e-06  28%  336 aa  TS2_MAIZE RecName: Full=Sex determination protein tasselseed-2;
  119::231     2e-06  32%  309 aa  RDHE2_HUMAN RecName: Full=Epidermal retinal dehydrogenase 2;       
   70::282     2e-06  22%  345 aa  MKAR_NEOFI RecName: Full=3-ketoacyl-CoA reductase;       
   34::223     2e-06  24%  319 aa  DHRS9_RAT RecName: Full=Dehydrogenase/reductase SDR family member
   31::192     2e-06  26%  292 aa  DHI1_SHEEP RecName: Full=Corticosteroid 11-beta-dehydrogenase
   68::188     2e-06  32%  254 aa  ADH_DROLA RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   35::218     3e-06  27%  356 aa  YXNA_BACSU RecName: Full=Uncharacterized oxidoreductase yxnA;      
  119::231     3e-06  31%  309 aa  RDHE2_MOUSE RecName: Full=Epidermal retinal dehydrogenase 2;       
   33::215     3e-06  25%  318 aa  RDH1_BOVIN RecName: Full=11-cis retinol dehydrogenase;       
   63::276     3e-06  25%  339 aa  MKAR_AJECN RecName: Full=3-ketoacyl-CoA reductase;       
   50::263     3e-06  29%  316 aa  LE767_CAEBR RecName: Full=Putative steroid dehydrogenase let-767;  
   31::192     3e-06  34%  292 aa  DHI1_RABIT RecName: Full=Corticosteroid 11-beta-dehydrogenase
   85::188     3e-06  35%  254 aa  ADH_DROMY RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   68::188     3e-06  32%  254 aa  ADH_DROBO RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     3e-06  35%  254 aa  ADH2_DROMU RecName: Full=Alcohol dehydrogenase 2;       
   85::188     3e-06  35%  254 aa  ADH2_DROHY RecName: Full=Alcohol dehydrogenase 2;       
   85::188     3e-06  35%  254 aa  ADH2_DROBU RecName: Full=Alcohol dehydrogenase 2;       
   85::188     3e-06  35%  254 aa  ADH1_DRONA RecName: Full=Alcohol dehydrogenase 1;       
   85::188     3e-06  35%  254 aa  ADH1_DROHY RecName: Full=Alcohol dehydrogenase 1;       
   40::227     4e-06  28%  316 aa  S16C6_BOVIN RecName: Full=Short chain dehydrogenase/reductase
    6::140     4e-06  35%  277 aa  CBR1_MACFA RecName: Full=Carbonyl reductase [NADPH] 1;       
   85::188     4e-06  35%  254 aa  ADH2_DROAR RecName: Full=Alcohol dehydrogenase 2;       
   85::188     4e-06  35%  254 aa  ADH1_DROMU RecName: Full=Alcohol dehydrogenase 1;       
   68::188     4e-06  32%  254 aa  ADH1_DROMN RecName: Full=Alcohol dehydrogenase 1;       
   66::280     6e-06  23%  341 aa  MKAR_PHANO RecName: Full=3-ketoacyl-CoA reductase;       
   44::249     6e-06  30%  330 aa  DHRSX_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   63::228     6e-06  30%  258 aa  ADH2_CERCA RecName: Full=Alcohol dehydrogenase 2;       
   70::282     7e-06  24%  345 aa  MKAR_ASPCL RecName: Full=3-ketoacyl-CoA reductase;       
   47::151     7e-06  33%  418 aa  HSDL2_PONAB RecName: Full=Hydroxysteroid dehydrogenase-like protein
    7::272     7e-06  30%  278 aa  FABG_YEAST RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   68::188     7e-06  31%  254 aa  ADH_DROIM RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     7e-06  35%  254 aa  ADH2_DROWH RecName: Full=Alcohol dehydrogenase 2;       
   63::239     7e-06  28%  257 aa  ADH1_CERCA RecName: Full=Alcohol dehydrogenase 1;       
   47::151     9e-06  33%  418 aa  HSDL2_HUMAN RecName: Full=Hydroxysteroid dehydrogenase-like protein
   34::221     9e-06  24%  291 aa  DHI1B_XENLA RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
    6::140     9e-06  37%  277 aa  CBR3_HUMAN RecName: Full=Carbonyl reductase [NADPH] 3;       
   85::188     9e-06  34%  254 aa  ADH_DRONI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     9e-06  35%  254 aa  ADH1_DROMO RecName: Full=Alcohol dehydrogenase 1;       
   74::201     1e-05  28%  326 aa  YL426_YEAST RecName: Full=Uncharacterized oxidoreductase YLR426W;  
   57::196     1e-05  29%  269 aa  INHA_MYCS2 RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    8::140     1e-05  37%  277 aa  CBR1_PONAB RecName: Full=Carbonyl reductase [NADPH] 1;       
    8::140     1e-05  37%  277 aa  CBR1_HUMAN RecName: Full=Carbonyl reductase [NADPH] 1;       
   85::188     1e-05  33%  254 aa  ADH_SCAAL RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     1e-05  35%  254 aa  ADH2_DROMO RecName: Full=Alcohol dehydrogenase 2;       
   15::222     2e-05  29%  263 aa  SPRE_XENLA RecName: Full=Sepiapterin reductase;         Short=SPR; 
   62::281     2e-05  25%  341 aa  MKAR_PICGU RecName: Full=3-ketoacyl-CoA reductase;       
   59::224     2e-05  29%  331 aa  MKAR_MAGGR RecName: Full=3-ketoacyl-CoA reductase;       
   57::227     2e-05  27%  240 aa  FOLM_SHIBS RecName: Full=Dihydrofolate reductase folM;       
   34::213     2e-05  25%  319 aa  DHRS9_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   13::220     2e-05  27%  261 aa  SPRE_XENTR RecName: Full=Sepiapterin reductase;         Short=SPR; 
   91::220     2e-05  25%  324 aa  DS7CA_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
   83::271     2e-05  27%  405 aa  DHI2_HUMAN RecName: Full=Corticosteroid 11-beta-dehydrogenase
   85::188     2e-05  32%  254 aa  ADH_DROPL RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     2e-05  31%  254 aa  ADH_DROMM RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     2e-05  32%  254 aa  ADH_DROGR RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     2e-05  32%  254 aa  ADH_DRODI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  137::250     3e-05  29%  339 aa  RD10A_DANRE RecName: Full=Retinol dehydrogenase 10-A;       
   55::194     3e-05  31%  331 aa  MKAR_BOTFB RecName: Full=3-ketoacyl-CoA reductase;       
   70::282     3e-05  23%  345 aa  MKAR_ASPFU RecName: Full=3-ketoacyl-CoA reductase;       
   70::282     3e-05  23%  345 aa  MKAR_ASPFC RecName: Full=3-ketoacyl-CoA reductase;       
   30::241     3e-05  26%  268 aa  FABI2_RHIME RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   68::188     3e-05  34%  254 aa  ADH_DROSU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   68::188     3e-05  34%  254 aa  ADH_DROPS RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     3e-05  32%  254 aa  ADH_DROPI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   68::188     3e-05  34%  254 aa  ADH_DROPB RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   68::188     3e-05  34%  254 aa  ADH_DROMD RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     3e-05  32%  254 aa  ADH_DROHA RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   68::188     3e-05  34%  254 aa  ADH_DROGU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     3e-05  31%  254 aa  ADH_DROCR RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   68::188     3e-05  34%  254 aa  ADH_DROAM RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     3e-05  30%  254 aa  ADH_DROAD RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   50::277     4e-05  27%  349 aa  STDH3_CAEEL RecName: Full=Putative steroid dehydrogenase 3;        
  139::252     4e-05  27%  341 aa  RDH10_RAT RecName: Full=Retinol dehydrogenase 10;       
  139::252     4e-05  27%  341 aa  RDH10_MOUSE RecName: Full=Retinol dehydrogenase 10;       
  139::252     4e-05  27%  341 aa  RDH10_HUMAN RecName: Full=Retinol dehydrogenase 10;       
  139::252     4e-05  27%  341 aa  RDH10_BOVIN RecName: Full=Retinol dehydrogenase 10;       
  134::246     4e-05  34%  336 aa  RD10B_DANRE RecName: Full=Retinol dehydrogenase 10-B;       
   37::169     4e-05  30%  287 aa  DHI1L_DANRE RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
   47::231     4e-05  24%  305 aa  DHB3_MOUSE RecName: Full=Testosterone 17-beta-dehydrogenase 3;     
   70::190     4e-05  35%  256 aa  ADH_DROYA RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   70::190     4e-05  35%  256 aa  ADH_DROTE RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   68::188     4e-05  34%  254 aa  ADH_DROPE RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     4e-05  31%  254 aa  ADH_DROAF RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   64::235     5e-05  29%  346 aa  MKAR_PICST RecName: Full=3-ketoacyl-CoA reductase;       
   70::283     5e-05  21%  346 aa  MKAR_ASPOR RecName: Full=3-ketoacyl-CoA reductase;       
   34::221     5e-05  26%  291 aa  DHI1A_XENLA RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
   70::190     5e-05  34%  256 aa  ADH_DROSI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   70::190     5e-05  34%  256 aa  ADH_DROSE RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   70::190     5e-05  34%  256 aa  ADH_DROME RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   70::190     5e-05  34%  256 aa  ADH_DROMA RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   70::190     5e-05  34%  256 aa  ADH_DROER RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  142::252     6e-05  28%  341 aa  RDH10_XENTR RecName: Full=Retinol dehydrogenase 10;       
  142::252     6e-05  28%  341 aa  RD10B_XENLA RecName: Full=Retinol dehydrogenase 10-B;       
   58::197     6e-05  30%  334 aa  MKAR_SCLS1 RecName: Full=3-ketoacyl-CoA reductase;       
   66::257     6e-05  24%  341 aa  MKAR_PYRTR RecName: Full=3-ketoacyl-CoA reductase;       
   43::227     6e-05  26%  240 aa  FOLM_ECOSM RecName: Full=Dihydrofolate reductase folM;       
   70::190     6e-05  34%  256 aa  ADH_DROTS RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   70::190     6e-05  34%  256 aa  ADH_DROOR RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     6e-05  30%  254 aa  ADH_DROHE RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  147::246     8e-05  29%  259 aa  SRLD_ECOLI RecName: Full=Sorbitol-6-phosphate 2-dehydrogenase;     
   43::227     8e-05  26%  240 aa  FOLM_SHIFL RecName: Full=Dihydrofolate reductase folM;       
   43::227     8e-05  26%  240 aa  FOLM_SHIF8 RecName: Full=Dihydrofolate reductase folM;       
   43::227     8e-05  26%  240 aa  FOLM_SHIDS RecName: Full=Dihydrofolate reductase folM;       
   43::227     8e-05  26%  240 aa  FOLM_ECOLI RecName: Full=Dihydrofolate reductase folM;       
   43::227     8e-05  26%  240 aa  FOLM_ECOLC RecName: Full=Dihydrofolate reductase folM;       
   43::227     8e-05  26%  240 aa  FOLM_ECOHS RecName: Full=Dihydrofolate reductase folM;       
   43::227     8e-05  26%  240 aa  FOLM_ECO57 RecName: Full=Dihydrofolate reductase folM;       
   43::227     8e-05  26%  240 aa  FOLM_ECO24 RecName: Full=Dihydrofolate reductase folM;       
  118::241     8e-05  29%  262 aa  FABI_HAEIN RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    4::88      1e-04  38%  106 aa  YDFG_DICNO RecName: Full=Probable NADP-dependent dehydrogenase in
   12::143     1e-04  33%  415 aa  HSDL2_DANRE RecName: Full=Hydroxysteroid dehydrogenase-like protein
   70::254     1e-04  21%  319 aa  HSDL1_DANRE RecName: Full=Hydroxysteroid dehydrogenase-like protein
   57::227     1e-04  26%  240 aa  FOLM_ECOUT RecName: Full=Dihydrofolate reductase folM;       
   57::227     1e-04  26%  240 aa  FOLM_ECOL6 RecName: Full=Dihydrofolate reductase folM;       
   57::227     1e-04  26%  240 aa  FOLM_ECOL5 RecName: Full=Dihydrofolate reductase folM;       
   57::227     1e-04  26%  240 aa  FOLM_ECOK1 RecName: Full=Dihydrofolate reductase folM;       
   48::235     1e-04  25%  262 aa  FABI_SALTY RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   85::188     1e-04  33%  254 aa  ADH_DROWI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     1e-04  33%  254 aa  ADH_DROPU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     1e-04  33%  254 aa  ADH_DROIN RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::188     1e-04  33%  254 aa  ADH_DROEQ RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  502::612     1e-04  26%  689 aa  YUXG_BACSU RecName: Full=Uncharacterized oxidoreductase yuxG;      
  203::325     1e-04  35%  342 aa  YR419_MIMIV RecName: Full=Uncharacterized short-chain type
   10::191     1e-04  29%  251 aa  YMP3_STRCO RecName: Full=Uncharacterized oxidoreductase in mprA
   13::128     1e-04  28%  177 aa  RL6_PSEU5 RecName: Full=50S ribosomal protein L6;
  117::243     1e-04  30%  258 aa  FABI_ANASP RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   38::228     1e-04  27%  302 aa  DHRS3_MOUSE RecName: Full=Short-chain dehydrogenase/reductase 3;   
    9::194     1e-04  23%  297 aa  AYR1_YEAST RecName: Full=NADPH-dependent 1-acyldihydroxyacetone
   13::197     2e-04  31%  325 aa  TSC10_NEUCR RecName: Full=3-ketodihydrosphingosine reductase
  142::252     2e-04  27%  341 aa  RD10A_XENLA RecName: Full=Retinol dehydrogenase 10-A;       
    5::105     2e-04  29%  322 aa  POR_PLEBO RecName: Full=Light-dependent protochlorophyllide
   57::227     2e-04  26%  240 aa  FOLM_SHISS RecName: Full=Dihydrofolate reductase folM;       
  165::244     2e-04  38%  272 aa  FABI1_RHIME RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   85::188     2e-04  30%  254 aa  ADH_DROSL RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   87::190     2e-04  35%  256 aa  ADH_DROAN RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  125::360     2e-04  30%  414 aa  WWOX_HUMAN RecName: Full=WW domain-containing oxidoreductase;      
   23::220     2e-04  27%  271 aa  NOR1_ASPPA RecName: Full=Aflatoxin biosynthesis ketoreductase
  145::227     2e-04  34%  240 aa  FOLM_CITK8 RecName: Full=Dihydrofolate reductase folM;       
   44::249     2e-04  30%  335 aa  DHRSX_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
  125::360     3e-04  30%  414 aa  WWOX_PONAB RecName: Full=WW domain-containing oxidoreductase;      
   85::257     3e-04  32%  395 aa  PORB_HORVU RecName: Full=Protochlorophyllide reductase B,
   48::235     3e-04  24%  262 aa  FABI_SHIFL RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   48::235     3e-04  24%  262 aa  FABI_ECOLI RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   48::235     3e-04  24%  262 aa  FABI_ECO57 RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   19::222     4e-04  24%  252 aa  Y1430_HAEIN RecName: Full=Probable NADP-dependent dehydrogenase
    8::96      4e-04  36%  322 aa  POR_SYNY3 RecName: Full=Light-dependent protochlorophyllide
   78::223     4e-04  29%  361 aa  MKAR_CRYNE RecName: Full=3-ketoacyl-CoA reductase;       
   78::196     4e-04  29%  269 aa  INHA_MYCTU RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   78::196     4e-04  29%  269 aa  INHA_MYCBO RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   74::148     4e-04  32%  490 aa  HSDL2_MOUSE RecName: Full=Hydroxysteroid dehydrogenase-like protein
   85::242     4e-04  23%  261 aa  FABI_NEIMB RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   12::220     5e-04  30%  261 aa  SPRE_MOUSE RecName: Full=Sepiapterin reductase;         Short=SPR; 
   87::180     5e-04  33%  398 aa  POR_DAUCA RecName: Full=Protochlorophyllide reductase,
   71::192     5e-04  28%  351 aa  MKAR_ASHGO RecName: Full=3-ketoacyl-CoA reductase;       
   31::221     5e-04  29%  300 aa  DHI1_CAVPO RecName: Full=Corticosteroid 11-beta-dehydrogenase
   38::192     5e-04  28%  287 aa  DHI1L_CHICK RecName: Full=Hydroxysteroid 11-beta-dehydrogenase
    5::66      7e-04  36%  854 aa  Y2073_MYCBO RecName: Full=Uncharacterized protein Mb2073c;
    5::66      7e-04  36%  854 aa  Y2047_MYCTU RecName: Full=Uncharacterized protein Rv2047c/MT2107;
  149::240     7e-04  35%  458 aa  POR_MARPA RecName: Full=Protochlorophyllide reductase,
    3::94      7e-04  41%  277 aa  CBR1_RAT RecName: Full=Carbonyl reductase [NADPH] 1;       
   40::201     9e-04  31%  335 aa  TSC10_CRYNE RecName: Full=3-ketodihydrosphingosine reductase TSC10;
   92::183     9e-04  35%  401 aa  PORB_ARATH RecName: Full=Protochlorophyllide reductase B,
  166::213     9e-04  44%  274 aa  MOMAS_ORYSJ RecName: Full=Momilactone A synthase;       
    1::238

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAERRTALVTGATKGIGLALSKHLQQLGWSVIGVARHAIEGFPGQLLTADLADIQQTDAVLAQVVAASRI
FABG_VIBHA      --EGKIALVTGASRGIGRAIAELLVERGATVIGTATSAISGENGKGLALNVTDVESIEATLKTINECGAI
NODG_AZOBR      ---QKIALVTGAMGGLGTAICQALAKDGCIVAALGQQEALGFKFYVAEGDVSDFESCKAMVAKIEALGPV
FIXR_BRAJA      --EPKVMLLTGASRGIGHATAKLFSEAGWRIISCARQPFDGCPWEAFQVDLGDHRMLPRAITEVLAGAPL
FABG_CUPLA      --ESPVVIVTGASRGIGKAIALSLGKAGCKVVNYARSSIEAFGGQALTGDVSKEEDVEAMIKTAVDAGTV
FABG_SHIFL      --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
FABG_ECOLI      --EGKIALVTGASRGIGRAIAETLAARGAKVIGTATQAISGANGKGLMLNVTDPASIESVLEKIRAEGEV
FABG_PSEAE      ----KVALVTGASRGIGQAIALELGRLGAVVIGTATSAANGVEGAGLVLDVSSDESVAATLEHIQQLGQP
FABG_BACSU      MLNDKTAIVTGASRGIGRSIALDLAKSGANVVAKANEVVDGRKAIAVKADVSNPEDVQNMIKETLSVSTI
FABG_BUCAP      --EKKTALVTGANQGLGKEIAIKLSQKGIQVIGTST-TVDGVKNKYLKKNILDLKDTDSILEKMKEICQI
FABG_HAEIN      ----KIALVTGSTRGIGRAIAEELSSKGAFVIGTATSAYLGDKGKGLVLNVTDKESIETLLEQIKNDGDI
FABG_CHLTR      ----KTAIVTGGSRGIGFSIAKLFAEQGWGINGEAGQALSEQTGRQVSFALVDVSKNDMVSAQVAEYNTI
FABG_THEMA      --EGKVCLITGAASGIGKATTLLFAQEGATVIAISKENLEGLPGKVYVLNVTDRDQIXXXXXXXXQKGRI
FABG1_SYNY3     ----QVALVTGASRGIGKXXXXXXXXXGMKVVSTAADAVXXXXXXXVQANVANADEVDQLIKTTLDKSRI
BUDC_KLEPN      ---KKVALVTGAGQGIGKAIALRLVKDGFAVAAVASEINQA--GGRAMAVKVDVSDRDQVFAAVEQARKF
FABG_STAES      ----KSALVTGASRGIGRSIALQLAEEGYNVAVVEEIKAKGVESFAIQANVAKGDEVKEMIKEVVSQGSV
FABG_STAEQ      ----KSALVTGASRGIGRSIALQLAEEGYNVAVVEEIKAKGVESFAIQANVAKGDEVKEMIKEVVSQGSV
FABG_RICPR      ----KTSLITGASSGIGSAIARLLHKLGSKVIGSNEEKLKSLGNALYTIEVCNLANKEECSNLISKTSNL
FABG_MYCTU      ----RSVLVTGGNRGIGLAIAQRLAADGHKV--AVTHRGSGAPKGLFGVE-CDVTDSDAVDRAFTAVEEV
FABG_MYCBO      ----RSVLVTGGNRGIGLAIAQRLAADGHKV--AVTHRGSGAPKGLFGVE-CDVTDSDAVDRAFTAVEEV
FABG_MYCS2      ----RSVLVTGGNRGIGLAIARRLAADGHKV--AVTHRGSGAPDDLVQCDVTDSAAVDRAFKEVEEQGPV
PHAB_ACISR      MSEQKVALVTGALGGIGSEICRQLVTAGYKIIATVVPREEDREKQWLQSEGFQDSDVRFVLTDLXXXGRV
NODG_RHIS3      ----RKALVTGASGGIGEAIARVLHAQG-AIVGLHGTRVEKL--ETLAAELGDLSNRDEVKALGQKAEAV
PHBB_RALEH      ---QRIAYVTGGMGGIGTAICQRLAKDGFRVVALEQQKALGFDFIASEGNVADWDSTKTAFDKVKSVGEV
FABG_STAAW      MKMTKSALVTGASRGIGRSIALQLAEEGYNVXXXXXXXXXXXDSFAIQANVADADEVKAMIKEVVSQGSL
FABG_STAAS      MKMTKSALVTGASRGIGRSIALQLAEEGYNVXXXXXXXXXXXDSFAIQANVADADEVKAMIKEVVSQGSL
FABG_STAAR      MKMTKSALVTGASRGIGRSIALQLAEEGYNVXXXXXXXXXXXDSFAIQANVADADEVKAMIKEVVSQGSL
FABG_STAAN      MKMTKSALVTGASRGIGRSIALQLAEEGYNVXXXXXXXXXXXDSFAIQANVADADEVKAMIKEVVSQGSL
FABG_STAAM      MKMTKSALVTGASRGIGRSIALQLAEEGYNVXXXXXXXXXXXDSFAIQANVADADEVKAMIKEVVSQGSL
FABG_STAAC      MKMTKSALVTGASRGIGRSIALQLAEEGYNVXXXXXXXXXXXDSFAIQANVADADEVKAMIKEVVSQGSL
FABG_AQUAE      ----KVSLVTGSTRGIGRAIAEKLASAGSTVI------ITGTSGERAKAVAEEIANKYGVKAHGVEMNLI
UCPA_SALTY      ----KTALITGASQGIGEGIARVFARHGANLIEIEKLADEGGRGHRCTAVKADVRDFASVQAAVARAKRI
UCPA_SALTI      ----KTALITGASQGIGEGIARVFARHGANLIEIEKLADEGGRGHRCTAVKADVRDFASVQAAVARAKRI
FABG_MYCAV      ----RSVLVTGGNRGIGLAIAQRLAAEAHKV--AVTHRGSGAPDGLVECDVTDNDAVDRAFTEVEEQGPV
YMFI_BACSU      ----KTALITGASGGIGKSISETLAARGYNLLNAAAELAEGVNAEILQADLSAQDGADKLTSSIVQP--I
FABG2_BRANA     ---------TGASRGIGKAIALSLGKAGCKVVNYARSAIEAYGGQAITGDVSKEADVDAMMKTAVDAGTI
FABG_SALTY      --EGKIALVTGASRGIGRAIAETLVARGAKVIGTATSEYLGANGKGLMLNVTDPASIESVLENIRAEGEV
FABG_SALTI      --EGKIALVTGASRGIGRAIAETLVARGAKVIGTATSEYLGANGKGLMLNVTDPASIESVLENIRAEGEV
FABG_CHLMU      ----KAAIVTGGSRGIGFGIAKLFAEHGANVQGINEEALSDKTGSKVSFALVDVSKNDMVSAQVAEYGTI
UCPA_ECOLI      ----KTALITGALQGIGEGIARTFARHGANLILLISPEIEKLADELCTAVVADVRDPASVAAAIKRAKRI
PHBB_RHIME      ----RVALVTGGSRGIGAAICVALKAAGYKVAAKAFEQESGIP--VYKWDVSSYQACVDGIARVEALGPV
FABG_VIBCH      --EGKVALVTGASRGIGKAIAELLAERGAKVIGTATQAISGDNGKGMALNVTNPESIEAVLKAITDEGGV
FABG3_BRANA     ---------TGASRGIGKAIALSLGKAGCKVVNYARSAIEAYGGQAITGDVSKEADVEAMMKTAIDAGTI
FABG1_BRANA     ---------TGASRGIGKAIALSLGKAGCKVVNYARSAIEAYGGQAITGDVSKEADVEAMMKTAIDAGTI
YXJF_BACSU      ---KQVALVTGAAGGIGFEIAREFAREGASVIAASKLAEEGFDAAAIPYDVTEAQVADTVNVIQKQYGRL
DER_CHICK       ----RRALVTGAGKGIGRAVAVALCKAGARVTALSRTAVRECPGEPLCLDLAD---WDATEAAVGAAGPF
UCPA_ECO57      ----KTALITGALQGIGEGIARTFARHGANLILLISPEIEKLADELCTAVVADVRDPASVAAAIKRAKRI
ACT3_STRCO      --DSEVALVTGATSGIGLEIARRLGKEGLRVFVCARGE-EGLRTTLKTCDVRSVPEIEALVAAVVERGPV
DCXR_BOVIN      ----RRALVTGAGKGIGRSIVKALHAAGARVVAVSRSLVRECPGETVCVDLADWEATEQALGGV---GPV
TRN1_DATST      -----TALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKEGLNVEGSVCDLLSRTERDKLMQTVVFDGKL
FABG_BUCBP      ---KKIAVITGANRGLGKGIAEELSNIGTSTSQKGCKIINKYNGIGIKLDITNPNEITKTMDFVYKNGRV
TRNH_DATST      -----TALVTGGTRGIGYAIVEELANFGAEVYTCSRSQNDGFKVSGPVCDVSSISQRQTLMESVTSSGKL
DHRS4_RABIT     ----KVAIVTASTDGIGLAIARRLAQDGAHVVAVAALQAEGLSVTGTVCHVGKAEDRERLVATALNLGGI
BDHA_RHIME      ----KTAVITGSTSGIGLAIARTLAKAGANIV------LNGFPDEIRTADMTKPSEIADMMAMVADRGGA
YOHF_ECOLI      ----QVAIITASDSGIGKECALLLAQQGFD-IGITWHSDEGVRAEIVQLDLGNLPEGALALEKLIQRGRI
PHAB_PARDE      ----KVALVTGGSRGIGAAISKALKEAGYTVAAAARAFTEETGIKTYKWSVADYDACAAGIKQVEEEGPI
DHKR_STRCM      ----RVALVTGATSGIGLATARLLAAQGHLVFLGARTTVKALRNDGLEAEVLDVRDGASVTAFVQAAGRI
LVR_LEIAQ       ----RVVLITGGGSGLGRATAVRLAAEGLSLVDVSSEGLEASKAAVLVADVSDEAQVEAVTATTERFGRI
KDUD_BACSU      ----KTALVTGPGTGIGQGIAKALAGAGADIIGTSHTSLVEQEGRIFTSFTLDMSKPEAIAAELFENRQI
FABG5_BRANA     ---------TGASRGIGKAIALSLGKAGCKVVNYARSAIEEYGGEAITGDVSKEADVDSMMKTAVDKGTI
YLX6_SCHPO      --EGRVVLITGAAGGIGKVLCKMFTELGDRVAGI--DIVDPSKVQALQADVSKADQIETAIEKVIQTGPI
Y2049_STAEQ     --KEKVAVVTGASSGIGEAIAKKLSQQGASIVLVGRNEQRNTPAKVVSADVTVKSNIDDMLKAVIDHGHI
Y2036_STAES     --KEKVAVVTGASSGIGEAIAKKLSQQGASIVLVGRNEQRNTPAKVVSADVTVKSNIDDMLKAVIDHGHI
BUDC_KLETE      ---QKVALVTGAGQGIGKAIALRLVKDGFAVAATAVAAEINQAGGRAVAIKVDVSRRDQVFAAVEQARKF
TRN2_DATST      -----TALVTGGSRGIGYGIVEELASLGASVYTCSRNQKEGFKVEASVCDLSSRSERQELMNTVANHGKL
NODG_RHIME      --------------------------------------------KLFPANLANRDEVKALGQRAEALEGV
GNO_GLUOX       ------ALVTGASRGIGLTLAKGLARYGAEVVLNGRNAESGFEAEGLKASTADVTDQDAVIDGVAAIERI
FABG4_BRANA     ----------GASRGIGKAIALSLGKAGCKVVNYARSAIEEYGGQAITGDVSKEADVDAMMKTAVDKGTI
DHRS4_BOVIN     --DNKVALVTASTDGIGFAIARRLAQDGAHVVVSSRRAVATLKGEGLSVTVGKAEDRERLVATAVKLGGV
KDUD_DICD3      ----KVALITGCDTGLGQGMAVGLAEAGCDIVGVPKETIEGRRFLSLTADMSDISGHAALVEKAVAEGKV
TRN2_HYONI      -----TALVTGGSRGIGYGIVEELANLGASVYTCSRNQKEGFNVEASVCDLSSRSEREEFMKTVSNHGKL
FABG_BUCAI      ---RQTAFITGANQXXXXXXXXXXXXXXXQVIGTSNDYLEG-NGFGFVLNLKNIDSITEKIQEIYKKKHI
HCDR_XANP2      ----RVAIVTGASSGNGLAIATRFLARGDRVAALARTHWHAYADKVLRADVADEGDVNAAIAATMEQGAI
DCXR_CAEEL      -------LVTGASQGIGKEICLSLAKAGAQVIAFARNEANLLSLVKETTSLGDVSANEEVLFKLIVPHPI
YGFF_ECOLI      ------ALVTGGSRGIGRATALLLAQEGYTVLHAAQEVMNGGKAFVLQADISDENQVVAMFTAIDQHDEL
PHBB_CHRVI      ----------------------------------------GFDIAVFTADVSSFDDSARMVREITEVGPI
YHXC_BACSU      --EGKTAIITGGDSGIGRAVSVLFAKEGANVVIVYLNEHEGVKCLLIAGDVGDEAFCNDVVGQASQVPSI
PHBB_ZOORA      ---------------------------------------------------------------------I
CPNA_COMTE      ----KVVLVTGGAMGMGLTLSDMNEELGHQAVAEIRR--QGGKAHFLHLDVTNENHWTGAVDTILAESRL
CPNA_COMS9      ----KVVLVTGGAMGMGLTLSDMNEELGHQAVAEIRR--QGGKAHFLHLDVTNENHWTGAVDTILAESRL
FABG_RICBR      -----------------------------------------------TIKVCNLTNTEECSNLVAQIEKL
FABG2_SYNY3     --EDKVIVVTGGNRGIGAAIVKLLQEMG-AKVAFTDLATDGGNTEALVANVTDLESMTAAAAEITKLGPV
FABG_RICTY      -------------------------------------------------NLANKEECNNLISKI---SNL
FABG_CHLPN      ----KKVIVTGGSRGIGLGIVKLFLENGWGLNEERGQAVTGLGGEVSFARV-DVSHNDCVQKFLDKHNKI
RHLG_PSEAE      ----RIALVTGGSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAYGDCQAIPADLSSEAGAARL
DHB8_HUMAN      ------ALVTGAGSGIGRAVSVRLAGEGATVAAAAQETVRGGPGSAFQADVSEARAARCLLEQVQACSRP
DCXR_RAT        ----RRALVTGAGKGIGRSTXXXXXXXXXXXXXXSRSLVRECPGEPVCVDLADWEATEQALSNV---GPV
DHR11_HUMAN     ----RLALVTGASGGIGAAVARALVQQGLKVVGCARTVIEGYPGTLIPY-RCDLSNEEDILSMFSAISGV
DHB8_CANFA      --------VTGAGSGIGRAVSVRLAKEGWLLGGQGSEKVA--PGGAHTAFQADVSEAGAVLEQVQACSRP
CMTB_PSEPU      --EGQVAVVTGGAHGIGLGIVERLLGLGLSLLCERLXXXXXXXXXXXXXXLSEEQGAQGLRAAVERFGSV
CMTB_PSEP1      --EGQVAVVTGGAHGIGLGIVERLLGLGLSLLCERLXXXXXXXXXXXXXXLSEEQGAQGLRAAVERFGSV
DHR11_BOVIN     ----RLALVTGASGGIGAAVARALVQQGLKVVGCARTVIEGYPGTLIPY-RCDLSNEEDILSMFSAVSGV
BUTA_STAAW      MTNNKVALVTGGAQGIGFKIAERLVEDGFKVAGAKAAALKSSDGTKAIAIKADVSNRDDVFNAVTAAQFG
BUTA_STAAS      MTNNKVALVTGGAQGIGFKIAERLVEDGFKVAGAKAAALKSSDGTKAIAIKADVSNRDDVFNAVTAAQFG
BUTA_STAAR      MTNNKVALVTGGAQGIGFKIAERLVEDGFKVAGAKAAALKSSDGTKAIAIKADVSNRDDVFNAVTAAQFG
BUTA_STAAN      MTNNKVALVTGGAQGIGFKIAERLVEDGFKVAGAKAAALKSSDGTKAIAIKADVSNRDDVFNAVTAAQFG
BUTA_STAAM      MTNNKVALVTGGAQGIGFKIAERLVEDGFKVAGAKAAALKSSDGTKAIAIKADVSNRDDVFNAVTAAQFG
BUTA_STAAC      MTNNKVALVTGGAQGIGFKIAERLVEDGFKVAGAKAAALKSSDGTKAIAIKADVSNRDDVFNAVTAAQFG
FADH_BACSU      --EKKAVIITGGSSGMGKAMAKKQAELGWHVMVTGRNEIQTFEGQVACFQMSDSAASDMIKEAVKAFGRL
DHR11_CHICK     ----RVALVTGASVGIGAAVARALVQHGMKVVGCARSVDKGYPGTLIPYK-CDLSNEEEILSMFSAIKTV
BUTA_STAEQ      ----KTAIITGSAGGLGKGIAERLANDGFNIVXXXXXXXXGYQAVAFKSDVSKKEQEELVQFAVTEFGQL
HSD_MYCTU       ----KVALVSGGARGMG---ASHVRAMVAEGAKVVFGDILDEEGKAVAAELADAQWTAAVDTAVTAFGGL
HSD_MYCBO       ----KVALVSGGARGMG---ASHVRAMVAEGAKVVFGDILDEEGKAVAAELADAQWTAAVDTAVTAFGGL
BAIA1_EUBSP     ---------------------------------------ELYPEEEVLGFAPDLTSRDAVMAAVGTVARL
DCXR_MOUSE      ----RRALVTGAGKGIGRSTVLALKAAGAQVVAVSRDLVRECPGEPVCVDLADWEATEQALSNV---GPV
CBR2_PIG        ------ALVTGAGKGIGRDTVKALHVSGARVVAVTRSLSQECPGEPVCVDLGDWEATERALGGV---GPV
Y4VI_RHISN      -------------------------------------------------------------------SRI
BACC2_BACSU     ----KTVLITGGASGIGYAVQAFLNQQANVVVADIDEAQGEAMIRKENNDRLHFVHTDAIRSAVDKFGGL
YJDA_BACSU      -SQEKIALITGASSDIGTAICRKLASQGIHIFFTHWNSIEEFQQEILRCEAMKIDLSDAHAAFTIHEKIS
YVRD_BACSU      --KEKLVLITGSTSGIGKAAAKSFLQEGAAVIVNGRRTIEELSGHGAAADLSKTDEAAAFIEKVNEIGDI
Y1385_MYCBO     ----------------------------------------------------DVTQADDVDILIRTAVEL
Y1350_MYCTU     ----------------------------------------------------DVTQADDVDILIRTAVEL
FABG_ARATH      --------------------------------------IEEYGGQAITGDVSKATDVDAMMKTALDKGTI
YHDF_BACSU      ----KVAIITGGDSGIGRAAAIAFAKEGASILYLDEHSDENVRCLLIPGDVGDENHCEQAVQQTVDHGKL
Y182_METEA      -----------------------------------------------------------VEAAVQQFGRL
GRDH1_ARATH     ----KVALITGGDSGIGRAVGYCFASEGATVAFTYVKGQEEKDAQETLQMLKEVKTSDSVVDEVVNAGRI
DHRS4_PIG       --ENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKTLQG-EGLSVTGTVCHVGKAELVAMAVNLHGGV
FABG_ACTAC      -----TILITGSSRGIGKAIALRLAQAGFDIVVHCRSRIXGQNARVLQFDVSRSEAADKLTADVEAHGAY
DCXR_MESAU      ----RRALVTGAGKGIGRSTVLALQAAGAHVVAVSRSLVSECPGETVCVDLADWEATEQALSSV---GPV
BACC_BACSU      ----KTVLITGGASGIGYA------------------AVQAFLGQQANVVVADIDQTDAVESAVHTFGGL
BDH2_MOUSE      ----KVIVLTAAAQGIGRASALAFAREGAKVIATKLQELESYRGQTRVLDVTKKRQIDQFASEI---ERI
YKVO_BACSU      --EGKIALVTGGTSGIGLATAQKFVNEGAYVYITGRRQNEGVQGDI--SKLEDLDKLYDIIKQ--EKGKL
BDHA_RALEH      ----------------------------------------------------------------------
DHR11_MOUSE     ----RLALVTGASGGIGAAVARALVQQGLKVVGCARTVIEGYPGTLIPY-RCDLSNEEDILSMFSAVSGV
YGCW_ECOLI      ----KTAIVTGGNSGLGQAFAMALAKAGANIFGETKEMIEK---QGVEVDFMQVGITAEGAPQKIIAATV
SORD_KLEPN      -------IVTGGASGIGLAIVDELLSQGAHVQMIDIHGGDGDNYHFWSTDISEVQQTDAIIQRW---SRI
Y3106_PSEAE     ----KVALVTGAARGIGLGISAWLIAEGWQVVGARVAEALGEHAWFVAMDVAQEGQVAMSVAEVLGQGRL
KDUD_ECOLI      ----------------------------------------------LTADLRKIDGIPALLDRAVAEGHI
DCXR_CAVPO      ----RRALVTGAGKGIGRSTVLALKAAGAQVVAVSRDLVRECPGEPVCVDLADWEATEQALSNV---GPX
CBR2_MOUSE      ------ALVTGAGKGIGRDTVKALHASGAKVVAVTRSLAKECPGEPVCVDLGDWDATEKALGGI---GPV
Y2778_STAA8     ----KVAVVTGAGSGIGEAIATLLHEEGAKVVGRNKEKLQNVANQLVPTDVTNKEEVDELIAQQTFGG-L
Y2488_STAAC     ----KVAVVTGAGSGIGEAIATLLHEEGAKVVGRNKEKLQNVANQLVPTDVTNKEEVDELIAQQTFGG-L
Y2422_STAA3     ----KVAVVTGAGSGIGEAIATLLHEEGAKVVGRNKEKLQNVANQLVPTDVTNKEEVDELIAQQTFGG-L
FABG_RICFE      -----------------------------------------------TIEICNLANKEECSNLISKAPKL
Y2403_STAAW     ----KIAVVTGAGSGIGEAIATLLHEEGAKVVGRNKEKLQNVANQLVPTDVTNKEEVDELIAQQTFGG-L
Y2370_STAAS     ----KIAVVTGAGSGIGEAIATLLHEEGAKVVGRNKEKLQNVANQLVPTDVTNKEEVDELIAQQTFGG-L
YQJQ_BACSU      --------ITGASGGLGERIAYLCAAEGAHVIEIKRKITEEWSGQIFPLDVGRLEDIARVRDQI---GSI
Y325_THEMA      ----KVVLITGAGSGIGKKAAVMFAERGAKVAEKGKETVEGGEAAFIFGDVADAEQI--VKKTVETFGRL
Y2478_STAAM     ----KIAVVTGAGSGIGEAIATLLHEEGAKVVLAGRNKLQNVANQLVPTDVTNKEEVDELMAQQTFGG-L
Y2266_STAAN     ----KIAVVTGAGSGIGEAIATLLHEEGAKVVLAGRNKLQNVANQLVPTDVTNKEEVDELMAQQTFGG-L
RDH8_HUMAN      -AAPRTVLISGCSSGIGLELAAHDPKKRYQVVATMRDLXXXXXXXXXXXXXXXVAQLDVCSDESVAQGEV
PECR_PONAB      LLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRERLKSAAGEL-QANLPPTKQARVIPIQCNIRNKI
DHG2_BACME      ----KVVVVTGGSKGLGRAMAVRFGQEQSKVVVNYRSNXXXXXGQAIIVR-GDVTKEEDVVNLVETAVKL
NOG4_RHIME      ----------------------------------------------------------------------
IDNO_ECOLI      ----KNILITGSAQGIGFLLATGLGKYGAQIIAVEKLHQEGIQAVAAPFNVTHKHEIDAAVEHIEKIGPI
IDNO_ECOL6      ----KNILITGSAQGIGFLLATGLGKYGAQIIAVEKLHQEGIQAVAAPFNVTHKHEIDAAVEHIEKIGPI
ENTA_ECOLI      --------VTGAGKGIGYATALAFVEAGAKVTGFDQFTQEQYPFATEXXXXXXXXXXXXXCQRLLAETRL
DCXR_HUMAN      ----RRVLVTGAGKGIGRGTVQALHATGARVVAVSRSLVRECPGEPVCVDLGDWEATERALGSV---GPV
TRNH1_ARATH     ----KTVLVTGGTKGIGHAIVEEFAGFGAVIHTCARNEYEGFQGSVCDASLRPEREKLMQTVSSMFGGKL
FOX2_CANTR      ----KVVIITGAGGGLGKYYSLEFAKLGAKVVGGALNGQGGNSGGVAVADYNNVLDGDKIVETAVKNGTV
FABG_RICCN      -------------------------------------------------NLADKEECRNLISK---ASKL
CBR4_XENTR      ----KVCAVFGGSRGIGKAVSKLLAQRDYKVAVISRDXXXXXXXXXXSCDVSKENEIQDTFKEITNLGNV
SPS19_YEAST     ---------------------------------------------IANVDVRNFEQVEAVKKTVEKFGKI
HDHA_ECOLI      -------------------------------------------------DITSEQELSALADFAISKGKV
HDHA_ECO57      -------------------------------------------------DITSEQELSALADFAISKGKV
FOX2_NEUCR      ----RVALVTGGGAGIGRAYCLAFARAGASXXXXXXXXIKKMGGKAVGAKFSAEDGDAVVKAAIDAFGRV
BAIA2_EUBSP     ---------------------------------------ELYPEEEVLGFAPDLTSRDAVMAAVGQVARL
Y2567_STAAR     ----KIAVVTGAGSGIGEAIATLLHEEGAKVVLAGRNKLQNVANQLVPTDVTKKEEVDELIKMAQQTGGL
PECR_HUMAN      LLQGQVAIVTGGATGIGKAIVKELLELGSNVV-IASRKLERLKSAALQANLPPTKQARVIPIQLDTFGKI
GRDH_DAUCA      ----KVALVTGGDSGIGRSVCYHFALEGATVAFVKGHEDKDANETLIAADLGFDDNCKKVVDQVVNAGSI
HCDS_XANP2      ----------------------------------------------------DVTDEAAITAAMAGAQRL
Y484_MYCTU      ---KRVAVVTGASSGIGEATARTLAAQGFHVVAVARRAITALANQIGTXXXXXXXXXXXXXXXXRALSRV
HDHA_CLOSO      --ENKVALVTSATRGIGLASAIKLAQNGAIVMGVRRYKEEGLILKPVFFDAYNIDIYKEMIDTIIKEGKI
BUTA_STAES      ------------------------------------------------------EQEELVQFAVTEFGQL
YJGI_ECOLI      ----KTVLILGGSRGIGAAIVRRFVTDGANVYAGSKDAAKRLAQETATAVFTDSADRDAVIDVVRKSGAL
LINC_PSEPA      --------------------------------GEAVVATSGGKAAYFRCDIAQEEDVKALVAQTLAAGGL
VIBA_VIBCH      -------LLVGSARGIGFSVLEHLLQAGWXXXXXXXXXXXGRYPDQLTLKKLDLAEPEAVREQVEQVAGF
VDLC_HELPY      ---QKVAIITGASSGIGLECALMLLDQGYKVYALSRHALNHALCESVDIDVSDSNALKEVFSNISAKEKY
YVAG_BACSU      ----KTALVTGSTSGIGKAIASSLAEEGAAVIINGRR--EEKVNQ--TIDELKTQHAEAVLYPAAAYPEV
YUSZ_BACSU      ---KKIAIVTGASSGFGLLAAVKLAR-SFFVIATSRQPEKAEQLRELAADVTDEQSIVSFGKAVSAYAPI
BACC_BACAM      ----KTVLITGGASGIGYAVQAFLNQQANVVVADIDEAQGEAMIRKENNDRLHFVQTDAILSAVDKFGGL
DHRS4_RAT       ----KVALVTASTDGIGLAIARRLAEDGAHVVAVATLQGEGLSVTGVVCHVGKAEDREKLVNMALKLHQI
DECR2_HUMAN     ----KVAFITGGGSGIGFRIAEIFMRHGCHTVIASRRKLAGATGRRCLPLSMDVRAPPAVMAAVDQAGRI
DECR2_DANRE     ----QVAFITGGGSGIGFRIAEVLMRHGCDTVIASRNLLTSTTGRRCLPIAMDVRQPETILAAVDETGRV
FABG6_BRANA     --------------------------------------------------------------------QI
DHRS4_MOUSE     ----KVALVTASTDGIGFAIARRLAEDGAHVVAVATLQGEGLSVTGIVCHVGKAEDREKLITTALKRHRI
BDH2_HUMAN      --------------------------------------LEKYPGQTRVLDVTKKKQIDQFANEV---ERL
HSD_STREX       -------------------------------------------------DAARYQHLDVTIEEVVAYARV
GRDH2_ARATH     ----KVALVTGGDSGIGKAVCHCYALEGASVAFTYVKGREDKDAEMIATDLGFEENCKRVVEEVVNSGRI
DECR2_PONAB     ----KVAFITGGGSGIGFRIAEIFMRHGCHTVIASRRKLAGATGRRCLPLSMDVRAPPAIVAAVDQAGRI
XYLL_PSEPU      ----KVAVITGAAQGIGRRVAERMAAEGGRLLLVDRELIHELADELLTADLEQFAECQRVMAAALERGRL
CBR4_DANRE      ----RLAVVFGGSRGIGRAASKLLAQRGHRIVLLSRNTAQSLPGENHLGLSCDVSKEEEVQKAFETINKV
SDH_RHIRD       -----TILITGATSGFGQATAQRFVKEGWKVIGTGRRALEALSAELGSADITDEEATKKALAGLPDGFRI
GS39_BACSU      ----KVALITGGDSGIGRAVSVAYAKEGADIAIVKRVEQEGVKCLLIAGDVGEEEFNEAVEKTVKELGGL
PECR_RAT        ---------------IGKAISRELLHLGCNVVIASRKAVDELRASQVTAIQCNIRKEEEVNNLVKSTGKI
VDLC_HELPJ      ------AVITGASSGIGLECVLMLLNQGYKVYALSRHALNHALCECVDIDVSDSNALKEVFLNISAKEHC
ACR1_ACIBI      ----KVALITGASSGIGLTIAKRIAAAGAHVLLVARAAIEQQGGQIFPCDLTDMNAIDQLSQQIMASDHV
ACR1_ACIAD      ----KVALITGASSGIGLTIAKRIAAAGAHVLLVARAAIEQQGGQIFPCDLTDMNAIDQLSQQIMASDHV
YTKK_BACSU      ----RHALITAGSKGLGRKVTETLLAKGYSVTVNYRQDEEAVPDCLLQFVKGDVTKKEDLLRIAEAAGRI
YM71_YEAST      ---KKTVLITGASAGIGKATALEYLEASMKLILAARRXXQEFPNAKVHVAQLDITQAEKIKPFIENLPQI
YAY8_SCHPO      LAEKKT-LLTGGDSGIGKAAAVMFAREGSDLVEVTRDLIERWEGKLDKSDNC----RDLVDFALKKLGWI
MAS12_AGRRH     -------LISGPSRGIGKAIAENLIAHGYRMSLGARRVKDGPQSEWLHYARFDAEDNDTMAAWVTAAGRI
BDH2_BOVIN      --------------------------------------------------------------------RL
YBBO_ECOLI      ---QKSVLITGCSSGIGLESALELKRQGFHVLAVERMNSMGFTGVLI--DLDSPESVDRAADEVIALTDL
YBBO_ECOL6      ---QKSVLITGCSSGIGLESALELKRQGFHVLAVERMNSMGFTGVLI--DLDSPESVDRAADEVIALTDL
Y4LA_RHISN      ---------------------------------------------------------------------V
Y0419_STAS1     ----KVAVVTGASSGIGASIAETLANQGVKVVLTGRDEIQDNKQAVVETSIVDXXXXXXXXXXXXXXGQI
MAS1_AGRT9      -------MVSGVTRGIGKAIAEDLIRHGYRVSLGARNAAFGDENEALHYARFDASMKDWVDTTIAKFNRI
GRDH_ORYSJ      ----------------------------------------------IPADLGYDDNCRKVVDEVAGAGAI
DHRS4_PONAB     ----KVALVTASTDGIGFAIARRLAQDGAHVVVSSRQAVATLQGEGLSVTVGKAEDRERLVATAVKLGGI
DHRS4_HUMAN     ----KVALVTASTDGIGFAIARRLAQDGAHVVVSSRQAVATLQGEGLSVTVGKAEDRERLVATAVKLGGI
YXBG_BACSU      -------------------------------------------------DVSDENSVKAFADQIKACGTI
FABG_SCHPO      ----RKVLITGGSSGLGKRIAQIWSQKGHQCHIVGRNSLSVAKGQQHTLTIADVQSDMKNLKSIFESVEI
DECR_RAT        ----KVAFITGGGTGLGKAMTTFLSSLGAQCVIASRNIITSKTGNKVYAIRCDVRDPDTVLELIKVAGHP
DECR_MOUSE      ----KVAFITGGGTGLGKAMTTFLSTLGAQCVIASRNIISSKTGNKVHAIRCDVRDPDTVLELIKVAGHP
YGHA_ECOLI      ---------------------------------------------LLPGDLSDEKFARSLVHEALGGLDI
YGHA_ECO57      ---------------------------------------------LLPGDLSDEKFARSLVHEALGGLDI
DHK1_STRVN      ---------------------------------------EGFDVDGTVCDVADPAQIRAYVAAAVQRGTV
DHGB_BACME      --EGKVVVITGSSTGLGKSMAIRFATEKAKVVSVLEEEIKKVGGEAIAVK-GDVTVESDVINLVQSAGKL
DHBA_BACSU      --EGKIAFITGAAQGIGEAVARTLASQGAHIAAVDYNPAEGRHAEAFPADVRDSAAIDEITARIEREGPI
Y2146_BRAJA     ---------------------------------------------------------------------V
DECR2_RAT       LLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSRSLLVAATGKRCLPLSMDVRVPPAVMAAVDQAGKI
VER1_ASPPA      ----------------------------------------------IQADVGDPEATAKLMAETVRHGYL
CBR4_XENLA      ----KVCAVFGGSRGIGKAVAKLLAQKDYKVLEVAQAAVTEIGAHLLSCDVSKENEIQCTFKEIKNLGNI
SDR1_PICAB      ----RVAIVTGASRGIGREIALNMAEKGAKVVSSNQHAAEGVRAIVCKADVAEPSQVAQLFDTAEHAGPL
DHSO_RHOSH      ----KTALITGSARGIGRAFAEAYVREG-ARVAIADINLEAXXXXXXXLDVTDQASIDRCVAELLDRGSI
DHRS7_DROME     ----KVVLITGASSGLGESLAHVFYRAGCRVILAARRTQEAYPPTVLPLDLAELNSIPEFVTRVLAVNQV
DHG2_BACSU      ----KTAIVTGSSKGIGKAIAERFGKEKMNVV-VNYHSIKQNGGKAVSVE-ADVSKEEGIQALLDTAGTL
FABL_BACSU      MEQNKCALVTGSSRGVGKAAAIRLAENGYNVINYARSALEGVKVLVVKANVGQPAKIKEMFQQIDETGRL
SDH_AGRT5       -----TILITGATSGFGQATARRFVKEGWKVIGTGXXXXQAFHG--IAFDITDEDATEKALAALPDGFRI
PECR_CAVPO      --------------------------------------------------------------------KI
DHB8_RAT        --------VTGAGSGIGRAISVRLXXXXXXXXXXXXXXLLGNPGSAFQADVSEGPAAKRLLEQVQACRPP
DHGA_BACME      ----KVVVITGGSTGLGRAMAVRFGQEEAKVVINAKKEVEEAGGQAIIVQ-GDVTKEEDVVNLVQTAIKL
BPHB_PSES1      ------ALVTGGGSGLGRAIVDRFVAEGARVAVLDKSAVLGIEGDVRV--LADHQK--AARECVAAFGKI
BEND_ACIAD      --EHKVVIVTGAAQGIGRGVALRIAQEGGCLILADRSDLIGALAIAVETDLETYAGAELVVSHAIAEGRI
SOU1_SCHPO      ---------------------------------------------------AVIETTNQAVEEL--GGRL
RDH8_BOVIN      ----RTVLISGCSSGIGLELAAHDPRQRYQVVATMRDAAGEALGQTLTVAQLDVCSDESVAQNCIQGGEX
DHG3_BACME      ----KVVVITGGSTGLGRAMAVRFGQEEAKVVINAKKEVEEAGGQAIIVQ-GDVTKEEDVVNLVQTAIKL
DHB2_RAT        --DQKAVLVTGADSGFGHALAKHLDKLGFTVFGPGAEELRKNCSERLSVLQMDVTKPEQIVAEKIQDKGL
BPHB_BURXL      -------LITGGASGLGRALVDRFVAEGAKVAVLDKSALETDHGDNVLGIVGDVRQKQAASRCVARFGKI
YQ53_SCHPO      -----TVLITGSSKGLGYALVKVGLAQGYNVIACSRATIEHSXXXXXXXDVTDVKSVETAFKDAKRRGNV
DHG_BACSU       ---------------------------------------------------------------------L
DHB2_HUMAN      --DQKAVLVTGGDCGLGHALCKYLDELGFTVFGVLN---ENGPGSVLQMDITKPVQIKDAYSKVAAMLQL
PECR_MOUSE      --------------------------------------------------------SNLVKSTLAKYGKI
HCD2_RAT        ------AVITGGASGLGLSTAKRLVGQGATAVLLDVPNSEGLGGNCIFAP-ANVTSEKEVQAALTLAKRI
DHG4_BACME      ----KVVVITGGSTGLGRAMAVRFGQEEAKVVINAKKEVEEAGGQAIIVQ-GDVTKEEDVVNLVQTAIKL
DHB8_MOUSE      ---------------------------------------DGAPRGKHAAFQADVSQGPALLEEVQACSRP
DHB2_MOUSE      --DQKAVLVTGADSGFGHGLAKHLDKLGFTVFALRKHCSERL--SVLQMDVTQIKDAHSKVTEKIQDKGL
YWFH_BACSU      ---KRTAFVMGASQGIGKAIALKLADQHFSLVINSRNLIESVKEDILAGDMSD-QHTRAGIFQKIESQRL
T4HR_MAGGR      --EGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAASDAACVKANVGVVEDIVRMGKL
STCU_EMENI      ----------------------------------------------IQADVGDPDAVTKLMDQAVEHGYL
BPHB_PSEPU      -------LITGGASGLGRALAERLAQLGDNVLGV-------------TGDVRSLEDQKQAASRCVAKGKI
NAHB_PSEU8      MGNQQVVSITGAGSGIGLELVRSFKSAGYYVSALVRNECKEFKDEIVVGDVRDHATNEKLIKQTIDRGHL
NAHB_PSEPU      MGNQQVVSITGAGSGIGLELVRSFKSAGYYVSALVRNECKEFKDEIVVGDVRDHATNEKLIKQTIDRGHL
DHB8_CALJA      ----------------------------------------------------------------------
CBR4_BOVIN      ----KVCAVFGGSRGIGRAVARLMAQRGYRLAIVARNXXXXXXXXXXSCDVADVQNTFEEIEKNLG--RV
Y4MP_RHISN      ----KTAVISGAARGIGRATAELFASHGAAILDINADEAKAAAGDLLRCDVADRASCTSASDEVLSAFGV
Y1627_STAS1     ----KVVVITGASSGIGEETVNLLSENGAKLVLGARRLLEKIQ-QKVGHDSVSIKKTDVTKPDEVNAGRI
DHB8_PIG        --------VTGAGSGIGRAVSVRLQLLGGP--GSEKGAPSG-PMAAFQADVSEAETARRLLEQVQAYRPP
THR1_GLOLA      ----KVALVTGAGRGIGREMAMELGRRGAKVIVNYANSAEGSDAASIKANVSDVDQIVKMFGEAKQIGRL
DHB1_PANTR      ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
DHB1_RAT        -------LITGCSSGIGLHLAVRLRSQSFKVYATLRDLAQGCPPGSLEILELDVRDSESVAAACVTEGRV
YXEK_CAEEL      ----------------------------------------------------------------------
Y4EK_RHISN      MNRYEVALVTGASSGIGKAIALELASAGLRVLALGRHSTAGIVP--VVFDLSDVSE----VYGKIAGEKI
MOAE_KLEAE      ----------------------------------------------------------------------
KDSR_BOVIN      -------VVTGGSSGIGKCIAIECYKQGAFITLVARHSIN--DKQVVLCISVDVSQDYSQVENVIKQAQV
DHRS7_HUMAN     --------VTGASSGIGEELAYQLSKLGVSLVLSARHELERVKRRVLPLDLTDTGSHEAATKAVLQEGRI
DHB14_HUMAN     --------------------------------------------------LCDVTQEDDVKTLVSETGRL
DHB1_MOUSE      -------LITGCSSGIGMHLAVRLRSQSFKVYATLRDLTQGCPPEILELDVRDSKSVAAAQA-CVTEGRV
DHB1_HUMAN      ---RTVVLITGCSSGIGLHLAVRLASQSFKVYATLRRALACPPGSLETLQL-DVRDSKSVAAERVTEGRV
LIMC_RHOER      --EGQVALITGAARGQGRSHAIKLAEEGADVIDVPNDVVDGYP--LGTADEADVRDLESLTAEVDRAGRL
FOX2_YEAST      --------------------------------------------------------------------RV
YHXD_BACSU      ----------------------------------------------------------------------
Y0585_STAHJ     ---------------------------------------------IVPTDVTNQVEVDALVAKVIDVGHV
KDSR_HUMAN      -------VVTGGSSGIGKCIAIECYKQGAFITLVARHSINDKQVVLISVDVSDYNQVENVIKQAEKLGPV
DHRS7_MOUSE     --------VTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKVLPLDLTDTSSHEAATKAVLQEGKI
DHK2_STRVN      --EAPVALVTGSSSGIGQTVAQRLAAEGYRVVVNSARSVE--DGEKTAAALPDAEEADAVDTAVEHYGRL
YIV6_YEAST      ----KVILITGASRGIGLQLVKTVEDDECIVYGVARYGADKFVYRVL--DITDRSRMEALVEEIRQKGKL
LINX_PSEPA      ----KVALITGGASGLGAAQAKRFAEEGAKVVVVAEIRAAGGDALFIRLDVTDXXXXXXXXXXXVDGGGL
BDH_BOVIN       ----KAVLITGCDSGFGFSLAKHLHSEGFLVFAGCLMKDKGSDGRLRTVQLNVCKSEEVDKAAEVIRSSL
DHB4_HUMAN      -------------------------------------------GGKAVANYDSVEEGEKVVKTALDAGRI
BPHB_COMTE      ------ALITGGASGLGRALVDRFVAEGARVAVLDKSAXXXXXXXXXXXXXRSLQDQKRAAERCLAAGKI
DHB12_XENTR     ------AVVTGATDGIGKAYAEELAKRGMNIVEVAKQIKEKFETKIIAADFGKPTEIYGRIESGLRDLEI
DH12B_XENLA     ------AVVTGATDGIGKAYAEELARRGMNIVLISRS-----PEKLEEAAI-HIKQKFKVETKIIAAERI
DH12A_XENLA     ------AVVTGATDGIGKAYAEELARRGMSIVLIAKHIKETFKVETKII-AADFGKPTEIYERIEAGLRI
DHB12_ANAPL     -------VVTGATDGIGKAYAKELAKRGMKVALISRSKEKGVETKVIVADFGEREDIYDRIRAGLEGLEI
MTDH_AGABI      ----KTIIVTGGNRGIGLAFTRXXXXXXXXXXXIYRSAKDAVEGVKTKAYQCDVSNTDIVIQQIDALGAI
UXUB_BACSU      ----KTAVITGGSGVLCSAMARELARHGMKVAILNRTAEKGXXXXXXXXDVLDRMSLERAKEDILGQGAV
HCD2_DROME      MIKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSAARL
DHB4_MOUSE      --------------------------------------------------------------------RI
KDSR_MOUSE      -------VVTGGSSGIGKCIAIECYKQGAFITLVARHSINDKQVVLISVDVSDYNQVENVIKQAEKLGPV
HCD2_HUMAN      --------------------------------------------------------------------RV
DHB4_RAT        --------------------------------------------------------------------RI
CBR4_MOUSE      ----KVCAVFGGSRGIGRAVAQLMAQKGYRLAIVSRNVAKVTAGELFRCDVAKEQDVQSTFQEMEKLGPV
YQC8_SCHPO      ----KNCVVFGAAKGIGFSIATAFAQAGGNVIITAKKLAEETGVQVHTLKI-DISRSDTVEAGVEEIQKI
YOXD_BACSU      ---------------------------------------------------------------------I
YCIK_ECOLI      ----RIILVTGASDGIGREAAMTYARYGATVIQVASHINEETGRQLLTCTSENCQQ----LAQRIAVNRL
MAS11_AGRRH     -------LVSGSNRGVGKAIAEDLIAHGYRLSLGARKVKDGPQDEWLHYARFDAEDHGTMAAWVTAAGRI
DRS7B_MOUSE     -------VVTGATSGLGRECAKVFHAAGAKLVLCGRNALEELSRELVTFDLADPGTIAAAAAEILQCGYV
ARDH_PICST      ----RLAIITGGSGGLAAVISRALLAQGADVLGWGEETLKGEHASAISCNIGDAEAVDATFSSINEGKIA
YVX3_CAEEL      ----------------------------------------------------------------------
RIDH_KLEAE      ----KVAAITGAASGIGLECARTLLGAGAKVVLIDREGEKGENAFALQVDLMQADQVDNLLQGILQLTRL
HETN_ANASP      ----------------------------------------------------DVRNTSQLSALVQQAQDI
DRS7B_XENLA     -------VITGATSGLGKECAKVFYAAGSHLVLCGRDSTQLHKPHMVIFDLSDVEAVNTAAKEILLAGRV
DECR_HUMAN      -----------------------------------------------------VQNTVSELIKVAGHPNI
BPHB_PSEPS      -------LITGGASGLGRALDRFVAEAKVAVLDKSAERLAELETDLIVGDVRSLEDQKQAASRCVARGKI
DHI2_MOUSE      ----RAVLITGCDTGFGKETAKKLDAMGFTVLATVLDL--NSPGALELRDLCDISRVLEITKAHTASTGL
BDH_RAT         -ASGKAVLVTGCDSGFGFSLAKHLHSKGFLVFAGCLLKDKGDAGRTIQLNVCNSEEVEKAVETVRSGLKM
ARDH_CANTR      ----------------------------------------------------------------------
YDFG_SHIFL      -------LVTGATAGFGECITRRFIQQGHKVIATGRRQERL---QELTDELGDIAQLDAAIEEMLASSNI
YDFG_SALTY      -------LVTGATAGFGECIARRFVENGHKVIATGRRALKDELGEVLTAQL-DVRNRAAIMASLPAQWRI
YDFG_SALTI      -------LVTGATAGFGECIARRFVENGHKVIATGRRALKDELGEVLTAQL-DVRNRAAIMASLPAQWRI
Y019_THEMA      ----------------------------------------GLDVTFVKTDVADENSVKNMVRKTVEIGGV
HCD2_MOUSE      ------AVVTGGASGPWLATAKRLVGQGATAVLLDVPDSEGESGESCIFAPANVTSEKEIQAALTLAKRI
DRS7B_XENTR     -------VITGATSGLGRECAKVFYAAGTRLVGRSEEGLKNLVQELVIFDLSDVEAVNSAANEILLTGRV
DHI2_RAT        ----RAVLITGCDTGFGKETAKKLDAMGFTVLATVLD-LNG-PGKLLQMDLTDISRVLEITKAHTASTGL
YWC4_CAEEL      ----------------------------------------------------------------------
YIV5_YEAST      ----KVILVTGVSRGIGKSIVDVLFSLDKDTVGVARSELKEKYGDRFFYVVGDITE-DSVLKQLVNAAKI
RDH13_HUMAN     ----KTVIVTGANTGIGKQTALELARRGGNIILACRDAAKDIRGETLNLDLASLKSIREFAAKIIEEERV
DHB11_PONAB     -------LITGAGHGIGRLTAYEFAKLKSKLVDINKHGLEGAKVHTFVVDCSNREDIYSAAKKVKAEGDV
BDH_MOUSE       -ASGKAILITGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGDAGRTIQLNVCNSEEVEKAVETIRSGLKM
DHRS7_ANOGA     ----KVVLITGASSGLGEALAHSFFLAGCKVVLAARRKDEL---ERVRKDLLELHATGKVQSVLEIHGAI
CBR4_RAT        ----KVCAVFGGSRGIGKAVAQLMAQKGYRLAIVARNATASELGGIHLAFRCNIAKEGDVHSTFEEMEKV
Y432_LISMO      --KNKVIIITGASSGIGKATALLLAEKGAKLVLAARRVIKANSGEAIFAKTDVTKREDNKKLVELAIERV
Y048_HAEIN      ----------------------------------------------------------------------
HSDL1_HUMAN     ----RWAVVSGATDGIGKAYAEELASRGLNIILISRNEEK---LQVVAKDIADTYETDIIVAEALKDKDV
DHB11_RAT       -------LITGAGHGIGRLTAYEFAKLNTKLVDINKNGIEETAGAQVHPFVVDCSQREEIYSAVRKVKEV
DHB11_HUMAN     -------LITGAGHGIGRLTAYEFAKLKSKLVDINKHGLEGAKVHTFVVDCSNREDIYSSAKKVKAEGDV
DECR2_MOUSE     LLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVGRSLXXXXXXRCLPLSM-DVRVPPEVMTAVDQAGKI
CBR4_HUMAN      ----KVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLXXXXXXXXFSCDVADVQNTFEEMEKHLG--RV
YDFG_ECOL6      -------LVTGATAGFGECITRRFIQQGHKVIATGRRQLKDELGDNLYIAQLDVRNRAAILASLPAESNI
Y5909_MYXXD     ----------------------------------------------------DVTKADATLERIRAAGGL
Y452_LISIN      --KNKVIIITGASSGIGEATAILLAEKGAKLVLAARRVIKASSGEAIFAKTDVTKREDNKKLVELAIERV
TODD_PSEP1      -------------------------------------AIVGVEGDVRSLD----SHREAVARCVEAFGKL
BNZE_PSEPU      -------------------------------------AIVGVEGDVRSLD----SHREAVARCVEAFGKL
YI78_SCHPO      --------------------------------------------------------------------RI
PGDH_CAVPO      ----KVALVTGAAQGIGRAFAEGLLHKGWNLAGVKCKAAEEFEPQFIQCDVADQEQLRDTFTKVVYFGRL
HSDL1_CHICK     ----RWAVVTGSTDGIGKAYAEELAKRGVNIIAVSRSISETYKVEFIVADFSKGREAYQAIKEGLKDREI
DRS7C_HUMAN     ---------------------ERLENLYDALISVADPSKQTFTPKLVLLDLSDISCVPDVAKEVLDCGCV
CSGA_MYXXA      ----------------------------------------------------------------VCTGPV
ARDH_CANAL      ----------------------------------------------------------------------
DH12A_DANRE     ------AVVTGATDGIGKSYAEELARRGFSMMLISRKSLESTYKVETKTIAVDFSQIDVYIEKGLAGLEI
BDH_HUMAN       ----KAVLVTGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGDSLNSDRLRTVQLNVCXXXXXXXXXX
SOU2_CANAL      ----KVASVTGSSGGIGWAVAEGYAQAGADVIWYNSHPADGVKSKAYKCNVTDFQDVEKVVKQIESFGTI
SOU1_CANAL      ----KVASVTGSSGGIGWAVAEAFAQAGADVAAKAEYLTEGVKAKAYKCNVTDPNDVSKVINEIEKDGTI
FOLM_KLEP7      MAEQRPILITGAGRRIGLALAHHFLQQRQPVIVSYRTAIDGLREAGALCLQADFSSDDGILTFAEAVKSL
DRS7B_HUMAN     -------VITGATSGLGKECAKVFYAAGAKLVLCGRNGVQTHKPYLVTFDLTDSGAIVAAAAEILQCGYV
DHG_BACME       --------------------------------------------------------------------KL
DHG1_BACME      -----------------------------------------------------------VQSSIKEFGKL
YDFG_ECO57      -------LVTGATAGFGECITRRFIQQGHKVIATGRRQLKDELGDNLYIAQLDVRNRAAILASLPAECNI
YB45_SCHPO      MAEEKVILLTGSSKGIGLATAEALQKKA-KVIAVSRSLTPELETLLIKGDVTEVGKA-SIETAIKKFGKL
RDH16_HUMAN     --------ITGCDSGFGKLLARQLDARGLRVLAACAEQLRGQTSDRLETVTLDVTKTESVAAECVRDKGL
HSDL1_PONAB     ----RWAVVSGATDGIGRAYAEELASRGLNIILISRNEEK---LQVVAKDIADTYKVETPIREALKDKDI
DHRS2_HUMAN     ----RVAVVTGSTSGIGFAIARRLARDGAHVVAMAKLQGEGLSVAGIVCHVGKAEDREQLVAKALECGGV
YDFG_ECOLI      -------LVTGATAGFGECITRRFIQQGHKVIATGRRQLKDELGDNLYIAQLDVRNRAAILASLPAECNI
Y7799_EMENI     --------ITGSSDGIGQAAAKVLSEQGHSVVLHARNAQEAVPGAVLVGDLSSIAETKALAEEANKLPPF
MTDH_UROFA      -------IVTGGNRGIGLAMSQACADAG-AAVGIIYNSAKGVKCKAYQCDVGQQHKVKEVFKKIEELGPV
HSDL1_BOVIN     ----RWAVVSGATDGIGRAYAEELASRGLNIVLISRSQEK---LQMVAKDIADTYETDIIVAEALQDRDI
DRS7B_PONAB     -------VITGATSGLGKECAKVFYAAGAKLVLCGRNGVQTHKPYLVTFDLTDSGAIVAAAAEILQCGYV
DLTE_BACSU      -----TVLITGGSAGIGLELAKRLLELGNEVIICGREAKQQLPNHTKQCDVADRSQREALYEWALKEPNL
DHB11_MOUSE     -------LITGAGHGIGRLTAYEFAKLNTKLVDINKNGIEGAQAHPFVVDCSQREEIYSAAKKVKEVGDV
YI13_SCHPO      ----KTILITGASSGIGKSTAFEXXXXXXTVEEIAKELESKYEVSVLPLDVSDLKSIPGVIESLPKEADI
YD114_YEAST     LSKNATALITGGSSGLGFELAKELSR---RINKVIVADIQSFPAQVEYNNICDITSLDEIKNLKKAIERX
HCD2_BOVIN      ---------------------------------------------------ADVTSEKDVQAALTLAGRV
DR9C7_MOUSE     --------ITGCDSGFGNLLAKQLVDRGMKVLAAAQKLLQDTSHQLQTF-LLDVTKSENVVRDQVGEQGL
DHI2_SHEEP      ----RAVLITGCDSGFGNATAKKLDAMGFTVLATVLDL--NSPGQLLQMDLADISRVLEFTKVHTASTGL
DCXR_TRIRE      ---------------------------------------------------SDYNDVERFVNQVVSDGKI
RDH1_HUMAN      -ASNAFVFITGCDSGFGRLLALQLDQRGFRVLALQRVASSRLHTTLLDTDPQSVQQAAKWVEMHVKEAGL
PGDH_MOUSE      ----KVALVTGAAQGIGKAFAEALLLHGWNLAGVKCKAAEQFEPQFVQCDVADQKQLRDTFRKVVHFGRL
MKAR_MALGO      ------ALVTGATDGIGREFAMQLAARGFNIVAVSRTAIESMPGDFLSAGNAEYEG----LEQLIRHLDI
HCAB_ECOLU      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQR--AVNQILTRSGKL
HCAB_ECO8A      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_ECO7I      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRA---LDQILTRSKL
DRS7C_MOUSE     -----------------------------------------FTPKLVLLDLSDISCVQDVAKEVLDCGCV
DRS7B_RAT       -------VVTGATSGLGKECARVFHAAGAKVVLCGRNALEEF-----TRELADSSSSQGQTHQPCVVTYV
DHB13_RAT       ----QTVLITGAGHGIGLTAYEFAKQKSRLVLDISKHGVEETAGAVVHVFVVDCSNRAEIYKSVDQVKKI
DHB12_MACFA     ------AVVTGGTDGIGKSYAEELAKRGMKVVLISREIKEKFKVETRTITLEDIYDK---IKTGLAGLEI
DHB12_HUMAN     ------AVVTGSTDGIGKSYAEELAKHGMKVVLISREIKEKFKVETRTVDFASEDIYDKIKTG-LAGLEI
DHB12_BOVIN     ------AVVTGGTDGIGKSYAEELAKRGMKIVLISREISEKFKVETKTVDFTSEDIYDKIKAS-LAGLNI
RDH7_MOUSE      --------ITGCDSGFGNLLARQLDRRGMRVLAACAEQLRNKTSDRLETVILDVTKTESIVAATVGNRGL
HCAB_SHISS      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_SHIBS      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_ECOSM      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRA---LDQILTRSKL
HCAB_ECOSE      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_ECOLI      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_ECOLC      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_ECOHS      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_ECODH      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_ECOBW      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_ECO55      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_ECO24      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
DRS7C_XENTR     --KNKVVVITDAISGLGKECSRVFHSAGWALISVADPSVT-FTPKLVLLDISDINNMEAMGKEIQDCGCV
DRS7C_BOVIN     ---------------------ERLQSLYDALISVADPS-KTFTPKLVLLDLSDISCVQDVAKEVLDCGCV
DHB13_HUMAN     -------LITGAGHGIGRQTTYEFAKVLWDINGVEETAAEGVTAHAYVVDCSNREEIYRSLNQVKKVGDV
DHI1L_XENTR     -------LVTGASTGIGEEIAYHYARAGAKLVLTARHALQEVKSRLVVADMASHNAREQVVAEALSAGGL
DHB13_MOUSE     ----QTVLITGAGHGIGLTAYEFAKQKSRLVLDINKRGVEETAGAVVHVFVVDCSNRAEIYNSVDQVKRV
RDH7_RAT        --------ITGCDSGFGNLLARQLDRRGMRVLAAGAEQLRSKTSDRLETVILDVTKTESIVAERVGNRGL
BZRD_BACSU      -------IITGASKGLGQAIALQALEKGHEVHALSRTKTDVSHKKLTQIDLINLEEAEQQFETLLSSIDS
YUSR_BACSU      ----------------------------------------------------------------------
RDH3_RAT        --------ITGCDSGFGNLLARQLDRRGMRVLAAGAEQLRSKTSDRLETVILDVTKTESIVAERVGNRGL
PGDH_MACFA      ----KVALVTGAAQGIGRAFXXXXXXXDWNLAGVQCKAAEKFEPQFIQCDVADQQQLRDTFRKVVHFGRL
PGDH_HUMAN      ----KVALVTGAAQGIGRAFXXXXXXXDWNLAGVQCKAAEQFEPQFIQCDVADQQQLRDTFRKVVHFGRL
HSDL1_RAT       ----RWAVISGATDGIGKAYAEELASHGLNIIAVAKHIADTYRVEVLVADFSRGREIYAPIREALRDRDI
DR9C7_BOVIN     --------ITGCDSGFGNLLARQLVDRGMRVLAACAQKLQQDTSYQLQTILLDVTKTESIKAATVGEQGL
DHMA_FLAS1      ----------------------------------------------------------------------
DHI2_RABIT      ----RAVLITGCDSGFGKETAKKLDAMGFTVLATVLEM--NGPGKLLQMDLADISRALEFTKAHTTSTGL
DHB3_RAT        ------AVITGAGDGIGKAYSFELARHGLNVVLISREEIERTTGSRVKVVQADFTREDIYIEEQLKGLEI
RDH13_MOUSE     ----KTVIVTGANTGIGKQTALELAKRGGNVILACRDAAKDIRGETLNPDLASLKSIREFARKVIKEERV
RDH12_MOUSE     ----KVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAQVLVRDLSDTKSIRAFAERFLAEEKL
HSDL1_MOUSE     ----RWAVISGATDGIGKAYAEELASHGLNVIAAAKHIADTYRVEVLVADFSRGREIYAPIREALRDRDI
HCAB_SHIFL      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_SHIF8      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_ECO5E      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
HCAB_ECO57      --------ITGGGSGLGLALVERFIEEGAQVATLELSAAQRFGEHILAVEYADYQRADQILTR---SGKL
DRS7B_DANRE     ----KVVVITGASSGLGKECARVFHAAGARLIGRDQRRLQEVVEELVTFDLSNTSVVCSAAAEILKRGHV
DR9C7_HUMAN     --------ITGCDSGFGNLLAKQLVDRGMQVLAACSQKLQRDTSYRLQTTLLDVTKSESIKAAAVGEQGL
DR4L2_HUMAN     ----KVALVTASTDGIGFAIARRLAQDRAHVVVSSRQAVATLQGEGLSVTVGKAEDRERLVAMAVKLGGI
DHB11_MACFA     -------LITGAGHGIGRLTAYEFAKLKSKLVDINKHGLEGLGAKVYTVDCSNREDIYSSAKKVKAEGDV
DH12B_DANRE     ------AVVTGATDGIGKAYAEELARRGFAIVLISRKAIESVETKTISADFGSVDIYPKI-ESGLAGLEI
BPHB_RHOGO      -------LVTGGCAGLGRAIGARVAVLDRSVAGLEE--LRAAHGDAVVAVEGDVRYLDSVAKCVETFGKL
Y4EL_RHISN      --------VVGGASGFGLETAKLMVRDGVSVIDINQERLDAAKGELAGKGTEIFTVVRDIARAEGAHASF
STDH2_CAEEL     ------AVVTGATDGIGKSYSFELARRGFNVYIVSRDILEKQPDRFATYDFTNPSVTDKLLSKLNEVS-V
MFEA_DICDI      ---------------------------------------------------------------------V
DHB3_HUMAN      ------AVITGAGDGIGKAYSFELAKRGLNVVLISRTEIERTTGRSVKIIQADFTKDDIYIKEKLAGLEI
BDH_CHICK       ------------TLGLDLPWPKHLHTKGFIIYAGCLQKNKGEGGRTVQLNVCDSKEVDRAVEHVNSSLEL
YAEB_SCHPO      MEAEKFVLITGCSEGIGNALALKFHQEGFQVLATARQ-VERMDNQTLKLDVTDEDSVREVEQEVFTNGSL
Y945_MYCTU      ---RQKILITGASSGLGAGMARSFAAQGRDLALCARRTSQRYPDIKIAVDVNDHERVPKVFAELSEIGGI
STDH1_CAEEL     ------AVVTGATDGIGKSYSFELAKRGFNVYIVSREILEVHPDRFATFDFTNVSDYEKLLSKLNEVS-I
RDH2_RAT        --------ITGCDSGFGNLLARQLDRRGMRVLAACAEQLRSKTSDRLETVILDVTKTESIVAATVGNTGL
DS7CB_DANRE     -----------------------------------------FPPKLVELDFSDMESVPEVISEILECCCL
DHRS7_DICDI     --KNKVVIITGASSGIGAELAKKYARLGCKVTIVARRQLEKVKSSFLKGDLTLIDDCKNMVEKVIEKSKI
RDH12_HUMAN     ----KVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAQVLVRDLSDTKSIRAFAEGFLAEEKL
RDH12_BOVIN     ----KVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAQVLVRDLSDTKSIRAFAEGFLAEEKL
RDH11_MOUSE     ----KVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAQAVTGDLADTKSIRAFAKDFLAEEKL
RDH11_HUMAN     ----KVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGVAKEIQTTDLSDTKSIRAFAKGFLAEEKL
DHI1_RAT        MLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTAREGLQKVVSRCLELGAASAHYIAGTMEDMAFAERL
DHI1_MOUSE      MLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTAREGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQL
DHB12_MOUSE     ------AVVTGGTDGIGKAYAEELAKRGMKIVLISRNIKEKF--NVETRTIAVDFSLDDIYDKILSGLEI
PTR1_LEIMA      ------ALVTGAAKRLGRSIAEGLHAEGYAVLHYHRSAAEANPNSAITADLSNVATAPVSCAELVAAGRC
MKAR_ASPTN      ------AVVTGASDGLGKEFALQLARAGYNIVLVSRTATSKYPSKVLAMDFARNQDSDQKLKELIGDLDV
KDSR_DICDI      --------------------------------------------EIYSCDITNKIKVKETIAQIVSKNKI
H17B6_MOUSE     --------ITGCDSGFGNLLARQLDRRGMRVLAAGAEELRNKTSDRLETVILDVTKTESIVAERVGDRGL
TSC10_CANAL     --EGKTALIVGASQGIGVNLAERLYEKNCSTILVARHQIEKYPSAKISYAVADVSNYDECLWQTIHPADP
PTR1_LEITA      ----------------------------------------------------------------------
DHI2_BOVIN      ----RAVLITGCDSGFGNATAKKLDTMGFTVLATVLDL--NSPGKLLQMDLGDISRVLEFTKVHTPSTGL
YBPE_SCHPO      ----------------------------------------------------------------------
RDH14_MOUSE     ----KTVLITGANSGLGRATAAELLRLGARVIGQLRQELDGTDGQLVVKDLASLRSVRAFCQELLQEERL
MKAR_NEUCR      ------AVITGASDGLGKEFAQQLASKGFNLVLVSRTQSDGFKAKTFAMDFSKDDDSDERLAELIKGLDI
HSDL2_XENLA     -----TLFITGASRGIGKAIALKAARDGANIVVAAKEAHPKLPGTIYTADVRDENQISAAVEKAVDAGGI
DHB14_BOVIN     --------------------------------------------------------------------RL
DRS7B_BOVIN     -------VITGATSGLGRECARVFHAAGARLVLCGRNGVQTHKPCTVTFDLADPGAIAGAASEILQCGHV
DHI1_HUMAN      MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
ADH_DROLE       ---------------------------------------------------------------------V
MKAR_PODAN      ------AVVTGASDGLGKEFASQLASKGFNLVLVSRTQSKGLETKVLAMDFSQDNDEDERLAKLIAGLDV
HCAB_PHOLL      ---------------------------------------------VIHGDVVSFEDNERAVAETVRCGKL
DHB12_RAT       ------AVVTGGTDGIGKSYAEELAKRGMKIVLISRNIKEKF--NVETRTIAVDFSLDDIYDKILSGLEI
BZRD_BACCE      ----RYVIITGTSQGLGEAIATQLLEESTTVISISRRLAEQYNSNCISLDLQDVHNLETNFKEIISSIKE
PGDH_BOVIN      ----KVALVTGAAQGIGRAFXXXXXXXDWNLAGVKCKAAEQFEPQFIQCDVADQEQLRDTFRKVVHFGKL
ADH_ZAPTU       ---------------------------------------------------------------------I
MKAR_CHAGB      ------AVVTGASDGLGKEFASQLAAKGFNLVLVARHLELRWSGQTKTLAMDYSQDNDARLAELISGLDI
DHRS9_MOUSE     --------ITGCDTGFGNLAARTFDKKGFRVIAACSAALKAKTSERLHTVLLDVTDPENVVKSHVGEKGL
DHI1_SAISC      MLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARHCLEAASAHYIAGTMEDMTFAEQFVAQAKLMGGL
ABA2_ARATH      ----KVALITGGATGIGESIVRLFHKHGAKVCEVCKSLLRGESKETAFFIHGDVRVEDDISNAVDFAVKL
Y1570_MYCBO     ----------------------------------------GGTAHVYPCDLSDMDAIAVMADQVLGLGGV
Y1543_MYCTU     ----------------------------------------GGTAHVYPCDLSDMDAIAVMADQVLGLGGV
HSDL2_XENTR     -----TLFITGASRGIGKAIALKAARDGANVVIAAKEAHPKLPGTIYTADVRDENQISAAVEKAVDTGGI
CBR1_MOUSE      -SSRPVALVTGANKGIGFAITRDLRKFSGDVVLAARDEERGQTAQKLQAESPRFHQLDIDNPQSIRALRL
RDH14_HUMAN     ----KTVLITGANSGLGRATAAELLRLGARVIRELRQAAECGPGELIVRDLASLRSVRAFCQEMLQEERL
MKAR_EMENI      ------AIVTGASDGLGKEFALQIARAGYNIVLVSRTATSKYPSKMLAMDFADYEKLKALIQDLDVAILI
LE767_CAEEL     ------AVVTGATDGIGKAYAFELARRGFNVLLVSREILEKYSSEVRTAAFDFTNAAPSAYKDLLATVEI
DHI1_MESAU      MLQGKKVIVTGASKGIGREMAYHLSEMGAHVVLTAREGLQKVASRCLELGAASAHYIAGTMEDMTFAEQL
CBR1_PIG        ----RVALVTGANKGIGFAIVRDLRQFAGDVVLTARDVAEGLSPRFHQLDIIDLQSIRALCDFLKEYGGL
MKAR_KLULA      -------VVTGASDGIGKEYAKQLAKRGFNLILISRTESKKIDVKILAIDVSDSKENYTLIREVASGLPV
H17B6_RAT       --------ITGCDSGFGNLLARQLDRRGMRVLAAGAEELKSKTSDRLETVILDVTNTDSISAEHVGDKGL
FOLM_ENT38      -------------------------------------SIEGLRQAGATCIQADFSTDEGILAETVKSNTL
ADH_DROVI       -----------------------------------------------------VAETTKLLKTIFAKLKV
ADH_DROFL       -----------------------------------------------------VAETTKLLKTIFAQLKV
ADH2_DROMN      -----------------------------------------------------VAETTKLLKTIFAQLKV
ADH1_DROMT      ---------------------------------------------------------------------V
TS2_MAIZE       ----KVAIVTGGARGIGEAIVRLFAKHGXXXXXXXGEALASALGPQVSFVRCDVSVEDDVRRAVDWAGRL
RDHE2_HUMAN     ---------------------------------------------------------------------V
MKAR_NEOFI      ------AVVTGASDGLGKEFSLQLARAGFNIVLVSRTASKSVQTKTLAMDFAANDDADEELKAIVNGLDV
DHRS9_RAT       --------ITGCDSGFGNLAARTFDRKGFRVIAACSEALKAKTSERLHTVLLDVTNPENVVKSHVGEKGL
DHI1_SHEEP      MLRGKRVIVTGASKGIGREMAYHLARMGAHVVVTARESLKKVVSRCLELGAASAHYVAGTMENMTFAEQL
ADH_DROLA       -----------------------------------------------------VAETTKLLKTIFAQLKV
YXNA_BACSU      -------VITGASSGIGLVTARMXXXXXXXXXXXXRNALKELTDELVKADVGKEEDVNRIAETAISTGRF
RDHE2_MOUSE     ---------------------------------------------------------------------V
RDH1_BOVIN      --------ITGCDSGFGRLLALRLDQRGFRVLASCAEDLQRVASSRLHTTLLDVTDPQSIRQAVVGEAGL
MKAR_AJECN      ------ALVTGASDGIGKEYSLQLARAGYNILLVSRTTSK------LAAVADEIKSKSPTVQTKVFAMDI
LE767_CAEBR     ------AVITGATDGIGKAYAFELARRGFNVFIVSREILEKYPN--IEVRTAAYDFTNAALLETLNKVEI
DHI1_RABIT      MLQGKKVIVTGASKGIGKEIAFHLAKMGAHVVVTARSK------ETLQEVVAHCLKLGAASAHYIAGTME
ADH_DROMY       ---------------------------------------------------------------------V
ADH_DROBO       -----------------------------------------------------LAETTKLLKTIFAQLKV
ADH2_DROMU      ---------------------------------------------------------------------V
ADH2_DROHY      ---------------------------------------------------------------------V
ADH2_DROBU      ---------------------------------------------------------------------V
ADH1_DRONA      ---------------------------------------------------------------------V
ADH1_DROHY      ---------------------------------------------------------------------V
S16C6_BOVIN     -------LITGAASGLGRLLAIKFASLGWDIMETCRIIKEERDAKVFTCDCSNRQDVYRVADQVKKVGNV
CBR1_MACFA      ----RVALVTGSNKGIGLAIVRDLCRLSGEVVLTARDVAEGLSPRFHQLDIDDLQSRDFLLKEY---GGL
ADH2_DROAR      ---------------------------------------------------------------------V
ADH1_DROMU      ---------------------------------------------------------------------V
ADH1_DROMN      -----------------------------------------------------VAETIKLLKTIFAQLKV
MKAR_PHANO      ------ALITGASDGIGKEFALALAAKGYNLILVSRSKLDSLAADILAMDFAQNKDSDNNLKKLVDGLDV
DHRSX_HUMAN     ----RVAIVTGGTDGIGYSTAKHLARLGMHVISKAKQVVSKIKEETLNCDLASMTSIRQFVQKFMKKIPL
ADH2_CERCA      -------------------------------------------------DITSKQSIKSALADVVAKVKI
MKAR_ASPCL      ------AVVTGASDGLGKEFALQLARAGFNIVLVSRTASKSVQTRTLAMDFAANDDTDEDLKTLVDGLDV
HSDL2_PONAB     ----------------------HPKLLG--TIYTAAEEIEAVGGKALPCDVRDEQQINAAVEKAIKQGGI
FABG_YEAST      ------AIVTGATRGIGKAICQKLFQKGLSCISIERTAIESYDGIEYFKDRPPLKQKYSTLSNNERRYYV
ADH_DROIM       -----------------------------------------------------LAETKKLLTTIFAKLKV
ADH2_DROWH      ---------------------------------------------------------------------V
ADH1_CERCA      -------------------------------------------------DITNKESIKQSLADVISVQHI
HSDL2_HUMAN     ----------------------HPKLLG--TIYTAAEEIEAVGGKALPCDVRDEQQISAAVEKAIKKGGI
DHI1B_XENLA     ----KRVLITGSSTGLGEQIAYEFARMGAHIMITARRLLGAASAHYVASDMGNLESAQSVAQEVVKLGGL
CBR3_HUMAN      ----RVALVTGANRGIGLAIARELRQFSGDVVLTARDVARGQAAQLQAEGLSPFHQLDIDDLQSIRALRL
ADH_DRONI       ---------------------------------------------------------------------V
ADH1_DROMO      ---------------------------------------------------------------------V
YL426_YEAST     -------LITGGSKGLGRAIVSQLLQLTILNVDICPSSVRNTRVKDLICDLSDDEEVAALLNLLKRKNEI
INHA_MYCS2      ------------------------------------------PAPLLELDVQNEEHADRITAEIGEGNKI
CBR1_PONAB      ------ALVTGGNKGIGLAIVRDLCRLSGDVVLTARDVARGQAAQLQAEGLSPFHQLDIDDLQSIRALRL
CBR1_HUMAN      ------ALVTGGNKGIGLAIVRDLCRLSGDVVLTARDVTRGQAAQLQAEGLSPFHQLDIDDLQSIRALRL
ADH_SCAAL       ---------------------------------------------------------------------V
ADH2_DROMO      ---------------------------------------------------------------------V
SPRE_XENLA      -------VLTGASRGFGRTLAHELCPRGSTLLLVSRXXXXXFPGVRVRWAAADLSTTEGVSATVRAAREL
MKAR_PICGU      ------AVITGASDGIGKEYATQLAAKGLNVVLVSREEIESVSTKVLAFDVSDAESSYEDLAATIADLPV
MKAR_MAGGR      ------AVVTGASDGLGKEFASQLAAKGFNIVLVSRXXXXXXNGSLKTKVLADYEQDNEKLGQLLSGLDV
FOLM_SHIBS      ---------------------------------------------------ADFSTNDGVMAEVLKSTHL
DHRS9_BOVIN     --------ITGCDTGFGNLAARTFDKKGFHVIAACSTALKAETSERLHTVLLDVTDPENVVKNQVGEKGL
SPRE_XENTR      -------VLTGASRGFGRTLAHLLSRTEEALKGLAGELAHKYPGVRVRWEAADLGTSEGVSAAVRAAGEL
DS7CA_DANRE     -----------------------------------------FTPKLVLLDFSDMENISDVVSEICECGCV
DHI2_HUMAN      ----RAVLITGCDSGFGKETAKKLDSMGFTVLATVLEL--NSPGRLLQMDLTDISRVLEFTKAHTTSTGL
ADH_DROPL       ---------------------------------------------------------------------V
ADH_DROMM       ---------------------------------------------------------------------V
ADH_DROGR       ---------------------------------------------------------------------V
ADH_DRODI       ---------------------------------------------------------------------V
RD10A_DANRE     ---------------------------------------------------------------------V
MKAR_BOTFB      ------AVVTGASDGLGKEYAIQLAQKGFNIVLVSRYAGSNIQTKILAMDFAANRDEDAKLKALVDGLDV
MKAR_ASPFU      ------AVVTGASDGLGKEFSLQLARAGFNIVLVSRTASK------LTTLAEEITTKHSVLKAIVDGLDV
MKAR_ASPFC      ------AVVTGASDGLGKEFSLQLARAGFNIVLVSRTASK------LTTLAEEITTKHSVLKAIVDGLDV
FABI2_RHIME     -----------AAQGAELAFTYQGEALGKRVKPLAAEVNSDF---LLPCDVEDIGSVDAVVDAIKERGKL
ADH_DROSU       -----------------------------------------------------VAETTKLLKTIFAQIKI
ADH_DROPS       -----------------------------------------------------VAETTKLLKTIFAQVKI
ADH_DROPI       ---------------------------------------------------------------------V
ADH_DROPB       -----------------------------------------------------VAETTKLLKTIFAQVKI
ADH_DROMD       -----------------------------------------------------VAETTKLLKTIFAQIKI
ADH_DROHA       ---------------------------------------------------------------------V
ADH_DROGU       -----------------------------------------------------VAETTKLLKTIFAQIKI
ADH_DROCR       ---------------------------------------------------------------------I
ADH_DROAM       -----------------------------------------------------ISETTKLLKTIFAQLKV
ADH_DROAD       ---------------------------------------------------------------------V
STDH3_CAEEL     ------AVITGGTDGIGKSFSFELAKRGFNIYIVSREIMEKYSNRFATFDFTNISDYKKLLSQLNEVS-I
RDH10_RAT       ---------------------------------------------------------------------V
RDH10_MOUSE     ---------------------------------------------------------------------V
RDH10_HUMAN     ---------------------------------------------------------------------V
RDH10_BOVIN     ---------------------------------------------------------------------V
RD10B_DANRE     ---------------------------------------------------------------------I
DHI1L_DANRE     -------LVTGASTGIGEQLAYHYARLGAQIVITARNVLEQVVSKYIPADMANPSDADLVVKYAIQLGGL
DHB3_MOUSE      ------AVITGAGDGIGKAYSFELARHGLNVVLISREEIERTTGSGVKIVQADFTREDIYIKEHLEGLEN
ADH_DROYA       -----------------------------------------------------IAETTKLLKTIFAQLKI
ADH_DROTE       -----------------------------------------------------IAETTKLLKTIFAQLKI
ADH_DROPE       -----------------------------------------------------VAETTKLLKTIFAQVKI
ADH_DROAF       ---------------------------------------------------------------------V
MKAR_PICST      ------AVITGASDGIGKEYAFQLASKGFNVVLVSRAKLETLASEIETKVVAFDASTDASLGDAISGLPV
MKAR_ASPOR      ------AVVTGASDGLGKEFSLQLARAGFNIVLVSRTASKSVQTKTLAMDFARNEDSDEKLKALVDELDV
DHI1A_XENLA     ----KRVLITGSSTGIGEQIAYEFARMGAHIMVTARRLLQEVANECLKLGAASAHYVASDMAQYVAQEAV
ADH_DROSI       -----------------------------------------------------IAETTKLLKTIFAKLKV
ADH_DROSE       -----------------------------------------------------IAETTKLLKTIFAKLKV
ADH_DROME       -----------------------------------------------------IAETTKLLKTIFAQLKV
ADH_DROMA       -----------------------------------------------------IAETTKLLKTIFAKLKV
ADH_DROER       -----------------------------------------------------IAETSKLLKTIFAKTTV
RDH10_XENTR     ----------------------------------------------------------------------
RD10B_XENLA     ----------------------------------------------------------------------
MKAR_SCLS1      ------AVVTGASDGLGKEYAIQLAQKGFNIVLISRYAGSNIQTKILAMDFAANRDEDAKLKALVDGLDV
MKAR_PYRTR      ------ALITGASDGIGKEFALSLAAKGYNLILVSRSKLDSLSADILAMDFALNKDADNNMKKLIEGLDV
FOLM_ECOSM      -------------------------------------AIDGLINAGAQCIQADFSTNDGVMAEVLKSTHL
ADH_DROTS       -----------------------------------------------------ITETTKLLKTIFAKVKV
ADH_DROOR       -----------------------------------------------------IAETTKLLKTIFAKTTV
ADH_DROHE       ---------------------------------------------------------------------V
SRLD_ECOLI      ----------------------------------------------------------------------
FOLM_SHIFL      -------------------------------------AIDGLINAGAQCIQADFSTNDGVMAEVLKTTHL
FOLM_SHIF8      -------------------------------------AIDGLINAGAQCIQADFSTNDGVMAEVLKTTHL
FOLM_SHIDS      -------------------------------------AIDGLINAGAQCIQADFSTNDGVMAEVLKSTHL
FOLM_ECOLI      -------------------------------------AIDGLINAGAQCIQADFSTNDGVMAEVLKSTHL
FOLM_ECOLC      -------------------------------------AIDGLINAGAQCIQADFSTNDGVMAEVLKSTHL
FOLM_ECOHS      -------------------------------------AIDGLINAGAQCIQADFSTNDGVMAEVLKSTHL
FOLM_ECO57      -------------------------------------AIDGLINAGAQCIQADFSTNDGVMAEVLKSTHL
FOLM_ECO24      -------------------------------------AIDGLINAGAQCIQADFSTNDGVMAEVLKSTHL
FABI_HAEIN      ----------------------------------------------------------------------
YDFG_DICNO      -------LITGASSGFGWEAAKLCVAKGHRVIGCARRTLQALQKELLPFDIADADALNAAFERLPEDWRI
HSDL2_DANRE     -----TIFITGASRGIGKAIALKAAQDGANVVIAAKTAHPKLPGTIYTVDVRDEKQNDAVEQAVEKFGGI
HSDL1_DANRE     ------AIICGASEAIAKAYAEELARHGICVILISKDLSSGVEAICIEADFNQGPSACKPIKDAISSKDI
FOLM_ECOUT      ---------------------------------------------------ADFSTNDGVMAEVLKSTHL
FOLM_ECOL6      ---------------------------------------------------ADFSTNDGVMAEVLKSTHL
FOLM_ECOL5      ---------------------------------------------------ADFSTNDGVMAEVLKSTHL
FOLM_ECOK1      ---------------------------------------------------ADFSTNDGVMAEVLKSTHL
FABI_SALTY      --------------------------------------VEEFAAQLLPCDVAEDASIDAMFAELGNVPKF
ADH_DROWI       ---------------------------------------------------------------------V
ADH_DROPU       ---------------------------------------------------------------------V
ADH_DROIN       ---------------------------------------------------------------------V
ADH_DROEQ       ---------------------------------------------------------------------V
YUXG_BACSU      ----------------------------------------------------------------LAYGGI
YR419_MIMIV     ----------------------------------------------------------------------
YMP3_STRCO      ----RSLLVLGGTSAIGLATARRLIARGARLVHLAARALEKAAGELVPFDALDPESHQASLGPVFAAGDV
RL6_PSEU5       ----------------------------------------------------------------------
FABI_ANASP      ----------------------------------------------------------------------
DHRS3_MOUSE     ---RESVLITGGGRGIGRHLAREFAERGARKIGRTEKCLKETTEEIRQMGICDVGNREEVYQMAKAVREI
AYR1_YEAST      ---KKIAVVTGASGGIGYEVTKELARNGYLVYACARRAIQ-FGNDSIKPYKLDISKPEEILRANLPDGKL
TSC10_NEUCR     --EGRTVLLTGASEGMGRSAAIQLSQKGANVILVSRNAAKNPSTQRFTYISADVSEHDAVLAEAIAGRSP
RD10A_XENLA     ----------------------------------------------------------------------
POR_PLEBO       --QKPTVVITGASSGVGLYAAKALVKRGWHVVMACRNLEKGMSPDSYTLMHIDLGSLDSVRKFVTSGKSL
FOLM_SHISS      ---------------------------------------------------ADFSTNDGVMAEVLKSPHL
FABI1_RHIME     ----------------------------------------------------------------------
ADH_DROSL       ---------------------------------------------------------------------V
ADH_DROAN       ---------------------------------------------------------------------V
WWOX_HUMAN      ----KVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAEAMTLDLALLRSVQH-FAEAFKAKNV
NOR1_ASPPA      --EETVYLVTGASRGIGRGLEAFLQRPKSTVVAWLRNVRTATPSRMIIVQLNSDSETDATLREEHGVTHL
FOLM_CITK8      ----------------------------------------------------------------------
DHRSX_MOUSE     ----RVAIVTGATAGIGRSTARQLARLGMCVVGNDEHRGQEVVSSIMGSDRAHFLPLDASLASVRGFARL
WWOX_PONAB      ----KVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAEAVTLDLALLRSVQH-FAEAFKAKNV
PORB_HORVU      ------AIITGASSGLGLATAKALAESGWHVIMACRDYLKGMPKGSYTIVHLDLASLDSV-RQFVKNVRI
FABI_SHIFL      --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF
FABI_ECOLI      --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF
FABI_ECO57      --------------------------------------VEEFAAQLLQCDVAEDASIDTMFAELGKVPKF
Y1430_HAEIN     -------------------ICKKLIEAGYKVIGTGRRALAEIHSQLLAFDIRDEQATINALNTLPEGAXX
POR_SYNY3       -----TVIITGASSGVGLYGAKALIDKGWHVIMACRNLDKGFPKDSYTIIKLDLGYLDSVVAQFRELGRL
MKAR_CRYNE      ------AVVTGCTSGIGLEFARQLAAKKFNIILVGRRALTDLSKEIVTVDVSGSARDDALTQLELLAQNL
INHA_MYCTU      -----------------------------------------------------------VTEAIGAGNKL
INHA_MYCBO      -----------------------------------------------------------VTEAIGAGNKL
HSDL2_MOUSE     -------------------------------------------------DVRDEQQINSAVEKAVEKGGI
FABI_NEIMB      ---------------------------------------------------------------------L
SPRE_MOUSE      -------VLTGASRGFGRALAPQLARLPGSVMLVSRQLKEELGAQLAAADLGTEAGVQRLLSAVRELPRP
POR_DAUCA       -----SVIITGASSGLGLATAKALAETGWHVIMACRDFLKGMPKENYTIMHLDLASLDSVRQFVETFRRL
MKAR_ASHGO      ------ALVTGASDGIGKEFALQLASKGFNVLLVSRMAKYKVDARVLSVDFVDNRLTYTAISELCGELPV
DHI1_CAVPO      MLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSK------EALQKVVARCLELGAASAHYIAGSME
DHI1L_CHICK     -------LLTGASAGIGEQMAYHYATFGAEIVLTARRVLQEVMKKCLTADMSSPSEPDRVVQFAVQLGGL
Y2073_MYCBO     --------VTGASGVLGRGLTARLLSQGHEVVGIARHRPDSWPADFIAADIRDATAVESAMADVVA----
Y2047_MYCTU     --------VTGASGVLGRGLTARLLSQGHEVVGIARHRPDSWPADFIAADIRDATAVESAMADVVA----
POR_MARPA       -------IITGASSGLGLATAKALADTGWHVIMACRDFLKGIPKDSYTVIHCDLASFDSVRAFVDNFRRL
CBR1_RAT        -SDRPVALVTGANKGIGFAIVRDLRKFLGDVVLTARDESRGHEAQLQTEGLSPFHQLDIDNPQSIRALRL
TSC10_CRYNE     --------ITGGSSGLGKALAERLVKQGAHVTIVGRDSAEGVPGQIIQCIAADLTSPIASTNAIHAACKP
PORB_ARATH      -------VVTGASSGLGLATAKALAETGWNVIMACRDFLKGMPKDSYTVMHLDLASLDSVRQFVDNFRRL
MOMAS_ORYSJ     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DAVINNAGIALPQKLESLDLPSLQTVFDLNVRAAVQVTQACLPSLKQSPAGRIVNVCSRAIHGARDRTSY
FABG_VIBHA      DILVNNAGITRDNLLMRMKDDEWNDIINTNLTPIYRMSKAVLRGMMKKRAGRIINVGSVVTMGNAGQTNY
NODG_AZOBR      DILVNNAGITRDKFFAKMDKAQWDAVIATNLSSLFNVTQQVSPKMAERGWGRIINISSNGVKGQAGQTNY
FIXR_BRAJA      HALVNNAGVS-PKTPTGDRMTSLTTVFHLNLVAPILLAQGLFDELRAA-SGSIVNVTS--IAGSRVHSAY
FABG_CUPLA      DILVNNAGITRDGLLMRMKKSQWQEVIDLNLTGVFLCTQXXXXXXXXXXXGRIINIASVVLVGNAGQANY
FABG_SHIFL      DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVTMGNGGQANY
FABG_ECOLI      DILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVTMGNGGQANY
FABG_PSEAE      LIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGRIINIGSVVAMGNAGQTNY
FABG_BACSU      DILVNNAGITRDNLIMRMKEDEWDDVININLKGVFNCTKAVTRQMMKQRSGRIINVSSIVVSGNPGQANY
FABG_BUCAP      DILINNAGITSDNLLVYMSNKEWENVIKINLTSVFYMSKSVIRSMIKKRYGRIVTIGSVIGYGNRGQINY
FABG_HAEIN      DILVNNAGITRDNLLMRMKDEEWFDIMQTNLTSVYHLSKAMLRSMMKKRFGRIINIGSVVSTGNPGQTNY
FABG_CHLTR      DVIVNNAGITRDALLMRMSEEEWSSVINTNLGSIYNVCSAVIRPMIKARSGAIINISSIVLRGSPGQTNY
FABG_THEMA      DVLVNNAGITRDALLVRMKEEDWDAVINVNLKGVFNVTQMVVPMIKQRXXXXXXXXXXXXXXXXPGQTNY
FABG1_SYNY3     DVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKSGRIINITSVAMMGNPGQANY
BUDC_KLEPN      DVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKEGHGGKIINACSQAGHGNPELAVY
FABG_STAES      DVLVNNAGITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQMLRQRSGAIINLTSIVAMGNPGQANY
FABG_STAEQ      DVLVNNAGITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQMLRQRSGAIINLTSIVAMGNPGQANY
FABG_RICPR      DILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVIAGNPGQANY
FABG_MYCTU      EVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSSGSWGIGNQANY
FABG_MYCBO      EVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSSGSWGIGNQANY
FABG_MYCS2      EVLVANAGISKDAFLMRMTEERFEEVINTNLTGAFRCAQRASRTMQRKRFGRIIFIGSSGMWGIGNQANY
PHAB_ACISR      DVLVNNAGITRDATFKKMSYEQWSQVIDTNLKTLFTVTQPVFNKMLEQKSGRIVNISSNGLKGQFGQANY
NODG_RHIS3      DILVNNAGITKDGLFVRMSDADWDTVLEVNLTAVFRLTRELTHPMMRRRHGRIINITSVVVTGNPGQTNY
PHBB_RALEH      DVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGRIVNISSNGQKGQFGQTNY
FABG_STAAW      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVGAVGNPGQANY
FABG_STAAS      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVGAVGNPGQANY
FABG_STAAR      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVGAVGNPGQANY
FABG_STAAN      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVGAVGNPGQANY
FABG_STAAM      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVGAVGNPGQANY
FABG_STAAC      DVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVGAVGNPGQANY
FABG_AQUAE      DILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGRIVNISSVVFTGNVGQVNY
UCPA_SALTY      DILVNNAGVCRLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTGDMVADETAY
UCPA_SALTI      DILVNNAGVCRLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTGDMVADETAY
FABG_MYCAV      EVLVSNAGISKDAFLIRMTEERFTEVINANLTGAFRVTQRAARSMQKKRFGRIIYIGSSGMWGIGNQANY
YMFI_BACSU      DAIVLNSGRSHFGLITDVDNATVQEMVQLHVASPYMLTRNLLPGMIRNKSGAIVAVSSIGETGASCEVLY
FABG2_BRANA     DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
FABG_SALTY      DILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAMMKKRCGRIITIGSVVTMXXXXXXXX
FABG_SALTI      DILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAMMKKRCGRIITIGSVVTMXXXXXXXX
FABG_CHLMU      DVVVNNAGITRDSLLMRMSEEEWSSVIDTNLGSIYNVCSAVIRPMIKARSGAIVNISSIVLRGSPGQTNY
UCPA_ECOLI      DILVNNAGVCRLGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMIARKDGRIVMMSSVTGDMVADETAY
PHBB_RHIME      DILVNNAGITRDAMFHKMTPEQWGEVIGTNLTGVFNMTHPLWSGMRDRGFGRIVNISSNGQKGQMGQVNY
FABG_VIBCH      DILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVTMXXXXXXXX
FABG3_BRANA     DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
FABG1_BRANA     DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
YXJF_BACSU      DILVNNAGIQHVAPIEEFPTDTFEQLIKVMLTAPFIAMKHVFPIMKKQQFGRIINIASNGLVGFAGKSAY
DER_CHICK       ELLVNNAAVAMLQPFLQVTREAVERSFDVNFRAVLHVSQVARQMIAQGLPGAIVNVSSQASQRARDHAVY
UCPA_ECO57      DILVNNAGVCRLGSFLDMSDDDRDFHIDINIKGVWNVTKAVLPEMIARKDGRIVMMSSVTGDMVADETAY
ACT3_STRCO      DVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGRIVNIASTGKQGVVHAAPY
DCXR_BOVIN      DLLVNNAAVAFLQPFLEVTKEAYDMSFSVNLRAVIQVSQIVARGLARGAPGVIVNVSSQASRGLTNHSVY
TRN1_DATST      NILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSY
FABG_BUCBP      DILINNAGIIRDKLLINMKTQDWNSVLNVNLNSIFYMSKSVIRNMIKNKQGKIITIGSVIAHGNCGQTNY
TRNH_DATST      NILINNAGTTIPKEATNFTAEDYSIIMGTNFEASYNLCQLAHPLLKASGNASIVNSSAAGVIAVPLSSIY
DHRS4_RABIT     DILVSNAAVPFFGKLMDVTEEVWDKILDINVKAMALMTKAVVPEMEKRGGGSVVIVASAAFNPFSGLGPY
BDHA_RHIME      DILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGWGRIINIASHGLVASPFKSAY
YOHF_ECOLI      DVLVNNAGAMTKAPFLDMAFDEWRKIFTVDVDGAFLCSQAARQMVKQGQGGRIINITSVHEHTPLDASAY
PHAB_PARDE      AVLVNNAGITRDAMFHKMTPQQWKEVIDTNLTGLFNMTHPVWSGMRDRKYGRIVNISSNGQKGQAGQANY
DHKR_STRCM      DVLVNNAGRSGGGVTADLTDELWDDVIDTNLNSVFRMTRAVLXXXXXXXXXXIINVASTAKQGVVLGAPY
LVR_LEIAQ       DGFFNNAGIEGKQNTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASGGIRGIGNQSGY
KDUD_BACSU      DILVNNAGIIHREKAEDFPEENWQHVLNVNLNSLFILTQLAGRHMLKRGHGKIINIASLSFQGGILVPAY
FABG5_BRANA     DVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
YLX6_SCHPO      DVLINNAGLADDTPFEQLSHESWDHDVSLVLRGNYLTQRYVIPHMKQGKGGSIVNIGSVNGHIYLGSPAY
Y2049_STAEQ     DIVVNSAGQSLSSKITDYNVEQWDTMIDVNIKGTLHVLQATLPYLLKQSSGHIINLASSGFEPTKTNAVY
Y2036_STAES     DIVVNSAGQSLSSKITDYNVEQWDTMIDVNIKGTLHVLQATLPYLLKQSSGHIINLASSGFEPTKTNAVY
BUDC_KLETE      NVIVNNAGIAPSTPIESITEEIVDRVYNINVKGVIWGMQAAVEAFKEGHGGKIVNACSQAGHGNPELAVY
TRN2_DATST      NILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGNVVFISS--VSGALAEAVY
NODG_RHIME      DILVNNAGITKDGLFLHMADPDWDIVLEVNLTAMFRLTREITQQMIRRRNGRIINVTSVAAIGNPGQTNY
GNO_GLUOX       DILINNAGIQRRAPLEEFSRKDWDDLMSTNVNAVFFVGQAVARHMIPRGRGKIVNICSVQSELARPGIAY
FABG4_BRANA     DVVVNNAGDTLLIRMKK---SQWDEVMDLNLTGVFLCSQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
DHRS4_BOVIN     DILISNAAVS-PFFGSLMDVPEWDKILDVNVKATALLTKAVVPEMAKRXXXXXXXXXXXAAYSPFPSLGY
KDUD_DICD3      DILVNNAGIIRREDAIEFSEKNWDDVMNLNIKSVFFMSQTVARQIKQGHGGKIINIASMSFQGGIPVPSY
TRN2_HYONI      NILVNNAGIVIYKEAKDYTMEDYSHIMSINFEAAYHLSVLAHPFLKASERGNVVFISS--ISGASAEAVY
FABG_BUCAI      DILINNAGIKEDNLLVNMKSTEWDDVIKTNLSSVFHLVKSVIRSMIKKRQGRIITIGSVAYTGNKGQVNY
HCDR_XANP2      DVLVNNAGITGNSELHTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGVIVNIASVALVAFPGRSAY
DCXR_CAEEL      HGLVNNAGIATNHAIGQITQQSIDRTFAVNVRGPILIAQLVARNVDRQIKGSIVNISSQAIRPLDNHTVY
YGFF_ECOLI      AALVNNAGILFTQTVENLTAERINRVLSTNVTGYFLCCREAVKRMNGGSGGAIVNVSSVALGSPGEYVDY
PHBB_CHRVI      DILVNCAGITRDKTFKKMEQAHWEAVINVNLNSVFNVTRQVWDGMLERGFGRIINISS--VNGQRGQANY
YHXC_BACSU      DILVNNAAEQHVQSIEKITSHQLIRTFQTNIFSMFYLTKAVLPHLKKGSS--IINTASTAYKGNKTLIDY
PHBB_ZOORA      DVLVNNAGITKDAMFHKMTPDQWNAVINTNLTGLFNMTHPVWSGMRDRSFGRIVNISSNGQKGQMGQANY
CPNA_COMTE      DALVNNAGILTLKPVQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHKGCIVNVSSYGLVGAPGAAAY
CPNA_COMS9      DALVNNAGILTLKPVQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHKGCIVNVSSYGLVGAPGAAAY
FABG_RICBR      DILVCNAGITKDTLAIRMKNEDFDQVIDINLKANFILNREAIKKMMTNRYGRIINITSIVVSGNPGQANY
FABG2_SYNY3     YGVVANAGITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMERKXXXXXXXXXXXXERGNVGQTNY
FABG_RICTY      DILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGRIINISSIVIAGNPGQANY
FABG_CHLPN      DILVNNAGITRDNLLMRMSEDDWQSVISTNLTSLYYTCSSVIRHMIKARSGSIINVASIVAKGSAGQTNY
RHLG_PSEAE      DILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASARVINIGSVAGISAMGEQAY
DHB8_HUMAN      PSVVVSAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCGSIINISSIVGKGNVGQTNY
DCXR_RAT        DLLVNNAAVATLQPFLEVTKEACDTSFNVNFRAVVQVSQVARGMIARGVPGAIVNVSSQASQRATNHTVY
DHR11_HUMAN     DICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGHIININSMSGHRVLPLSFY
DHB8_CANFA      PSVVVSAGLTRDEFLLRMSEDDWDRVIAVNLKGIFLVTQAAAQALVSSGCGSIINISSIVGKGNVGQTNY
CMTB_PSEPU      QILVNCAGGGVIRPFLEHTPETLKATIDRNLWTALWCSRVFLPDMLARQYGRIINIGADSVNGLPDHAAY
CMTB_PSEP1      QILVNCAGGGVIRPFLEHTPETLKATIDRNLWTALWCSRVFLPDMLARQYGRIINIGADSVNGLPDHAAY
DHR11_BOVIN     DICINNAGLARPDTLLSGSTSGWKEMFNVNVLALSICTREACQSMRERKVGHIINICGHRVPPPAETHFY
BUTA_STAAW      DVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKNHGGKIINATSQAVEGNPGLSLY
BUTA_STAAS      DVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKNHGGKIINATSQAVEGNPGLSLY
BUTA_STAAR      DVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKNHGGKIINATSQAVEGNPGLSLY
BUTA_STAAN      DVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKNHGGKIINATSQAVEGNPGLSLY
BUTA_STAAM      DVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKNHGGKIINATSQAVEGNPGLSLY
BUTA_STAAC      DVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKNHGGKIINATSQAVEGNPGLSLY
FADH_BACSU      DALINNAAGNFICPAEKLTPNGWKAVIEIVLNGTFFCSQAAARHIDQKQQGVILNMAATXXXXXXXXXXX
DHR11_CHICK     DVCINNAGLARPEPLLSGKTEGWRTMIDVNVMAVSICTREAYQSMKERDDGHIININSMNGHSVVPQSFY
BUTA_STAEQ      DVMVNNAGVDAVTPILEIGEEELSKLFNINVFGTLFGIQAAANQIKQKSKGKIINACSIAGHESYEVLTY
HSD_MYCTU       HVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSEGLAGTVACHGY
HSD_MYCBO       HVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSEGLAGTVACHGY
BAIA1_EUBSP     DVMINNAGITMNSVFSRVSEEDFKNIMDINVNGVFNGAWSAYQCMKDAKQGVIINTASTGIYGSLSGIGY
DCXR_MOUSE      DXXXXXXXXXXXQPFLEVTKEACDTSFNVNLRAVIQVSQIVAKGMARGVPGAIVNVSSQASQRATNHTVY
CBR2_PIG        DLLVNNAAVALMQPFLDTTKEVFDRSFNVNLRSVFQVSQIVARSMERGVPGSIVNVSSMVSHVTYPGAAY
Y4VI_RHISN      EVLVNNAGIG-PTMAATADLEDFQRALAINLVGAYSV--ACETAKLMKPGAAIVNVASLALLGNPKRSAY
BACC2_BACSU     DVLINNAGIEIVAPIHEMELSNWNKVLNVNLTGMFLMSKHALKYMLKSGKGNIINTCSGGVVAWPDIPAY
YJDA_BACSU      DKLINNAAHSASDNYVSLDAKSLDEHYAVNMRSNFLLCVEFARRFKKSNSGRIINMTSGQDLGPLPELAY
YVRD_BACSU      DILVNNLGFFEVKDFADVTDEEWNQYFEVNVMSAVRTSRHFLPKMLAKNSGRILNIASEAVKPLPTMIPY
Y1385_MYCBO     DVMVNNAGITRDATMRTMTEEQFDQVIAVHLKGTWNGTRLAAAIMRERKRGAIVNMSSVSGKGMVGQTNY
Y1350_MYCTU     DVMVNNAGITRDATMRTMTEEQFDQVIAVHLKGTWNGTRLAAAIMRERKRGAIVNMSSVSGKGMVGQTNY
FABG_ARATH      DVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQAAVXXXXXXXXXXXXXXSSVVLIGNIGQANY
YHDF_BACSU      DILVNNAAEQHPQSILNISTEQLEKTFRTNIFSMFHMTKKALPHLQEGCA--IINTTSTAYEGDTALIDY
Y182_METEA      DVLVNNSGVYEFAAIEEVTEEHYRRIFDVNVLGVLLATQAASKHLGEG--GSIINISSVVTDVLMPTSAY
GRDH1_ARATH     DVLINNAAEQYESSIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGSS--IINTTSNAYKGNASLLDY
DHRS4_PIG       DILVSNAAV---NPFFGNIIDATEEVWDVNVKATVLMTKAVVPEMKRXXXXXXXXXXXXAYHPFPNLGPY
FABG_ACTAC      YGVVLNAGLTRDNAFPALTDEDWDRVLRTNLDGFYNVLHPIMPMIRRRKAGRIVCITSSGLIGNRGQVNY
DCXR_MESAU      DXXXXXXXXXXXQPFLEVTKEAFDMSFNVNLRAVIQVSQIVARGMARGAPGAIVNVSSQASQRAANHSVY
BACC_BACSU      DVLINNAGIEIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKGNIINTCSGGLVAWPDIPAY
BDH2_MOUSE      DVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKMLAQKSGNIINMSSVAIKGVENRCVY
YKVO_BACSU      DILFANAGIGNFLPLGEITEEQVDRTFDINVKGTIFTVQKALSLFPDKVGSIIVTGSTAGSIGNPAFSVY
BDHA_RALEH      DILVNNAGIQHVAAIEDFPPERWDAIIAINLTSAFHTTRLALPGMKQKDWGRIINVASHGLVASAQKSAY
DHR11_MOUSE     DICINNAGMARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERDDGHIININSMCGHRVPPQSFY
YGCW_ECOLI      DILVNNAGICKLNKVLDFGRADWDPMIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFSYGGQWSPAY
SORD_KLEPN      DGLVNNAGVNFPRLLVDEKAPAFEKMVNINQKGVFFMSQAVARQMVKQRAGVIVNVXXXXXXXXXXXXXY
Y3106_PSEAE     DGLVCNAAIANPRNLEALSLGEWTRTLAVNLTGPMLLAKYCTPYLR-AHNGAIVNIASTRAHQSEDSEAY
KDUD_ECOLI      DILVNNAGLIRREDALEFSEKDWDDVMNLNIKSVFFMSQAAAKHIAQGNGGKIINIASMSFQGGIRVPSY
DCXR_CAVPO      XXXXXXXXXXXXQPFLEVTKEACVTSFNVNLRAVIQVSQIVAKGMARGVPGAIVNVSSQASQRATNHTVY
CBR2_MOUSE      DLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQVARDMINRGVPGSIVNVSSMVAHVTPNLITY
Y2778_STAA8     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASSGFEVTKSSTIY
Y2488_STAAC     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASSGFEVTKSSTIY
Y2422_STAA3     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASSGFEVTKSSTIY
FABG_RICFE      DILVCNAGITSDTLAIRMKDEDFDKVIDINLKANFILNREAIKKMMQNRYGRXXXXXXXXXXXXXPQANY
Y2403_STAAW     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTVQAALPTMLEQSSGHLINIASSGFEVTKSSTIY
Y2370_STAAS     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTVQAALPTMLEQSSGHLINIASSGFEVTKSSTIY
YQJQ_BACSU      DVLINNAGFGIFETVLDSTLDDMKAMFDVNVFGLIACTKAVLPQMLEQKKGHIINIASQAGKIATPKSSY
Y325_THEMA      DILVNNAGIVPYGNIEETSEEDFDKTMAVNVKGPFLLSKYAVEQMKKQGGGVIVNVSSEALIGIPRRCVY
Y2478_STAAM     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASSGFEVTKSSTIY
Y2266_STAAN     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGHLINIASSGFEVTKSSTIY
RDH8_HUMAN      DVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSMGLQGVIFNDVY
PECR_PONAB      NFLVNNGGGQFLSLAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVSIKTGLPLAVHS
DHG2_BACME      DVMINNAGVENPVPSHELSLENWNQVIDTNLTGAFLGSREAIKYFVENDIGNVINMSS--VHEMIPWVHY
NOG4_RHIME      -----NAGITKDGLFLHMADPDWDIVLEVNLTAMFRLTREITQQMIRRRNGRIINVTSVAAIGNPGQTNY
IDNO_ECOLI      DVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVERKAGKVINICSMQSELGRDTTPY
IDNO_ECOL6      DVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVERKAGKVINICSMQSELGRDTTPY
ENTA_ECOLI      DALVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRGMSAY
DCXR_HUMAN      DXXXXXXXXXXXQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLARGVPGAIVNVSSQCSQRATNHSVY
TRNH1_ARATH     DILINNLGAIRSKPTLDYTAEDFSFHISTNLESAYHLSQLAHPLLKASGCGNIIFMXXXXXXXXXXXXXX
FOX2_CANTR      HVIINNAGILRDASMKKMTEKDYKLVIDVHLNGAFAVTKAAWPYFQKQKYGRIVNTSSPALYGNFGQANY
FABG_RICCN      DILVCNAGITSDTLAIRMKDEDFDKVIDINLKANFILNREAIKKMIQNRYGRXXXXXXXXXXXXXPQANY
CBR4_XENTR      DYLVNSAGIALLLRTRSEDIRSLLSV---NLVGTIQTCKLALRSMIQQQGGAIVNIGSIVGHGNIGQSIY
SPS19_YEAST     DFVIAGAAGNFVCDFANLSPNAFKSVVDIDLLGSFNTAKACLKELKKSKGSILFVSATFHYYGVPFQGHV
HDHA_ECOLI      DILVNNAGGGGPKPFD-MPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNNMTSY
HDHA_ECO57      DILVNNAGGGGPKPFD-MPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNNMTSY
FOX2_NEUCR      DIVVNNAGILRDKAFHNMDDSLWDPVMNVHARGTYKVTKAAWPYFLKQKYGRVLNTTSTSIYGNFGQANY
BAIA2_EUBSP     DVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGVIINTASTGIFGSLSGVGY
Y2567_STAAR     DIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAKAALPTMLEQSSGHLINIASSGFEVTKSSTIY
PECR_HUMAN      NFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHS
GRDH_DAUCA      DVLVNNAAEQYKASVEDIDEERLERVFRTNIFAYFFMARHALKHMREGST--IINTTSNAYKGNAKLLDY
HCDS_XANP2      TGLVNNAGIAGFGSVHATEVETWSRIMAVNVTGTFLASKAALFGMLERGRGAIVNFGSVALVGIPTMAAY
Y484_MYCTU      DVLVNNAGGAKGQFVADADLEHWRWMWDTNVLGTLRVTRALLPKLIDSGDGLIVTVTSAAIEVYDGGAGY
HDHA_CLOSO      DILVNNFGTGRPEKLVNGDEDTFFELFNYNVGSVYRLSKLIIPHMIENKXXXXXXXXXXXXXXPDSRIGY
BUTA_STAES      DVMVNNAGVDAVTPILEIGEEELSKLFNINVFGTLFGIQAAANQIKQKSKGKIINACSIAGHESYEVLTY
YJGI_ECOLI      DILVVNAGIGVFGEALELNADDIDRLFKINIHAPYH---ASVEAARQMPGGRILIIGS--VNGDRXXXXX
LINC_PSEPA      DGSFNNA--AIPQALAEVSLERFRQSMDINVTGTLCMKYQILAMIERGTKGSIVNTASAAVVGVPMHGEY
VIBA_VIBCH      DHLVCCAGILHVAPLHEMPMEQVSSIFTVNAFGVLACMQGVASSMKARQQGSMVIIGSNAANTPRMSIAY
VDLC_HELPY      DVLINSAGYGVFGSVEDTPIEEVKKQFSVNFFALCEVVQFCLPLLKNKPHSKIFNLSSIA-----GRVSY
YVAG_BACSU      DILVNNLGIFEP--AEYFDIPDDERFFEVNIMSGVRLTRRYLHNMIEKKEGRVIFIASEAIMPSQEMAHY
YUSZ_BACSU      DLLVNNAGTAYGGFIEDVPMEHFRQQFETNVFGVIHVTKTVLPYIRKHGGAKIINVSSSGLTGFPALSPY
BACC_BACAM      DVLINNAGIEIVAPIHEMELSDWNKVLNVNLTGMFLMSKHALKYMLKSGKGNIINTCSGGVVAWPDIPAY
DHRS4_RAT       DILVSNAAVPFFGNLMDVTEEVWNKVLSINVTASAMMIKAVVPAMEKRXXXXXXXXXXXXXFVLFPSLGY
DECR2_HUMAN     DILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATGNRGQALQVHA
DECR2_DANRE     DILINNAAGNFLCPATSLSFNAFKTVMEIDTMGTFNTSKVIYDKWFKDHGGSIVNISATGYRGQALQVHA
FABG6_BRANA     DVIANNAGI---------------TVIALNLTGVFLCSQAATXXXXXXXXXXXXXXASVVLIGNIGQANY
DHRS4_MOUSE     DILVSNAAVPFFGNLMDVTEEVWDKVLSINVTATAMMIKAVVPEMEKRXXXXXXXXXXXAFTRFPSLGPY
BDH2_HUMAN      DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVAVKGVVNRCVY
HSD_STREX       DGLVNNAGISTGMFLETESVERFRKVVDINLTGVFIGMKTVIPAMKDAGGGSIVNISSAALMGLALTSSY
GRDH2_ARATH     DVLVNCAAEQHEVSIEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGSS--IINTTSVVAYGNSSLLEY
DECR2_PONAB     DILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATGNRGQALQVHA
XYLL_PSEPU      DILINNVGGTIWAKFEHYQEREIEAEVRRSLFPTLWCCHAALAPMIEQGSGAIVNVSSVATRGIH-RVPY
CBR4_DANRE      GFLVNAAGINRDALLLRSKSEDMLSVLHTNLLGSMLTCKAAVRNML-SHGGAIVNIGSVVVKGNAGQCVY
SDH_RHIRD       DILVNNAGLALTAPAPQVPLKDWQTMVDTNITGLLNVTHHLLPTLIER-KGIVINLSSVAAHPYLGGNVY
GS39_BACSU      DILVNNAGEQHPKEIKDITSEQLHRTFKTNFYSQFYLTKKAIDYLK--PGSAIINTTSNPYVGNPTLIDY
PECR_RAT        NFLVNNAGGQFMAPAEDITAKGWQAVIETNLTGTFYMCKAVYNSWMKDHGGSIVNIIVLLNNGFPTAAHS
VDLC_HELPJ      DVLINSAGYGVFGSVEDTPIEEVKKQFSVNFFALCEVVQLCLPLLKNKPYSKIFNLSSIA-----GRVSY
ACR1_ACIBI      DFLINNAGRSIRRAVESFDFHDFERTMQLNYFGAVRLVLNLLPHMIKRKNGQIINISSIGVLANATRSAY
ACR1_ACIAD      DFLINNAGRSIRRAVESFDFHDFERTMQLNYFGAVRLVLNLLPHMIKRKNGQIINISSIGVLANATRSAY
YTKK_BACSU      DFLINNAGIFERKKLADYTDDEWYGMLEGNLSAVFHLFKAVIPIMRKQQFGRIITYGFQAAHGWLHRSAF
YM71_YEAST      DILVNNAGKALSDRVGQIATEDIQDVFDTNVTALINITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSY
YAY8_SCHPO      DVLVNNIAYQVAQSIEDIDDEQWDLTFKTNIFSFFWVTKAAISHMKSGSS--IVNCSSNAYVGRPDLLDY
MAS12_AGRRH     DGLINNAGCGEPVNLEKIDYKQFHRQWHINCVAPLRMTELCLPYLCETGSGRVVNI--NSMSGQRPFVGY
BDH2_BOVIN      DVLFNVAGFVHHGTILDCEETDWDFSMNLNVRSMYLMIKAFLPKMMAQKSGNIINMSSVAIKGVVNRCVY
YBBO_ECOLI      YGIFNNAGFGMYGPLSTISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSMGLISTPGRGAY
YBBO_ECOL6      YGIFNNAGFGMYGPLSTISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSMGLISTPGRGAY
Y4LA_RHISN      DLLVNNASAMRDRAILDLDLAVWDQTMATNLRGTLLCCRQAIPRMIARGGGAIVNMSSQGLSGDTAQTSY
Y0419_STAS1     DILVNSAGLMLSSAITEGDVEAWEAMIDVNIKGTLYTINAVLPSMLNQSSGHIINIASSGFEVTKKSTLY
MAS1_AGRT9      DGLVNNAGCGDHVDLEKINVELLQKQWDINCVAPLIMTKLCMPYLIESGSGRIVNLNSMSQRVANSLVGY
GRDH_ORYSJ      DILVNNAAEQYERSITDITEDDLERVFRTNIFSYFFMSKHAVKRMRDXXXXXXXXXCSNAYKGNKTLLDY
DHRS4_PONAB     DILVSNAAVPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMKRXXXXXXXXXXXAAFSPSPGFSPY
DHRS4_HUMAN     DILVSNAAVN-PFFGSIMDVTEWDKTLDINVKAPALMTKAVVPEMKRXXXXXXXXXXXAAFSPSPGFSPY
YXBG_BACSU      DILFNNAGVDQEGKVHEYPVDLFDRIIAVDLRGTFLCSKYLIPLMLEN-GGSIINTSSMSGRAADDRSGY
FABG_SCHPO      DTVVHAAGVLQSSLCVRTSEKEIDSIICTNLVSAIKLSKMAILEWKNSERDRLINISSRLSTYALPGTSY
DECR_RAT        DVVINNAAGNFISPSERLSPNGWKTITDIVLNGTAYVTIEIGKQLAQKGAAFLAITTIYAESGSGFVMPS
DECR_MOUSE      DVVINNAAGNFISPSERLTPNGWKTITDIVLNGTAYVTLEIGKQLAQKGAAFLAITTIYAESGSGFVMPS
YGHA_ECOLI      MALVAGKQVAIPD-IADLTSEQFQKTFAINVFALFWLTQEAIPLLPKG-ASIITTSSIQAYQPSPHLLDY
YGHA_ECO57      MALVAGKQVAIPD-IADLTSEQFQKTFAINVFALFWLTQEAIPLLPKG-ASIITTSSIQAYQPSPHLLDY
DHK1_STRVN      DILVNNAGRSGGGATAEIADELWLDVITTNLTSVFLMTKEVLNAMLAKKRGRIINIASTGKQGVVHAVPY
DHGB_BACME      DVMINNAGMENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGTVINMSS--VHEWKIPVHY
DHBA_BACSU      DILVNVAGVLRPGLIHSLSDEEWEATFSVNSTGVFNASRSVSKYMMDRRSGSIVTVGSNAAGVPRTXXXX
Y2146_BRAJA     DLLVNNASAMRDRAILELELAVWDQTMATNLRGTLLCCRQAIPRMIARGGGAIVNMSSQGLSGDTALTSY
DECR2_RAT       DILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDHGGVIVNITATSMRGQVLQLHA
VER1_ASPPA      DIVSSNAGIVSFGHLKDVTPEEFDRVFRVNTRGQFFVAREAYRHMREG--GRIILTSSNTVKGVPKHAVY
CBR4_XENLA      DYLVNSAGISRDALLLRTRSEDIMSLLSINLVGTIQTCKVALKGMXXXXXXXXXXXXXXXXHGNIGQSIY
SDR1_PICAB      HIVVNNAGVTYPTLAQTSD-EEWDRIFQVNCKGAFLCSREAAKXXXXXXXXXXXXXXXXLVAMPIPRYAY
DHSO_RHOSH      DILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMAGGRGGKIINMASQA--GRRGEALY
DHRS7_DROME     DILINNGGISVRADVASTAVDVDLKVMVVNYFGSVALTKALLPSMVKRGSGHICFISSQGKFAIPQRAAY
DHG2_BACSU      DVMVNNSGFAMPHEMS---LEDWQRVIDVNVTGTFLGAKAALNHMKNNIKGNVLNISS--VHQQIPRVQY
FABL_BACSU      DVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLSIRYLENYTTV
SDH_AGRT5       DILVNNAGLALTAPAPQVALKDWQTMVDTNITGLLNITHHLLPTLIKQ-KGIVVNLSSVAAHPYLGGNVY
PECR_CAVPO      DFLVNNGGGQFWSSPEHISSKGWHAVIETNLTGTFYMCKAAYNSWMKEHGGAIVNIII-LLNGQPFVAHS
DHB8_RAT        SVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQALXXXXXXXXXXXXXXXXXXXXNQTNY
DHGA_BACME      DVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIGNVINMSS--VHEMIPWVHY
BPHB_PSES1      DCLIPNAGI-WDYSMPLVDIPAFDEVFHINVKGYLLAVKACLPALVQSRGSVVFTISNAGFYPNGGGPLY
BEND_ACIAD      DVLINNVGGAIWMKXXXXXXXXXXXXVHRSLFPALWCCRAVLPEMLKHQQGTIVNVSSIATRGIH-RIPY
SOU1_SCHPO      DVMIANAGIAIPHSLEDKNEDIWTKVVGINLNGAYYTAQAAGHHFKKQGKGSLIFTASMSGHIAQQWASY
RDH8_BOVIN      XXXXXXXXXXXXXXXEGLSLAAMQNVFDTNFFGAVRLVKAVLPSMKRRRQGHIVVVSSMGLQGVVFNEVY
DHG3_BACME      DVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIGNVINMSS--VHEMIPWVHY
DHB2_RAT        WAVVNNAGVLFPIDGELIPMTVYRKCMAVNFFGAVEVTKVFLPLLRKS-KGRLVNVSSMAMIPFQMVAAY
BPHB_BURXL      DTLIPNAGIDLPE--ESLDA-AFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNAGFYPNGGGPLY
YQ53_SCHPO      DIVINNAGYGLVGEFESYNIEEMHRQMNVNFWGVAYITKEALNLMRESKGGRILQISSVAYYPSPCLSMY
DHG_BACSU       DIMINNAGLENPVPSHEMPLKDWDKVIGTNLTGAFLGSREAIKYFVENDIGNVINMSS--VHEVIPWVHY
DHB2_HUMAN      WAVINNAGVGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKS-KGRLVNVSSMGGGAPMERASY
PECR_MOUSE      NFLVNNGGGQFMAPVEDITAKGWHAVIETNLTGTFYMCKEVYNSWMREHGGSIVNIIVLLNNGFPTAAHT
HCD2_RAT        DVAVNCAGIAVAKKNQVHTLEDFQRVINVNLIGTFNVIRLVAGVMGQNEPGVIINTASAAFEGQVGQAAY
DHG4_BACME      DVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIGNVINMSS--VHEMIPWVHY
DHB8_MOUSE      PSVVVSAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQALXXXXXXXXXXXXXXXXXXXXXQTNY
DHB2_MOUSE      WAVVNNAGVHLPIDGELIPMSIYRKCMAVNFFGTVEVTKAFLPLLRKS-KGRLVNVSSMGGTVPLQMTSY
YWFH_BACSU      DVLINNIPGGAPDTFDNCNIEDMTATFTQKTVAYIDAIKRASSLMKQNEFGRIINIVGNLWKGANMFTN-
T4HR_MAGGR      DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
STCU_EMENI      DIVSSNAGIVSFGHVKDVTPDEFDRVFRVNTRGQFFVAREAYRHLREG--GRIILTSSNSVKGVPRHAVY
BPHB_PSEPU      DTLIPNAGIDLPE--ESLDA-AFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNAGFYPNGGGPLY
NAHB_PSEU8      DCFIANAGISIEEPWEKIS-SSFDEIFDINVKSYFSGISAALPELKKTNGSVVMTXXXXXXXXXXXXXCY
NAHB_PSEPU      DCFIANAGISIEEPWEKIS-SSFDEIFDINVKSYFSGISAALPELKKTNGSVVMTXXXXXXXXXXXXXCY
DHB8_CALJA      ------------------------------------------------------------------QTNY
CBR4_BOVIN      NFLVNAAGINRDNLLVRTNTEDMLSQLHTNLLGSMLTCRAALKTMIKQQRGSIVNVGSVVLKGNSGQSVY
Y4MP_RHISN      NILINNAGITQPVKTLDISDADWQRIVAVNMTGVLNLSQVFIPNMRQNGGGSIASVSAQRGGGIFGGPHY
Y1627_STAS1     DVLINNAGLMPQSFLEKNKQDEWNQMIDVNIKGVLYGIGAVLPYMRKQKSGHIINLASVAGHVVFPGSAY
DHB8_PIG        SVVVSCAGITRDEFLLRMSEDDWDKVIAVNLKGIFLVTQAAAQALVXXXXXXXXXXXXXXXXGNMGQTNY
THR1_GLOLA      DIVCSNSGVVSFGHVKDVTPEEFDRVFAINTRGQFFVAREAYKHLEVGGRLILMGSITGQAKGVPKHAVY
DHB1_PANTR      DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRVLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
DHB1_RAT        DVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRMLQAFLPDMKRRHSGRVLVTASGGLMGLPFHEVY
YXEK_CAEEL      DILINNAAGNFIMATERLSPNAYGTIIDIVLKGTLHVTRRCIQQKRGASVLSITTLYAQS--GAPFVVPS
Y4EK_RHISN      DVLVNNAGLTASASLVDLSEDDIDAMIDINIRSVFKLTRHVLKQMIERRRGHIFFTGSSGGLAPHPNSSY
MOAE_KLEAE      ---------------------------DGNLTSAFASVRACLPSLI-ARRGNVLFVASIASLAAGPQAGY
KDSR_BOVIN      DMLVNCAGMSLSGKFEDLEVSTFERLMSINYLGSVYPSRAVIATMKERRMGRVVFVSSQAGQGLFGYTAY
DHRS7_HUMAN     DILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSLGIISVPLSIGY
DHB14_HUMAN     DCVVNNAGHPPPQRPEETSAQGFRQXXXXXXXXXXXXXKLALPYLRKSQ-GNVINISSLVAIGQAQAVPY
DHB1_MOUSE      DVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRMLQAFLPDMKRRHSGRVLVTASGGLMGLPFHEVY
DHB1_HUMAN      DVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSGGLMGLPFNDVY
LIMC_RHOER      DIVSANAGIASVPFL-SHDIPTWRQMIDINLTGVWHTAKVAVPHILAGERGGSIVLTSSALKGYAQISHY
FOX2_YEAST      DVLINNAGILRDVSFAKMTEREFASVVDVHLTGGYKLSRAAWPYMRSQKFGRIINTASPALFGNFGQANY
YHXD_BACSU      ------------ENIEDLPTEQIYKTFEVNVFSLYWVVKAALPYLPEG-ASIITTTSVEGYNPSPMLLDY
Y0585_STAHJ     DIFVNCAGVMRSSKITDYQVESWDSMVDTNIKGLLYSLNAILPKFEAQGSGHVVNLASSANEVSKESALY
KDSR_HUMAN      DMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQGLFGFTAY
DHRS7_MOUSE     DILVNNGGRSQRSLVLETNLDVFKELINLNYIGTVSLTKCVLPHMIERKQGKIVTVNSIAIASVSLSSGY
DHK2_STRVN      DVLVNNAGRAIPHADLAAATPEVREILGLNVIGTWQTTVAAMPHLAR--XXXXXXXXXXXIAGSRPAGSY
YIV6_YEAST      DGIVANAGMLEPVKSISQDIKQWERLFDVNFFSIVSLVALCLPLLKSSPVGNIVFVSSGAVKPYNGWSAY
LINX_PSEPA      TTLSNTAGIIHPGGFEEESIEGWNKMVAVNQTAIFLGIKAAIPELKXXXXXXXXXXXXXXMFPTAGNASY
BDH_BOVIN       EGLVNNAGISTFGDVEFTSMETYKEVAEVNLWGTVRVTKAFLPLIRRA-KGRVVNISSMMGRMANARSPY
DHB4_HUMAN      DVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASIYGNFGQANY
BPHB_COMTE      DTLIPNAGIALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLY
DHB12_XENTR     GVLVNNVGVSYEHPEYFLEIPDLENTLDINITSVCQMTRLVLPGMLGRGRGVILNISSASMYPVPLLTVY
DH12B_XENLA     EALVNNVGISYEYPEYFLEIPDLENTLDINIMSVCQMTRLVLPGMLGRGKGVVLNISSASMYPVPLLTVY
DH12A_XENLA     GVLVNNVGVSYEYPEYFLEIPDLENTLDINIMSVCQMTRLVLPGMLGRGKGVILNISSASMYPVPLLTVY
DHB12_ANAPL     GVLVNNVGISYSYPEYFIDVPDLDKTIDINIMSVCKMTRLVLPGMLERSKGVILNISSAAMYPTPLLTLY
MTDH_AGABI      SGLIANAGVSVVKPATELTHEDFKFVYDVNVFGVFNTCRAVAKLLQKQQKGSIVVTXXXXXXXXXXQVFY
UXUB_BACSU      DLLINGAGGNHPQSFFDMDERGFLTVFSTNFTGAFLASQVFGKELLKADSPAIINLSSMSAYSPMTKVAY
HCD2_DROME      DLTVNCAGTATAVKTFNFNLEDFQRVININIRLSAGLMGANEPN-QDGQRGVIVNTASAAFDGQIGQAAY
DHB4_MOUSE      DVVVNNAGILRDRSFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASIYGNFGQANY
KDSR_MOUSE      DMLVNCAGTSMSGKFEELEVSSFEKLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQGLFGFTAY
HCD2_HUMAN      DVAVNCAGIAVASKTYNLKLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPGVIINTASAAFEGQVGQAAY
DHB4_RAT        DVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGRIIMTASASIYGNFGQANY
CBR4_MOUSE      NFLVNAAGINRDSLLVRTKTEDMISQLHTNLLGSMLTCKAAMKTMIQQXXXXXXXXXXXXLKGNVGQSAY
YQC8_SCHPO      HVVVANAG--MPFRRSVLDSPEFEKVMNINTNSVYRVAYYMGKIFKKQGFGNLIATASMSVNAPQHIAAY
YOXD_BACSU      DILINNAGISKFGGFLDLSADEWENIIQVNLMGVYHVTRAVLPEMIERKAGDIINISSTAQRGAAVTSAY
YCIK_ECOLI      DGVLHNAGLLGDVCPMSEQNPQVQDVMQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSGRQGRANWGAY
MAS11_AGRRH     DGLVNNAGYGEPVNLDKVDYQRFHLQWYINCVAPLRMTELCLPHLYETGSGRIVNI--NSMSGQRPLVGY
DRS7B_MOUSE     DVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKQGHIVAISS--IQGKISRSAY
ARDH_PICST      DLLINTAGYCENFPAETYPATNAESIMKVNGLGSFYVSQSARPLIQNNLRGSIILIGSMSVNDPQPQCMY
YVX3_CAEEL      DILVNNAAGNFIMATERLSPNAHGTIIDIVLKGTMNVTTELGKRCIQSKTGASVTSITAAYSGAPFIVPS
RIDH_KLEAE      DIFHANAGAYIGGPVAEGDPDVWDRVLHLNINAAFRCVRSVLPHLIAQKSGDIIFTAVIAVVPVIWEPVY
HETN_ANASP      DVLINNAGIEINGTFANYSLAEIQSIFNTNXXXXXXXXXXXXPSMMERGSGRIVNIASLAKKGVAFNSVY
DRS7B_XENLA     DILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALLPSMIKNRRGHVVVISS--VQGKISRSAY
DECR_HUMAN      --VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLAQKGAAFLSITTIYAETGSGFVVPS
BPHB_PSEPS      DTLIPNAGIDLPE--ESLDA-AFDEVFHINVKGYIHAVKA-LPALVASRGNVIFTISNAGFYPNGGGPLY
DHI2_MOUSE      WGLVNNAGLNIVADVELSPVATFRKCMEVNFFGALELTKGLLPLLRHS-RGRIVTVGSPAGDMPYPLAAY
BDH_RAT         WGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSFLPLLRRA-KGRVVNISSMLGRMANPRSPY
ARDH_CANTR      --LINTAGYAENFPAEEYPAKNAENIMKVNGLGSFYVSQAARPLIQNNMTGSIILIGSMSVNDPQPQCMY
YDFG_SHIFL      DILVNNAGLALGMEAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTA----------
YDFG_SALTY      DVLVNNAGLALGEPAHKASVEDWETMIDTNNKGLIYMTRAVLPGMVERNRGHIINIGSTASWPYAGGNVY
YDFG_SALTI      DVLVNNAGLALGEPAHKASVEDWETMIDTNNKGLIYMTRAVLPGMVERNRGHIINIGSTASWPYAGGNVY
Y019_THEMA      DVLVNNAAVMSVKSIFERPLEEWERVIRVNLTGPYICSRYCAEEMIKRGGGVIINIASRAFQSEPDTEPY
HCD2_MOUSE      DVAVNCAGIAVAKKNKIHTLEDFQRVINVNLIGTFNVIRLVAGEMGQNEPGVIINTASAAFEGQVGQAAY
DRS7B_XENTR     DILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALIPSMIKNRRGHIVVISS--VQGKISRSAY
DHI2_RAT        WGLVNNAGLNMVADVELSPVVTFRECMEVNFFGALELTKGLLPLLRHS-RGRIVTVGSPAGDMPYPLAAY
YWC4_CAEEL      EILVNNAAGNFIMATELLSSNAYGTIIDIVLKGTFNVTTELGKRCIQNKTGASITTAGYARAGAPFIVPS
YIV5_YEAST      DSLVANAGVLEPQNVNEIDVNAWKKLYDINFFSIVSLVGIALPELKKT-NGNVVFVSSDACNYFSSWGAY
RDH13_HUMAN     DILINNAGVMRCPHWTTEDGFEMQ--FGVXXXXXXXXXXXXXXXXKASAPSRIINLSSLAVAGHIDKAAY
DHB11_PONAB     SILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMMKNNHGHIVTVASAAGHSVPFLLAY
BDH_MOUSE       WGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSFLPLLRRA-KGRVVNISSMLGRMANPRSPY
DHRS7_ANOGA     DILVNNGGI-------SVRGDALSTAIDVDIRGSVALTKACLPSMMARKEGRIVSISSQGKFAIPHRSAY
CBR4_RAT        NFLVNAAGINRDSLLVRTKTEDMLSQLHTNLLGTMLTCRAAMRTMIQQXXXXXXXXXXXXLKGNVGQAAY
Y432_LISMO      DAIFLNAGIMPNSPLSALKEDEWEQMIDINIKGVLNGIAAVLPSFIAQKSGHIIATSSVALKAYPGGAVY
Y048_HAEIN      -----------------LDKSGIEFVFNLNYLGSLLPTQVFAKDMLGKQGANIINISSNAFTPLTKIPAY
HSDL1_HUMAN     GILVNNVGVPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSSCCKPTPQLAAF
DHB11_RAT       SILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMMKNNHGHVVTVASAAGHTVVPLLAY
DHB11_HUMAN     SILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHSVPFLLAY
DECR2_MOUSE     NILINCAAGNFLCPASALSFNAFKTVVDIDTIGTFNVSSVLYKKFFRDHGGVIVNITATSMRGQVLQLHA
CBR4_HUMAN      NFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMQQQXXXXXXXXXXXXLKGNSGQSVY
YDFG_ECOL6      DILVNNAGLALGMEAHKASIEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTA----------
Y5909_MYXXD     DLVVANAGVGGTTNAKRLPWERVRGIIDTNVTGAAATLSAVLPQMVERKRGHLVGVSSLAFRGLAGHAAY
Y452_LISIN      DAIFLNAGIMPNSPLSALKEDEWEQMIDINIKGVLNGIAAVLPSFIAQKSGHIIATSSVALKAYPGGAVY
TODD_PSEP1      DCLVGNAGV-WDYLTQLVDIPAFEEMFEVNVKGYILAAKAALPALYQSKGSAIFTVSNAGFYPGGGGVLY
BNZE_PSEPU      DCLVGNAGV-WDYLTQLVDIPAFEEMFEVNVKGYILAAKAALPALYQSKGSAIFTVSNAGFYPGGGGVLY
YI78_SCHPO      DVLLNNAGYSVYSPLESTTEEQIHNIFNTNVFGALEVIKAITPIFRSQHNGMIINVSS--IGGKMTGCLY
PGDH_CAVPO      DILVNNAGVNNEKNWEK--------TLQINLVSVISGTYLGLDYMSKQHGGEIINMSSLALMPVAQQPVY
HSDL1_CHICK     GILVNNVGLTYPDYFTNLSEDMLWDMINVNIASANMMVHIVLPGMVEKRKGAIVNVSSASCQPTPMLTTY
DRS7C_HUMAN     DILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKALLPNMISRRTGQIVLVNNQGKFGIPFRTTY
CSGA_MYXXA      DVLINNAGVSLWCALGDVDYADMARTFTINALGPLRVTSAMLPGLRQGALRRVAHVTSRAANTDGGAYAY
ARDH_CANAL      --LVNTAGYAENFPAEEYPAKNAENLMKVNGLGSFYVSQAARPLIQNNMTGSIILIGSMSVNDPQPQCMY
DH12A_DANRE     GILVNNVGISYSYPEFFLHIPDLETMINVNITSVCQMTRLVLPRMEARAKGVILNISSASMFPVPLLTIY
BDH_HUMAN       XGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMTKSFLPLIRRA-KGRVVNISSMLGRMANPRSPY
SOU2_CANAL      DIFVANAGVAWTEEIDVKGVDKWNKVVDVDLNSVYYCAHVVGPIFRKKGKGSFIFTASMSVNVPQLQAAY
SOU1_CANAL      DIFVANAGVAWTDEIDVQGYDQWKKIVDCDLNGVYYCAHTVGQIFKKNKSGSLIITSSMSVNIPQLQAPY
FOLM_KLEP7      RAIIHNASDWMAEKPGVPLSTVINRMMQIHVHAPYLLNHALEALLRGHAASDIIHITDYVVERGSDKIAY
DRS7B_HUMAN     DILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISS--IQGKMSRSAY
DHG_BACME       DVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGTVINMSS--VHEKIPWVHY
DHG1_BACME      DVMINNAGMENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGTVINMSS--VHEKIPWVHY
YDFG_ECO57      DILVNNAGLALGMEAHKASIEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTA----------
YB45_SCHPO      DSVILNAGVLEPAKIADADINEWRKLFDINFFSVVETVKYAIPHLRKTKGTIVIVSSGAAVRVFPAWAAY
RDH16_HUMAN     WGLVNNAGISLPAPNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRA-RGRVVNVSSVMGRVSLFGGGY
HSDL1_PONAB     GILVNNVGVPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSSCCKPTPQLAAF
DHRS2_HUMAN     DFLVCSAGV---NPLVGSTLGTSEQIWDVNVKSPALLLSQLLPYM-ENRRGAVILVSSIAAYNPVVALGY
YDFG_ECOLI      DILVNNAGLALGMEAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERNHGHIINIGSTA----------
Y7799_EMENI     DTVIHNAGIGYATASQEITADKISAVFAVNTLAPYILT-----CLMHKPKARLLYMSSDSHYGG-DESLR
MTDH_UROFA      TGLIANAGVSVVKEALQYNKDDFNKIFDVNVFGVFNCAQAMAQIWTDTGFQRXXQICNRPL----TQCFY
HSDL1_BOVIN     GILVNNVGVPYPQYFTQVSEDTLWDIVNVNIAAASLMVHIVLPGMVERKKGAIVTISSSCCKPTPQLAAF
DRS7B_PONAB     DILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISS--IQGKISRSAY
DLTE_BACSU      NVLVNNAGIEIDFKKGTEELFVDGDEIELNFQAPVHLSALFTPHLMKQPEAAIVQVTSLAFNPLAVYPVY
DHB11_MOUSE     SILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHFWTTKAFLPVMMKNNHGHIVTVASAAGHTVVPLLAY
YI13_SCHPO      DVLINNAGLALTDKVIDLNIDDAVTMITTNVLGMMAMTRAVLPIFYSKNKGDILNVGSIAGRESYVGGSY
YD114_YEAST     XXXXXXAGVAHIKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDMIDNREGFIINIASGELTPAR-LTSY
HCD2_BOVIN      DVAVNCAGIAVASKTYNLKLEDFQRVINVNLIGTFNVIRLVAGEMGQNEPGVIINTASAAFEGQVGQAAY
DR9C7_MOUSE     WALVNNAGVGLPSPNEWLTIKDFVKVININLVGLIDVTLNMLPMIKKA-RGRVVNMSSSGGRVAIFGGGY
DHI2_SHEEP      WGLVNNAGQNIVADAELCPVATFRTCMEVNFFGALEMTKXXXXXXXSSPAGDMPFPCLAA---------Y
DCXR_TRIRE      DAFIANAGATANSGVVDGSASDWDHVIQVDLSGTAYCAKAVGAHFKKQGHGSLVITASMSGHVAQEQTSY
RDH1_HUMAN      FGLVNNAGVAIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQQA-RGRVINITSVLGRLAANGGGY
PGDH_MOUSE      DILVNNAGVNNEKNWEQ--------TLQINLVSVISGTYLGLDYMSKQNGGEIINMSSLALMPVAQQPVY
MKAR_MALGO      AVLVNNVGLSMPVNFLEMDGRELASICQVNIVATMQVTRVVAPHLVRRGRGLILNLGSFSGQWSTPLATY
HCAB_ECOLU      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECO8A      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALISSEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECO7I      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLSAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
DRS7C_MOUSE     DILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKVLLPNMISRRTGQIVLVNNQAKFGIPFRTAY
DRS7B_RAT       DILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKRGHIVAISS--IQGKISRSAY
DHB13_RAT       EIVVNNAGAIYPADLLSTKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCGHRVIPLIPY
DHB12_MACFA     GILVNNVGMSYEYPEYFLDVPDLDNVININILSVCKMTQLVLPGMVERSKGAILNISSSGMFPVPLLTIY
DHB12_HUMAN     GILVNNVGMSYEYPEYFLDVPDLDNVININILSVCKMTQLVLPGMVERSKGAILNISSSGMLPVPLLTIY
DHB12_BOVIN     GVLVNNVGMSYEYPEYFLDVPDLKKLITVNALSVCKMTRLVLPGMVERSKGAILNISSASMYPVPLLTIY
RDH7_MOUSE      WGLVNNAGICVFAINEWLKKEDFANILDVNLLGMIEVTLSMLPLVRKA-RGRVVNISSSMGRVSLCGGGY
HCAB_SHISS      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAARYPGGGGPLY
HCAB_SHIBS      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECOSM      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECOSE      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECOLI      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECOLC      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECOHS      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECODH      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECOBW      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECO55      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECO24      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
DRS7C_XENTR     DVLINNASMKMKGPLQSVSLELDKKIMDANYFGPITLVKAILPHMISRRTGQIVLVNTQGKIGVPFRAAY
DRS7C_BOVIN     DILINNASVKVKGPAHKISLELDKKIMDANYFGPIILTKALLPDMISRRTGQIVLVNNQGKLGIPFRTAY
DHB13_HUMAN     TIVVNNAGTVYPADLLSTKDEEITKTFEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHGIPYLIPY
DHI1L_XENTR     DYLVLNHIGWTPFKMWDGDVNHTRWLMEVNFLSYIHLATAALPYLTQSKGSIIVLSSLTAKTPIPYTTSY
DHB13_MOUSE     EIVVNNAGAIYPADLLSAKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCGHGVIPLIPY
RDH7_RAT        WGLVNNAGISVPMPNEWMRKKDFASVLDVNLLGVIEVTLNMLPLVRKA-RGRVVNIASTMGRMSLLGGGY
BZRD_BACSU      DTLINNAGMVTPKRAGEASLDELQRHYQLNLTAPVLLSQLFTKRFSYSGKKTVVNITSGAAKNPKGWSAY
YUSR_BACSU      --------------------------------------RAVVPFMKKSKDGAIVNVXXXXXXXXXXXXMY
RDH3_RAT        WGLVNNAGISVPGPNEWMRKKDFASVLDVNLLGVIEVTLNMLPLVRKA-RGRVVNIASTMGRMSLVGGGY
PGDH_MACFA      DILVNNAGVNNEKNWEK--------TLQINLVSVISGTYLGLDYMSKQNGGEIINMSSLALMPVAQQPVY
PGDH_HUMAN      DILVNNAGVNNEKNWEK--------TLQINLVSVISGTYLGLDYMSKQNGGEIINMSSLALMPVAQQPVY
HSDL1_RAT       GILVNDVGYPYPQYFSQVPEDTIWDIVNVNIAAASLMVHIVLPGMVERKKGAIVTVSSSCCKPTPQLAAF
DR9C7_BOVIN     WALVNNAGVGLPSPNEWLTKEDFVKVINVNLVGLIEVTLHMLPMVKKA-RGRVVNMSSSGGRVAVIGGGY
DHMA_FLAS1      ----------------------------------------------------------------------
DHI2_RABIT      WGLVNNAGHNVVADVELSPVATFRNCMEVNFFGALELTKGLLPLLHHS-RGRIVTLGSPAGEMPYPLAAY
DHB3_RAT        GVLVNNVGM-LPNLLPSHFLSTSQSVIHCNITSVVKMTQLVLKHMESRRRGLILNISSGV--GVRPYSLY
RDH13_MOUSE     DILVNNAAVMRCPHWTTEDGFEMQ--FGVNYLGHFXXXXXXXXXXKASAPSRIINLSSLAVAGHIDKAAY
RDH12_MOUSE     HILINNAGVMMCPYSKTTD--GFETHFGVNHXXXXXXXXXXXXXXKESAPARVVNLSSIAFHDLQGQKRY
HSDL1_MOUSE     GILVNDVGYPYPQYFSQVPEDTLWDIVNVNIAAASLMVHIVLPGMVERKKGAIVTVSSSCCKPTPQLAAF
HCAB_SHIFL      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_SHIF8      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECO5E      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIAGEGSMIFTLSNAAWYPGGGGPLY
HCAB_ECO57      DCFIGNAGILVNTPAETLET-GFHELFNVNVLGYLLGAKACAPALIAGEGSMIFTLSNAAWYPGGGGPLY
DRS7B_DANRE     DVLINIAGVSYRGNILDTHVSVQREVMETNYFGPVALTQAILPSMVDRGSGHIVVISS--VQGKISRSAY
DR9C7_HUMAN     WALVNNAGVGLPSPNEWLTKDDFVKVINVNLVGLIEVTLHMLPMVKRA-RGRVVNMSSSGGRVAVIGGGY
DR4L2_HUMAN     DILVSNAAVPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMKRXXXXXXXXXXXAAFSPSPGFSPY
DHB11_MACFA     SILVNNAGVVYTSDLFATQDAQIEKTFEVNILAHFWTTKAFLPAMMKNNHGHVVTVASAAGHSVPFLLAY
DH12B_DANRE     GVLVNNVGVSYSYPEFFLNIPDVDSXXXXXXXSVCQMTRLVLPRMVDRSKGVILNVASASMYPVPLLTLY
BPHB_RHOGO      DCYIGNAGVALVEIPEDRLDEAFDEMYSINVKGYLLGVKAALGALYASRGSVIFTVSNAGFYPAGGGALY
Y4EL_RHISN      DAAVKTAGRIRSSICAAIRAPLLEITDDMNIKGTYHMMVAAVKHMQGHKAGRIVNITSVDAFKAHPQNAY
STDH2_CAEEL     GILINNVGMFFPEMLHKINIDSIANVIIINTLPATLLSAGILPQMVSRKAGIIVNIGSFAVVKLAEWSIY
MFEA_DICDI      DILINNAGILRDVSFGKMTDGDWDLVYRVHAKGAYKLSRAAWNHMREKNFGRIIMTSSAALYGNFGQANY
DHB3_HUMAN      GILVNNVGM-LPNLLPSLNAPEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGALFPWPLYSMY
BDH_CHICK       WGLVNNAGISTFGEVEFTSMDTYMEVAEVNLWGTVRTTKAFLPLIRRS-KGRVVNISSMGRMGSPARSPY
YAEB_SCHPO      HYLINNAGAPCSAPAIDLDIEDVSKVMDVNFYGVIRMNKAFQHQLIRA-KGTIVNVNSLVSYPXXXXXXX
Y945_MYCTU      DRVIVNAGIGKGARLGSGKLWANKATIETNLVAALVQIETALDMFNQRGSGHLVLISSKGVPGVK--AAY
STDH1_CAEEL     GILINNVGMFFPEMLHKINIDSIANVTIINTLPATLLSAGILPQMVPRKAGIIVNIGSVALATMAEWSVY
RDH2_RAT        WGLVNNAGISGHLPNEWMNKQNIASVLDVNLLGMIEVTLSTVPLVRKA-RGRVVNVASIAGRLSFCGGGY
DS7CB_DANRE     DVLVFNSSMKLKAPVHSLSLQMDRLLMDVNYFGPITLVKGFLPSLISRRSGHILLV--NSIQGKLARTTY
DHRS7_DICDI     DICVWNAGSGSLIEFSKLDISIYRDNMELNYFSLVNCTHLVYKYLEQSHGSIIVISSLAGKFGTALRTSY
RDH12_HUMAN     HILINNAGVMMCPYSKTAD--GFETHLGVNHXXXXXXXXXXXERLKVSAPARVVNVSSVAHHIGKDLQSY
RDH12_BOVIN     HILINNAGVMLCPYSKTAD--GFETHLAVNXXXXXXXXXXXXXXXKESAPARVVNLSSVAHHLGKIRFAY
RDH11_MOUSE     HLLINNAGVMMCPYSKTAD--GFEMHIGVNXXXXXXXXXXXXXXXKESAPSRIVNLSSLGHHLGRIHLAY
RDH11_HUMAN     HVLINNAGVMMCPYSKTAD--GFEMHIGVNXXXXXXXXXXXXXXXKESAPSRIVNVSSLAHHLGRIHLAY
DHI1_RAT        DMLILNHITQTTMSLFHDDIHSVRRSMEVNFLSYVVLSTAALPMLKQS-NGSIAIISSMAGKMTQPLASY
DHI1_MOUSE      DMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQS-NGSIAVISSLAGKMTQPMIAY
DHB12_MOUSE     GVLVNNVGMSYEYPEYFLEIPDLKKLININVLSVCKVTRLVLPGMVERSKGVILNISSASMLPVPLLTIY
PTR1_LEIMA      DVLVNNASSFYPTPLLRNDREAMETLFGSNAIAPYFLIKAFAHRFAGTPAKHIINMVDAMTNQPLGYTIY
MKAR_ASPTN      AVLINNVGKSMPVPFALTSEEEMTDIVTINCMGTLRVTQLVVPGMMQRRRGLILTMGSGGLLPTPLLATY
KDSR_DICDI      DCLINCAGFAIPGYFIEQDEEIFEKTMQLDYFGSLYATKEVVPLMIENQGGHIVFVSSTGLVGVPGYSTY
H17B6_MOUSE     WGLVNNAGVLQPAYIEWYRPEDYMPIFQVNLIGLTQVTISMLFLVKKA-RGRIVNVSSALGRVALFGGFY
TSC10_CANAL     DILFCCAGSSIPKLFQDLTKVDIESGIDINYKTVINVVHT---GFKHALSNNTDNL---EPHNFKKRSQY
PTR1_LEITA      -------------------------------------------------------------------TMY
DHI2_BOVIN      WGLVNNAGQNIVADAELCPVATFRTCMEVNFFGALEMTKXXXXXXXSSPAGDMPFPCLAA---------Y
YBPE_SCHPO      -ALINAAAIAPKNHLLSISRQELQKCFETNVIGQLAITSALFPLLLQDPNPHVVNIASSAYFSAMGVGAY
RDH14_MOUSE     DVLINNAGVFHCPYTKTEDGFEMQ--FGVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYKNFEDLNSY
MKAR_NEUCR      GILINNVGHSIPVPFLQTDRDELQNIVTINCLGTLKTTKVVAPILAQRKKGLILTMGSFAVMPTPYLATY
HSDL2_XENLA     DILVNNASISLTNTLET-SMKKVDLMMGINTRGTYLTSKICIPYLKKSKVAHI-----------------
DHB14_BOVIN     DCIVNNAGYPPPQWPEETSAQGFRQXXXXXXXXXXXXXKLALPHLRKS-RGNVINISSLVAIGQSQAVPY
DRS7B_BOVIN     DVLINNAGISYRGAIVDTSPDVDKRVMETNYFGPVALTKALLPAMIRRRQGHVVAISS--IQGKISRSAY
DHI1_HUMAN      DMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKVAYPMAAY
ADH_DROLE       DILINGAGI--------LDDHQIERTIAINFTGLVNTTTAILDKRKGGPGGIIANICSNAIHQV---PVY
MKAR_PODAN      GILINNVGHSIPVSFLDTEKTELQSIVTINCLGTLKTTKVVAPILAARKKGLILTMGSFATMPTPYLATY
HCAB_PHOLL      DCFVGNAGI-WDHKISLLDASPEQILMGVNLKGYILGAKAALPALTASEGSMIFTLSNSSWFSGGGGVLY
DHB12_RAT       GVLVNNVGMSYEYPEYFLEIPDLKKLININVLSICKVTRLVLPGMVERSKGVILNISSASMLPVPLLTVY
BZRD_BACCE      DNVINNAGTVAPMKIEKAESEQFITNVHINLLAPMILTSTFMKHTKEWKVDRVINISSGAGKNPYGWGAY
PGDH_BOVIN      DILVNNAGVNNEKNWEK--------TLQINLVSVISGTYLGLDYMSKQNGGENINMSSLALMPVAQQPVY
ADH_ZAPTU       DLLINGAGI--------LDDHQIERTIAVNFTGLVNTTTAILQKRKGGPGGVIANICSTGFNAIYQVPVY
MKAR_CHAGB      GILVNNVGHSIPVPFLETAREELQDIITINCLGTLKTTQVVAPILAKRKKGLILTMGSFAVMPTPYLATY
DHRS9_MOUSE     WGLINNAGVGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKA-RGRVINVSSIGGRLAFGGGGY
DHI1_SAISC      DMLILNHITNTSLNFFHDDIHHVRKSMEVNFLSYVVLTVAAMPMLKQS-NGSIVIVSSVAGKVAYPMISY
ABA2_ARATH      DILINNAGLAPCPDIRNYSLSEFEMTFDVNVKGALSMKHAARVMIPEKKXXXXXXXXXXXXXXXXXXXXX
Y1570_MYCBO     DILINNAGRSIRRSLESYDIHDYQRTMQLNYLGAVQLILKFIPGMRERHFGHIVNVSSVGVQTRAPRGAY
Y1543_MYCTU     DILINNAGRSIRRSLESYDIHDYQRTMQLNYLGAVQLILKFIPGMRERHFGHIVNVSSVGVQTRAPRGAY
HSDL2_XENTR     DILVNNASISLTNTLET-PMKKVDLMMGINTRGTYLTSKICIPYLKKSKVAHI-----------------
CBR1_MOUSE      DVLVNNAGIAFKVNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIK--PQGRVVNVSS------------
RDH14_HUMAN     DVLINNAGIFQCPYMKTEDGFEMQ--FGVXXXXXXXXXXXXXXXXKSSAPSRIVVVSSKLYQSYNKSFCY
MKAR_EMENI      NNVGKSHSIPVPFALTPED--ELADIITINCMGTLRVTQLVVPGMTQRKRGLILTMGSGGLVPSPLLATY
LE767_CAEEL     GVLINNVGMSYPDVLHKVDIERLAXXXXXXXXXXXXXSAGILPQMVARKAGVIVNVGSSA--GANQMAVY
DHI1_MESAU      DMLILNHITYTSMNFFRDEIHALRKAMEVNFISYVVMSVAALPMLKQS-NGSIVVVSSIAGKMAHPLASY
CBR1_PIG        DVLVNNAAIAF-----QLDNPTAELTMKTNFMGTRNVCTELLPLIK--PQGRVVNVSS------------
MKAR_KLULA      TVLINNVGHSIPVPFDQTEESELRDIITINNTATLMITQTLLPQLKAS----------------------
H17B6_RAT       WGLVNNAGVFQAAYIEWCRPEDCMSIFQVNLIGLAQVTLSMLFLVKKA-RGRIVNVSSVLGRVALFGGFY
FOLM_ENT38      RAIIHNASAWQAEKPGTPLSETLACMMQIHVHAPYLLNHALEELLRGHAAGDIIHFTDYVVERGSDKIAY
ADH_DROVI       DLLINGAGI--------LDDHQIERTIAVNFTGTVNTTTAIMEKRKGGPGGVIANICSTGFNAIYQVPVY
ADH_DROFL       DLLINGAGI--------LDDHQIERTIAVNFTGTVNTTTAIMEKRKGGPGGVIANICSTGFNAIYQVPVY
ADH2_DROMN      DLLINGAGI--------LDDHQIERTIAVNFTGTVNTTTAIMEKRKGGPGGVIANICSTGFNAIYQVPVY
ADH1_DROMT      DLLINGAGI--------LDDYQIERTIAVNFAGTVNTTTAIMAKRKGGPGGVIANICSTGFNSIYQVPVY
TS2_MAIZE       DVYCNNAGVLGRQSILSFDAAEFDRVLRVNLGAALGMKHAARAMAPRRXXXXXXXXXXXXXXXXXXPHAY
RDHE2_HUMAN     SILINNAGIVTGKKF--LDCPDMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSALSGVNGLADY
MKAR_NEOFI      AVLINNVGKSIPTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQRKRGLVLTMGSGGLLPTPLLATY
DHRS9_RAT       WGLINNAGVGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKA-RGRVINVSSIGGRLAFGGGGY
DHI1_SHEEP      DMLILNHINYTPLRVFSNDIHLLRRSLEVNLLSYVVLSTAALPMLKQTXXXXXXXXXXAGKIACPLAAAY
ADH_DROLA       DLLINGAGI--------LDDHQIERTIAVNFTGTVNTTTAIMEKRKGGPGGVVANICSTGFNAIYQVPVY
YXNA_BACSU      DTWVNNAAVSTFGHAMDVTVEDMKRMFDTNFWGPVYGTRAAVKHYTRGVPGALINVGSLGDRGTVIQSTY
RDHE2_MOUSE     SILINNAGIVTGRNF--LDCPDMEKSFDVNFKAHLWMYKAFLPAMIANNHGHLVCISSSALIGVNGLSDY
RDH1_BOVIN      FGLVNNAGVAGPTPWQTRE--DFQRVLNVNTLGPIGVTXXXXXXXXQA-RGRVINITSVLGRLAANGGGY
MKAR_AJECN      SILVNNVGHSIPTPFVLTPLEELENIIMINCTGTLRITQLVAPGMMQRKRGLILTMASFAMIPTPLLATY
LE767_CAEBR     GVLVNNVGLSYPDVLHKVDIERLAXXXXXXXXXXXXXSAGILPQMVARKAGVIVNVGSSASANQMALWAY
DHI1_RABIT      DMTFAEQFVAKAGKLMNNDIHHVRKEMEVNFLSYVVLTVAALPMLKQS-NGSIVVVSSLAGKIAHPLIAY
ADH_DROMY       DLLINGAGI--------LDDYQIERTIAVNFTGTVNTTTAIMSKRKGGPGGVIANICSTGFNAIYQVPVY
ADH_DROBO       DLLINGAGI--------LDDHQIERTIAVNFTGTVNTTTAIMEKRKGGPGGVVANICSTGFNAIYQVPVY
ADH2_DROMU      DLLINGAGI--------LDDYQIERTIAVNFTGTVNTTTAIMSKRKGGPGGIIANICSTGFNAIYQVPVY
ADH2_DROHY      DLLINGAGI--------LDDYQIERTIAVNFAGTVNTTTAIMAKRKGGPGGVIANICSTGFNAIYQVPVY
ADH2_DROBU      DLLINGAGI--------LDDYQIERTIAVNFTGTVNTTTAIMAKRKGGPGGVIANICSTGFNAIYQVPVY
ADH1_DRONA      DLLINGAGI--------LDDYQIERTIAVNFTGTVNTTTAIMSKRKGGPGGVIANICSTGFNAIYQVPVY
ADH1_DROHY      DLLINGAGI--------LDDYQIERTIAVNFAGTVNTTTAIMAKRKGGPGGVIANICSTGFNAIYQVPVY
S16C6_BOVIN     TILINNAGVVTGREFLKTPDHMVERSFLVNVMSHFWTYKAFLPAMLEANHGHLVCISSFAIVGINELSDY
CBR1_MACFA      DVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIK--PQGRVVNISS------------
ADH2_DROAR      DLLINGAGI--------LDDYQIERTIAVNFTGTVNTTTAIMSKRKGGPGGVIANICSTGFNAIYQVPVY
ADH1_DROMU      DLLINGAGI--------LDDYQIERTIAVNFTGTVNTTTAIMSKRKGGPGGVIANICSTGFNAIYQVPVY
ADH1_DROMN      DLLINGAGI--------LDDHQIERTIAVNFTGTVNTTTAIMEKRKGGPGGVVANICSTGFNAIYQVPVY
MKAR_PHANO      SILINNVGLSIPVPFAETPKQEMTDIIMINCMATLRVTQLLTPGMISRKRGLILTMASGGFFPTPLLATY
DHRSX_HUMAN     HVLINNAGVMMVPQRKTRD--GFEEHFGXXXXXXXXXXXXXXXXXKESHSARVVTVSSATHYVAEPHAAY
ADH2_CERCA      DALINGAGI--------LTDPNVELTMNINLIGLINTTLEGLPLMKQGRGGVIVNIASLGLEPCPPAAVY
MKAR_ASPCL      SILINNVGIPVPFALTPED--EMTDIVTINCLGTLRATQLVIPGMMQRRRGLVLTMGSGGLLPTPLLATY
HSDL2_PONAB     DILVNNASAI--SLTNTLDTPTLDLMMNVNTRGTYLASKACIPYLKKSKVAHILNI--------------
FABG_YEAST      NLLINCAGLTQESLSVRTTASQIQDIMNVNFMSPVTMTNICIPELSQSARPTIVNISS-ILHSGKMKVPY
ADH_DROIM       DLLINGAGILNDHQIE--------LTIAINFTGLVNTTTAIMDKRKGGPGGAIANICSTGFNAIYQVPVY
ADH2_DROWH      DILINGAGI--------LDDYQIERTIAVNFTGTVNTTTAIMSKRKGGPGGIIANICSTGFNAIYQVPVY
ADH1_CERCA      DALINGAGI--------LTDPNVELTMNINLIGLINTTLEALPLMDKNKHGRIVNIASLGLEPCPPAAVY
HSDL2_HUMAN     DILVNNASAI--SLTNTLDTPTLDLMMNVNTRGTYLASKACIPYLKKSKVAHILNI--------------
DHI1B_XENLA     DLVLNHIXXXXXXXXXXXDMDPVVGSTTVNFLSYVQLTSSALSALQESQGSIVVISSMSGRIGAPFTTSY
CBR3_HUMAN      NVLVNNAAVAFPMPFDIKAEMTLKT----NFFATRNMCNELLPIMK--PHGRVVNISS------------
ADH_DRONI       DLLINGAGI--------LDDHQIERTIAVNFTGTVNTTTAIMDKRKGGPGGIVANICSTGFNSIYQVPVY
ADH1_DROMO      DLLINGAGI--------LDDHQIERTIAVNFTGTVNTITAIMSKRKGGPGGVIANVCSTGFNAIYQVPVY
YL426_YEAST     RLIVNNAGVANFTGFNGMERDNLDKIFKINTFAPLQFIQELAPSRHSTRQCYIVNIAS------------
INHA_MYCS2      DGVVHSIGF-MPQSGMGIDAPYEDVSKGIHISAYASLAKAVLPIM--NPGGGIVGMDFDPTRAMPAYNWM
CBR1_PONAB      DVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIK--PQGRVVNVSS------------
CBR1_HUMAN      DVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIK--PQGRVVNVSS------------
ADH_SCAAL       DLLVNGAGI--------LDDHQIERTIAVNFTGTVNTTTAIMEKRKGGPGGVIANICSTGFNSIYQVPVY
ADH2_DROMO      DLLINGAGI--------LDDHQIERTIAVNFTGTVNTITAIMSKRKGGPGGVIANVCSTGFNAIYQVPVY
SPRE_XENLA      QAIINNAGSIGDVSKMFVDFSAPEEVTEFNVSSPLCLTASLLKTFPRRPQRLVVNVSSAALQPYKSWVLY
MKAR_PICGU      TVLVNNVGHSIPVPFLETDEKELRNIITINNTATLKITQVVAPKIKKKTRGLILTMGS---FGGLLPTPY
MKAR_MAGGR      AILINNVGRSHSIPVPFLQTPELQNIVTINCLGTLKTTQVVAPIMAQRKRGLILTMGS---FGGWMPTPF
FOLM_SHIBS      RAILHNASAWMAEKLGAPLADVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
DHRS9_BOVIN     WGLINNAGIGVLAPNDWLTVEDYREPVEVNLFGLISVTLNMLPLVKKA-RGRIINVSSIGGRLAFGGGGY
SPRE_XENTR      QVIINNAGSIGDVSKMFVDFSDPKEVTDFNVSSPLCLTASLLKTFPRRPDLQVVNVSSAALQPFKSWALY
DS7CA_DANRE     DVLICNSSMKVKAPVQNLSLEMDKTIMDVNYFGPITLAKGVLPLMITRRTGQFVLVNS--IQGKLARTCY
DHI2_HUMAN      WGLVNNAGHEVVADAELSPVATFRSCMEVNFFGALELTKXXXXXXXXSPAGDMPYPCLGA---------Y
ADH_DROPL       DLLINGAGI--------LDDNQIERTIAVNFTGTVNTTTAIMDKRKGGPGGVIANICSTGFNSIYQVPVY
ADH_DROMM       DLLINGAGI--------LDDHQIERTIAVNFTGTVNTTTAIMDFWDKGPGGVIANICSTGFNSIYQVPVY
ADH_DROGR       DLLINGAGI--------LDDNQIERTIAVNFTGTVNTTTAILDKRKGGPGGVVANICSTGFNSIYQVPVY
ADH_DRODI       DLLINGAGI--------LDDNQIERTIAVNFTGTVNTTTAIMDKRKGGPGGVIANICSTGFNSIYQVPVY
RD10A_DANRE     DLLINNAGVVSGHHLLECPDELIERTMVVNCHAHFWTTKAFLPKMLEMNHGHIVTVASSGLFSTAGVEDY
MKAR_BOTFB      GILVNNVG-----QSHSIPVPFIQTIITINCMGTLRVTQIVAPGMVQRKRGLILTMGS------------
MKAR_ASPFU      AVLINNVGKSIPTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQRKRGLVLTMGSGGLLPTPLLATY
MKAR_ASPFC      AVLINNVGKSIPTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQRKRGLVLTMGSGGLLPTPLLATY
FABI2_RHIME     DFVVHAIGFSDKNELKGLYADTTRDNFSRTVISCFSFTEIAKRAAEMSEGGTMLTLTGGSMRVMPNYNVM
ADH_DROSU       DVLINGAGI--------LDDHQIERTIAVNYSGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROPS       DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROPI       DLLINGAGI--------LDDHQIERTIAVNFAGTVNTTTAILDKRKGGPGGVVANICSTGFNSIYQVPVY
ADH_DROPB       DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROMD       DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROHA       DLLINGAGI--------LDDNQIERTIAVNFTGLVNTTTAILDKRKGGPVGVVANICSTGFNSIYQVPVY
ADH_DROGU       DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROCR       DLLINGAGI--------LDDHQIERTIAVNFTGTVNTTTAIMEKRKGGPGGVVANICSTGFNSIYQVPVY
ADH_DROAM       DVLINGAGI--------LDDYQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROAD       DLLINGAGI--------LDDNQIERTIAVNFTGTVNTTTAIMDKRKGGPGGVVANICSTGFNSIYQVPVY
STDH3_CAEEL     GMLINNVGMLFPENLHKTGIDVVANVTILNTLPVTLLSAGILPQMVSRKTGIIVNIGS--VAGAAEWSVY
RDH10_RAT       SVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSGLFSTAGVEDY
RDH10_MOUSE     SVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSGLFSTAGVEDY
RDH10_HUMAN     SVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSGLFSTAGVEDY
RDH10_BOVIN     SVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSGLFSTAGVEDY
RD10B_DANRE     DLLINNAGVVSGRHL--LDCPDIERTMMVNCHAHFWTTKAFLPKMLELNHGHIVTVASSGLFTTAGVEDY
DHI1L_DANRE     DYLVLNHIGPSPYQMWDGDVQHTRWLLEVNFLSYLQMAQKALPTLEKS-KGSIVVVSS------------
DHB3_MOUSE      GILVNNVGMXXXXXXXXXXXXESQNLIHCNITSVVKMTQLVLKHMESRRKGLILNISSAALRPWPLYSLY
ADH_DROYA       DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROTE       DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROPE       DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROAF       DLLINGAGI--------LDDNQIERTIAVNFTGTVNTTTAIMDKRKGGPGGVVANICSTGFNSIYQVPVY
MKAR_PICST      TVLINNVGHSIPVPFLETENKELQDIITINVTATLKITQTVAPVIKKKVRGLILTMGS---FGGLLPTPY
MKAR_ASPOR      AILVNNVGKSIPTPFALTSQEEMTDIITINCMGTLRATQLIVPGMMQRKRGLILTMGSGGLLPTPLLATY
DHI1A_XENLA     NKVLNHIGGSASFGFFKGEMDPVVGSIYINFLSYVQLTSAALKALQESQGSIVVMSSMSGRIGAPFTTSY
ADH_DROSI       DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROSE       DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROME       DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROMA       DVLINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROER       DVLINGAGI--------LDDYQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
RDH10_XENTR     --LLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMEMNHGHIVSVASSGLFSTAGVEDY
RD10B_XENLA     --LLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMEMNHGHIVSVASSGLFSTAGVEDY
MKAR_SCLS1      GILVNNVG-----QSHSIPVPFIQTIITINCIGTLRVTQIVAPGMVQRKRGLILTMGS------------
MKAR_PYRTR      SILINNVGLSIPVPFTETPKQEMTDIIMINCMATLRVTQLVTPGMVSRKRGLVLTMASGGFFPTPLLATY
FOLM_ECOSM      RAILHNASAWMAEKPGTSLTDVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
ADH_DROTS       DILINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROOR       DVLINGAGI--------LDDYQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
ADH_DROHE       DLLINGAGI--------LDDTQIERTIAVNFTGTVNTTTAIMDKRKGGPGGVVANICSTGFNSIYQVPVY
SRLD_ECOLI      --------------------------------------------------------------GSKHNSGY
FOLM_SHIFL      RAILHNASAWIAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKVAY
FOLM_SHIF8      RAILHNASAWIAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKVAY
FOLM_SHIDS      RAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
FOLM_ECOLI      RAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
FOLM_ECOLC      RAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
FOLM_ECOHS      RAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
FOLM_ECO57      RAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
FOLM_ECO24      RAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
FABI_HAEIN      ---------------------------DISAYSFVAMAQAARPYLNPNAALLTLSYLG-AERAIPNYNVM
YDFG_DICNO      DVLVNNAGLALGQ---------------------------------------------------------
HSDL2_DANRE     DILVNNAAINLTGTLQT-PMKKADLMLGINLRGTYLTSKLCIPHLLKS----------------------
HSDL1_DANRE     GFLVNSGTLEISQNFLELSESVLWGTINRNIAATTLVTRLALPAMMEKGRGAVVNISSHCFHPIPRKAAF
FOLM_ECOUT      RAILHNASAWMAEKPGAPLTDVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
FOLM_ECOL6      RAILHNASAWMAEKPGAPLTDVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
FOLM_ECOL5      RAILHNASAWMAEKPGAPLTDVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
FOLM_ECOK1      RAILHNASAWMAEKPGAPLTDVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
FABI_SALTY      DGFVHSIGFAPGDQLDAVTREGFKVAHDISSYSFVAMAKACRTMLNPGSALLTLSYLG-AERAIPNYNVM
ADH_DROWI       DVLINGAGI--------LDDHQIERTIAVNFTGLVNTTTAILDKRKGGPGGVICNIGSTGFNAIYQVPVY
ADH_DROPU       DVLINGAGI--------LDDHQIERTIAVNFTGLVNTTTAILDKRKGGPGGVICNIGSTGFNAIYQVPVY
ADH_DROIN       DVLINGAGI--------LDDHQIERTIAVNFTGLVNTTTAILDKRKGGPGGVICNIGSTGFNAIYQVPVY
ADH_DROEQ       DVLINGAGI--------LDDHQIERTIAVNFTGLVNTTTAILDKRKGGPGGVICNIGSTGFNAIYQVPVY
YUXG_BACSU      DIVVNNAGLATSSPFDETSLKEWNLNMNVLGTGYFLVAREAFKQMKQNRGGSMVFVGSKSVYAGKNASAY
YR419_MIMIV     ----------------------------------------------------IINMSSR--NGVNDRPIY
YMP3_STRCO      DLVLLRFGIAGDQRDESRPLDAVR-VAQTNYTXXXXXXXXXXXXXQEQGHGTLVVLSSAAVRARRADFIY
RL6_PSEU5       ------AGVEIKMSGQQLSVKGAKGALELNVHPSVEVIQE---GGELRFAGRNGDQQTRAMAG----TTR
FABI_ANASP      ------------------------TALDISTFSLVQLSGAAKPLMTEG--GSIITLSY--LGGVRAVPNY
DHRS3_MOUSE     TILVNNAAVVHGKSLMDSDDDALLKSQHVNTLGQFWTTKAFLPRMLELQNGHIVCLNSSAIPGAID---Y
AYR1_YEAST      DLLYNNAGQSCTFPALDATDAAVEQCFKVNVFGHINMCRELSEFLIKAKGTIVFTGSLAGVVSFPFGSIY
TSC10_NEUCR     DIVWCVAGMSTPLLTDDGSMAAARRNMDVNYFGSAEMSRAILPENSTGPNGEVFTASMLALFAILGYGPY
RD10A_XENLA     --LLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMELNHGHIVSVASSGLFSTAGVEDY
POR_PLEBO       DALVCNAAVHMPLLKEPMRSP-------------------------------------------------
FOLM_SHISS      RAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHAASDIIHFTDYVVERGSDKIAY
FABI1_RHIME     ----------------------------------------------------------------------
ADH_DROSL       DLLINGAGI--------LDDTQIERTIAVNFTGTVNTTTAIMDFWDKGPGGVIANICSTGFNSIYQVPVY
ADH_DROAN       DILINGAGI--------LDDHQIERTIAVNYTGLVNTTTAILDKRKGGPGGIICNIGSTGFNAIYQVPVY
WWOX_HUMAN      PLVCNAATFALPW---SLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSL
NOR1_ASPPA      DVVVANAAMATNGPASTMPLEHLQAHMMVNMYAPVLLFQATRLMLQQSKQQAKFVLIGAPISTITNMHDY
FOLM_CITK8      --------------------------------------------------------------GSDKHIAY
DHRSX_MOUSE     HLLVNNAGVMLEPRAETEDERHLGVNFXXXXXXXXXXXXXXRASGAEGRGSRVVTVGSATLHGRHAYSPY
WWOX_PONAB      PLVCNAATFALPW---SLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSL
PORB_HORVU      DVVVCNAAVYQPTAKESFTADGFEMSVGVNHLGHFLLARELLEDLKASPSKRLIIVGS--ITGNTNTLAG
FABI_SHIFL      DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM
FABI_ECOLI      DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM
FABI_ECO57      DGFVHSIGFAPGDQLDAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLG-AERAIPNYNVM
Y1430_HAEIN     XXXXXXXXXXXXEPAHKADLQDWYQMIDTNIKGLVTITRLVLPNMVARNYGQIINLSSIATYPYAGSNVY
POR_SYNY3       KALVCNAAVYFP----------------------------------------------------------
MKAR_CRYNE      DVLINNVGASMPVAFHETERSEMSRIIETNVTWTYLVTRSILPSMKGAPKSLVITIGS------------
INHA_MYCTU      DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
INHA_MYCBO      DGVVHSIGF-MPQTGMGIDAPYADVSKGIHISAYASMAKALLPIM--NPGGSIVGMDFDPSRAMPAYNWM
HSDL2_MOUSE     DILVNNASAI--SLTNTLDTPTVDLMMNVNTRGTYLTSKACIPFLKKSKVGHI-----------------
FABI_NEIMB      DGLVHSIGFAPKEALDSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNVM
SPRE_MOUSE      EGLINNAGDVSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPSKTVVNISSLALQPYKGWGLY
POR_DAUCA       DVLVCNAAVYFPTAKE------------------------------------------------------
MKAR_ASHGO      TVLVNNVGVSIPVSFLETTEEELRGIITVNNTATLMVTQTVAP---------------------------
DHI1_CAVPO      DMTFAEEFVALMGGLDMLEIDNVRKSMEVNFHSFVVLSVAAMPMLMQS-QGSIAVVSSVAGKITYPLIAY
DHI1L_CHICK     DLVLNHIGVS-PFQMWGGDVEHTRWLMQVNFFSYVALATAALPTLEKNHGSVVVVSSLTGKIPTPFTTSY
Y2073_MYCBO     ----------------------------------------------------------------------
Y2047_MYCTU     ----------------------------------------------------------------------
POR_MARPA       DVLVCNAAVYFPTDKE------------------------------------------------------
CBR1_RAT        NVLVNNAGIA------------------------------------------------------------
TSC10_CRYNE     DYVYLCAGFSRPKLFVETTKQELKDGLDVYWVSAYTAHEACQMMSKQRRTGKIIFVASFLSYSFAGYSSY
PORB_ARATH      DVLVCNAAVYFPTAKE------------------------------------------------------
MOMAS_ORYSJ     ---------------------------------------------------------------------Y


                         +         .         .         .         .         *         .:210
query           AAAKSALIGVTRTWALELAPLGITANAVAPGPVETELFRLTHPVGSDEEKRILATIPMQRLGKPEEVASL
FABG_VIBHA      AAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETD---MTKALNDDQRAATLSNVPAGRLGDPREIASA
NODG_AZOBR      SAAKAGVIGFTKALAAELATKGVTVNAIAPGYIGTD---MVMAIREDIRQAITDSVPMKRLGRPDEIGGA
FIXR_BRAJA      ATSKAALASLTRELAHDYAPHGIRVNAIAPGEIRTDM------LSPDAEARVVASIPLRRVGTPDEVAKV
FABG_CUPLA      SAAKAGVIGFTKTVAREYASRNINVNAVAPGFISSDM---TSKLGDDINKKILETIPLGRYGQPEEVAGL
FABG_SHIFL      AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETD---MTRALSDDQRAGILAQVPAGRLGGAQEIANA
FABG_ECOLI      AAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETD---MTRALSDDQRAGILAQVPAGRLGGAQEIANA
FABG_PSEAE      AAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTD---MTRELPEAQREALLGQIPLGRLGQAEEIAKV
FABG_BACSU      VAAKAGVIGLTKSSAKELASRNITVNAIAPGFISTD---MTDKLAKDVQDEMLKQIPLARFGEPSDVSSV
FABG_BUCAP      SASKSGLIGFHKSLALEVAQKGITVNIVSPGFIKT---NLTKNLNVFQYKKHLSKIPMKRIGTAEEIANA
FABG_HAEIN      CAAKAGVVGFSKSLAKEVAARGITVNVVAPGFIATD---MTEVLTDEQKAGILSNVPAGRLGEAKDIAKA
FABG_CHLTR      AAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTD---MTKSLNDNLKNEWLKGVPLGRVGMPEEIAKA
FABG_THEMA      AASKAGVIGMTKTWAKELAGRNIRVNAVAPGFIETP---MTEKLPEKARETALSRIPLGRFGKPEEVAQV
FABG1_SYNY3     SAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATD---MTENLNAEP---ILQFIPLARYGQPEEVAGT
BUDC_KLEPN      SSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGRITLGRLSEPEDVAAC
FABG_STAES      VATKAGVIGLTKTAARELASRGITVNAVAPGFIVSD---MTNALSDDLKDQMLEQIPLKRFGEDTDIANT
FABG_STAEQ      VATKAGVIGLTKTAARELASRGITVNAVAPGFIVSD---MTNALSDDLKDQMLEQIPLKRFGEDTDIANT
FABG_RICPR      CASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSD---MTDKLNEKQREAIVQKIPLGTYGIPEDVAYA
FABG_MYCTU      AASKAGVIGMARSIARELSKANVTANVVAPGYIDTD---MTRALDERIQQGALQFIPAKRVGTPAEVAGV
FABG_MYCBO      AASKAGVIGMARSIARELSKANVTANVVAPGYIDTD---MTRALDERIQQGALQFIPAKRVGTPAEVAGV
FABG_MYCS2      AAAKAGLIGMARSISRELAKAGVTANVVAPGYIDTE---MTRALDERIQAGALDFIPAKRVGTAEEVAGA
PHAB_ACISR      SASKAGIIGFTKALAQEGARSNICVNVVAPGYTATP---MVTAMREDVIKSIEAQIPLQRLAAPAEIAAA
NODG_RHIS3      CASKAGMIGFSKSLAQEIATRNITVNCVAPGFIES---AMTDKLNDKQKEAIMAAIPTRRMGTSVEVASA
PHBB_RALEH      STAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKA---IRQDVLDKIVATIPVKRLGLPEEIASI
FABG_STAAW      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSD---MTDALSDELKEQMLTQIPLARFGQDTDIANT
FABG_STAAS      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSD---MTDALSDELKEQMLTQIPLARFGQDTDIANT
FABG_STAAR      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSD---MTDALSDELKEQMLTQIPLARFGQDTDIANT
FABG_STAAN      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSD---MTDALSDELKEQMLTQIPLARFGQDTDIANT
FABG_STAAM      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSD---MTDALSDELKEQMLTQIPLARFGQDTDIANT
FABG_STAAC      VATKAGVIGLTKSAARELASRGITVNAVAPGFIVSD---MTDALSDELKEQMLTQIPLARFGQDTDIANT
FABG_AQUAE      STTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETD---MTAVLSEEIKQKYKEQIPLGRFGSPEEVANV
UCPA_SALTY      ALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAEIARQSNPDDPESVLTAIPLRRLADPLEVGEL
UCPA_SALTI      ALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAEIARQSNPDDPESVLTAIPLRRLADPLEVGEL
FABG_MYCAV      AAAKAGLIGMARSISRELSKAGVTANVVAPGYIDTE---MTRALDERIQAGALEFIPAKRVGTAAEVPGA
YMFI_BACSU      SMAKGAQHSFVKGLAKELAPSGIRVNAVAPGAVDTNMMNQFTPA---EKEEIADEIPIGRLARPQEIADA
FABG2_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRYGQPEDVAGL
FABG_SALTY      XXXXXXLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIASA
FABG_SALTI      XXXXXXLIGFSKSLAREVASRGITVNVVAPGFIETDM---TRALSDDQRAGILAQVPAGRLGGAQEIASA
FABG_CHLMU      AAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTD---MTKGLSDNLKNEWLKGVPLGRVGTPEEIAMA
UCPA_ECOLI      ALTKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPEDPESVLTIPMRRLADPLEVGEL
PHBB_RHIME      SAAKAGDLGLTKALAQEGAAKGITVNAICPGYIGTEMVRAVPEKVLNE--RIIPQIPVGRLGEPEEVARC
FABG_VIBCH      XXXXXXVIGFTKSMAREVASRGVTVNTVAPGFIETDM---TKALNDEQRTATLAQVPAGRLGDPREIASA
FABG3_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRYGQPEDVAGL
FABG1_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRYGQPEDVAGL
YXJF_BACSU      NSAKHGVIGLTKVGALEGAPHGITVNALCPGYVDTQLVRRNVPYDSVLEQVIFPLVPQKRLLSVKEIADY
DER_CHICK       CSTKSALDMLSKVMAMELGPHKIRVNTVNPTVVMTDMGRIN---WSDPQKAMINRIPLGKFAEVDDVVNS
UCPA_ECO57      ALTKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPEDPESVLTIPLRRLADPLEVGEL
ACT3_STRCO      SASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDEEDRITARVPIGRYVQPSEVAEM
DCXR_BOVIN      CSTKGALDTLTKVMAVELGPHKIRVNAVNPTVVMTPMGQAAWS-DPQKAKAMLDRIPLGRFAEVENVVDT
TRN1_DATST      SASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETANPHQKEEIDNFIVKTPMGRAGKPQEVSAL
FABG_BUCBP      SAAKLGLVGFHKSLALELAPKGITVNMIAPGLIKT---GMTNNLSQKQLSKYLSKIPMKRLGTIKEISKI
TRNH_DATST      AASKGAINQVTKSLACEWAKDSIRVNAVAPWIINTPIIEAACQVPSQKKESLIGRAPMKRAGEPSEVSSL
DHRS4_RABIT     NVSKTALVGLTKNLALELAAQNIRVNCLAPGLIKTSFSKALWEDKAQEEN-IIQKLRIRRLGKPEECAGI
BDHA_RHIME      VAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTPLVEKQIPRGITEEQVILKGQPTKKFITVEQVASL
YOHF_ECOLI      TAAKHALGGLTKAMALELVRHKILVNAVAPGAIATPMNGMD---DSDVKPDAEPSIPLRRFGATHEIASL
PHAB_PARDE      SAAKAGDLGFTKALAQEGARAGITVNAICPGYIGTEMVRAIDEKVLNE--GIIPQIPVAAWAEPEEIARC
DHKR_STRCM      SASKHGVVGFTKALGNELAPTGITVNAVCPGYVETPMVRQGYAAAYDTEEAILAKIPLGRYSTPEEVAGL
LVR_LEIAQ       AAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENPRFIQVNPSKRYGEAPEIAAV
KDUD_BACSU      TASKHAVAGLTKSFANEWAASGIQVNAIAPGYIST---ANTKPIRDDEKRNILKRIPAGRWGQADDIGGT
FABG5_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRYGQPEYVAGL
YLX6_SCHPO      SAAKAGLENLTKALAVRYGPLGIRVNVCAPGPAWDERFK-KHPDVGDRMKR---WYPVGRLGTPEDVARA
Y2049_STAEQ     GATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPM---------------------------------
Y2036_STAES     GATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPM---------------------------------
BUDC_KLETE      SSSKFAVRGLTQTAARDLAPLGITVNGFCPGIVKTPMW--------------------------------
TRN2_DATST      GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTDPEQKENLNKLIDRCALRRMGEPKELAAM
NODG_RHIME      CASKAGMIGFSKSLAQEIATRNITVNCVAPGFIESAM---TDKLNHKQKEKIMVAIPIHRMGTGTEVASA
GNO_GLUOX       TATKGAVKNLTKGMATDWGRHGLQINGLAPGYFATE---MTERLVADEEDWLCKRTPAGRWGQVEELVGA
FABG4_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM---TAKLGEDMEKKILGTIPLGRYGQPEDVAGL
DHRS4_BOVIN     NVSKTALLGLTKNLALELAESNVRVNCLAPGLIRTSFSRVLWEDPARQES-IKATFQIKRIGKPEECAGI
KDUD_DICD3      TASKKRVMGITRIVANEWAKHNINVNAIAPGYMATNNTQHVR-ADQDRSKEILDRIPAGRWGLPQDLQGP
TRN2_HYONI      GATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSMVEMTDPEQKENLDKLIDRCALRRMGEPKELAAV
FABG_BUCAI      SASKSGLIGFHKSLALEVASKGITVNIVSPGLIKT---NFTEKLNSIQYQKYLSNIPMKRFGQKEEVADA
HCDR_XANP2      TTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMWRLDQPELRDQ---VLARIPQKEIGTAAQVADA
DCXR_CAEEL      CASKAALDMVTRCLANELGSQNIRVNSVNPTVVMTDMGR-DNWSDPDKKKKMLDRMPIKRFAEVDEVVNA
YGFF_ECOLI      AASKGAIDTLTTGLSLEVAAQGIRVNCVRPGFIYTEM----HASGGEPGRRVKSNIPMQRGGQAEEVAQA
PHBB_CHRVI      SAAKAGMHGFTMALAQEGASKGVTVNTISPGYVET---AMTLAMNDDVRNSIISGIPMRRMAQPNEIAAA
YHXC_BACSU      SATKGAIVTFTRSLSQSLVQQGIRVNAVAPGPIWTPL--IPASFAAKDVEVFGSDVPMERPGQPVEVAPS
PHBB_ZOORA      SAAKAGDLGFTKALAQEGAAKGITVNAICPGYIGTEMVRAIPEKVLNE--RIIPQIPVGRLGEPDEIARI
CPNA_COMTE      EASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQLDAP---QSARALLGPTLLGRAAQPMEVSQA
CPNA_COMS9      EASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQLDAP---QSARALLGPTLLGRAAQPMEVSQA
FABG_RICBR      CASKAGLIGMTKSLAYEVATRGITVNAVAPGFIKSD---MTDKLNDEQKEAITRKIPKGTYGMPEDIANA
FABG2_SYNY3     SATKAGVIGMMKSLAREGARYGVRANAVAPGFIDTE---MTLAIREDIREKITKEIPFRRFGKPEEIAWA
FABG_RICTY      CASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSD---MTDKLNEKQREAIVQKIPLGTYGIPEDVAYA
FABG_CHLPN      AAAKAGIIAFTKSLAKEVAARNIRVNCLAPGFIETD---MTSVLNDNLKAEWLKSIPLGRAGTPEDVARV
RHLG_PSEAE      APSKAALHQLSRMLAKELVGEHINVNVIAPGRFPS---RMTRHIANDPQEADSASIPMGRWGRPEEMAAL
DHB8_HUMAN      AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATP---MTQKVPQKVVDKITEMIPMGHLGDPEDVADV
DCXR_RAT        CSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTPMGRANWS-DPHKAKVMLDRIPLGKFAEVENVVDT
DHR11_HUMAN     SATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFKLH---DKDPEKAAATYEQMKCLKPEDVAEA
DHB8_CANFA      AASKAGVIGLTQTAARELGRHGIRCNSVLPGFITTP---MTQKVPQKVLDKVIGMIPMGHLGDPEDVADA
CMTB_PSEPU      NAAKGGMHGLTTGLAREFARQGVTVNTVAPCAVNTEVWVRIKNANPELAQRFLDVIPMGRVGEIEEVASM
CMTB_PSEP1      NAAKGGMHGLTTGLAREFARQGVTVNTVAPCAVNTEVWVRIKNANPELAQRFLDVIPMGRVGEIEEVASM
DHR11_BOVIN     SATKYAVTALTEGLRQELARSHIRATCISPGVVETQFAFKLH---DKDPEKAAATYEHMKCLKPEDVAEA
BUTA_STAAW      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAEQFTSQIALGRVSQPEDVSNV
BUTA_STAAS      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAEQFTSQIALGRVSQPEDVSNV
BUTA_STAAR      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAEQFTSQIALGRVSQPEDVSNV
BUTA_STAAN      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAEQFTSQIALGRVSQPEDVSNV
BUTA_STAAM      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAEQFTSQIALGRVSQPEDVSNV
BUTA_STAAC      CSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAEQFTSQIALGRVSQPEDVSNV
FADH_BACSU      XXXXXXXLSLTRTLAVEWSKYGIRTNAIAPGPIERKLFESEKAMA-----RTMNSVPLGRLGTPEEIAAL
DHR11_CHICK     SATKYAVTALTEGLRQELAKTHIRATCISPGLVETGFAFKLH---DNDPERAAATYESIRCLKAEDMANA
BUTA_STAEQ      SATKHSVRSFTQTAAKELADKGITVNAYCPGVAKTEMWRIDEEMVGDAFEAFSSEIKLGRYQEPSDVANL
HSD_MYCTU       TATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPM--------TDWVPEDIFQTALGRAAEPVEVSNL
HSD_MYCBO       TATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPM--------TDWVPEDIFQTALGRAAEPVEVSNL
BAIA1_EUBSP     PTSKAGVIGLTHGLGREIIRKNIRVVGVAPGVVDTDMTKGLPPEILED---YLKTLPMKRMLKPEEIANV
DCXR_MOUSE      CSTKGALDMLTKMMALELGPHKIRVNAVNPTVVMTPMGR-TNWSDPHKAKAMLDRIPLGKFAEVENVVDT
CBR2_PIG        SSTKGAMTMLTKSMAMELGPHKIRVNSVNPTVVLTAMGR---SVTSDPERKLKERHPMRKFAEVEDVVNS
Y4VI_RHISN      AASKAGLISITKSLACRWASRGIRVTAVAPGHVRTPMVAELERAGKLDVSAIRRRVPLGRIARPDEIARA
BACC2_BACSU     NASKGGVLQLTRSMAVDYAKHNIRVNCVCPGIIDTPLNELENNEGTLEEKEKAKVNPLLRLGKPEEIANV
YJDA_BACSU      AATKGAISAFTRSLSQELAPLGITVNAVNPGPTDSTWM-------TDEIRNFLSKFPMGRIGTPDDAARM
YVRD_BACSU      SMTKTALISLSRGMAEMTKGTNVTVNSVLPGPTWTEMEGAAQAAGQDTDTFIKPTSLIQRYATAEEVANT
Y1385_MYCBO     SAAKAGIVGMTKAAAKELAHLGIRVNAIAPGLIRS---AMTEAMPQRIWDQKLAEVPMGRAGEPSEVASV
Y1350_MYCTU     SAAKAGIVGMTKAAAKELAHLGIRVNAIAPGLIRS---AMTEAMPQRIWDQKLAEVPMGRAGEPSEVASV
FABG_ARATH      AAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDM---TAELGEDMEKKILGTIPLGRYGKAEEVAGL
YHDF_BACSU      SSTKGAIVSFTRSMAKSLADKGIRVNAVAPGPIWTPLIPATFP--EEKVKQHGLDTPMGRPGQPVEHAGA
Y182_METEA      SGTKGALNAISGVLANELAPRKIRVNVVSPGYVVTEGTHTAGIAGSEMEAGLVAQTPLGRSGQPDDIAGV
GRDH1_ARATH     TATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLI----PASFNEEKNFGSEVPMKRAGQPIEVAPS
DHRS4_PIG       NVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNFSQVLW-MDKARKEYMKESLRIRRLGNPEDCAGI
FABG_ACTAC      XXXXXXXXXXXXXLAVELAKRKITVNCVAPGLIDTDILDENVPI--DE---ILKMIPAGRMGDPEEVAHA
DCXR_MESAU      CSTKGALDMLTKMMALELGPHKIRVNAVNPTVVMTSMGR-TNWSDPHKAKVMLDRIPLGKFAEVENVVDA
BACC_BACSU      NASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNELENNEGTLEEKEKAKVNPLLRLGKPEEIANV
BDH2_MOUSE      SATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARDNPKEALKTFLNRQKTGRAEEVALL
YKVO_BACSU      GASKAALRALVRNWILDLKGTEIRVNVVSPGGILTPAY---DELFGDALEEVLETVPAGKVGTPEEVANA
BDHA_RALEH      VAAKHGIVGFTKVTALETAQTGVTANAICPGWVLTPLVQKQIPVEQAKRELVLEKQPSGQFVTPDELGAL
DHR11_MOUSE     SATKYAVTALTEGLRQELAQTHIRATCISPGLVETQFAFKLHDKDPGE---AAATYEHIKCLRPEDVAEA
YGCW_ECOLI      SATKHALAGFTKAYCDELGQYNIQVNGIAPGYYATDITLATRS-NPETNQRVLDHIPANRWGDTQDLMGA
SORD_KLEPN      AATKAALNSFTRSWSKELGKYGIRVVGVAPGPEYEEALAWTRNITVEQEGYTKNAIPIGRAGKLSEVADF
Y3106_PSEAE     AASKXXXXXXXXXXXXXXXP-DIRVNALSPGWIDTRAEREAAPLTEDHDQHLVG-----RVGTVEDVASL
KDUD_ECOLI      TASKSGVMGVTRLMANEWAKHNINVNAIAPGYMAT---NNTQQLRADEQREILDRIPAGRWGLPSDLMGP
DCXR_CAVPO      CSTKGALYMLTKMMALELGPHKIRVNAVNPTVVMTPMGR-TNWSDPHKAKAMLDRIPLGKFAEVENVVDT
CBR2_MOUSE      SSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGK---KVSADPERKLKERHPLRKFAEVEDVVNS
Y2778_STAA8     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNPTDRKKEPQDIAEAVLYALTQPKHV---
Y2488_STAAC     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNPTDRKKEPQDIAEAVLYALTQPKHV---
Y2422_STAA3     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNPTDRKKEPQDIAEAVLYALTQPKHV---
FABG_RICFE      CASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSD---MTDKLNEKQREAIVQKIPLGTYGMPEDVANA
Y2403_STAAW     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNP--SDRKKL-----------DPQDIAEA
Y2370_STAAS     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNP--SDRKKL-----------DPQDIAEA
YQJQ_BACSU      SATKHAVLGYSNALRMELSGTGIYVTTVNPGPIQTDFFSIADK-GGDYAKNV------------------
Y325_THEMA      SVSKAALLGLTRSLAVDYVDYGIRVNAVCPGTTQSELMARVKASPNPEEKKMTSRIPMKRLGKXXXXXXX
Y2478_STAAM     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNP--SDRKKL-----------DPQDIAEA
Y2266_STAAN     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITAAYNP--SDRKKL-----------DPQDIAEA
RDH8_HUMAN      AASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTE----------------------------------
PECR_PONAB      GAARAGVYNLTKSLALEWACSGVRINCVAPGVIYSQTAVENYSYGQSFFEESFQKIPAKRIGVPEEVSSV
DHG2_BACME      AASKGGMKLMTETLALEYAPKGIRVNNIGPGAIDTP---INAEKFADPEQRVESMIPMGYIGKPEEIASV
NOG4_RHIME      CASKAGMIGFSKSWRRR-STRNITVNCVAPGFIESAM---TDKLNHKQKEKIMVAIPIHRMGTGTEVASA
IDNO_ECOLI      AASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTE---MTKALVEDETAWLCKRTPAARWGDPQELIGA
IDNO_ECOL6      AASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTE---MTKALVEDETAWLCKRTPAARWGDPQELIGA
ENTA_ECOLI      GXXXXXXXXXXXXVGLELAGSGVRCNVVSPGSTDTDMQRTLWVSDDAEEQRIRGGIPLGKIARPQEIANT
DCXR_HUMAN      CSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWS-DPHKAKTMLNRIPLGKFAEVEHVVNA
TRNH1_ARATH     XXTKGALNQLARNLACEWASDGIRANAVAPAVIATPL---AEAVYDDEFKKVISRKPLGRFGEPEEVSSL
FOX2_CANTR      ASAKSALLGFAETLAKEGAKYNIKANAIAP------LAR------SRMTESILPPPMLEKLG-PEKVAPL
FABG_RICCN      CASKAGLIGMTKSLSYEVATRGITVNTVAPGFIKSD---MTDKLNEKQREAIVQKIPLGTYGMPEDVAHA
CBR4_XENTR      GASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIHTDM-----TLGLEEDS-LTKMVPLGRFGDPEEVAQS
SPS19_YEAST     GAAKAGIDALAKNLAVELGPLGIRSNCIAPGAIDTE--GLKRLAGKKYKEKALAKIPLQRLGSTRDIAES
HDHA_ECOLI      ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTD--ALKSVITPEIEQKMLQHTPIRRLGQPQDIANA
HDHA_ECO57      ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTD--ALKSVITPEIEQKMLQHTPIRRLGQPQDIANA
FOX2_NEUCR      SAAKCAILGFSRAIALEGAKYNIYVNTIAPN------------AGTAMTKTILPEELVQAF-KPDYVAPL
BAIA2_EUBSP     PASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMTNGNPP---EIMEGYLKALPMKRMLEPEEIANV
Y2567_STAAR     SATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAITATYNPTDRKKEPQDIAEAVLYALTQPKHV---
PECR_HUMAN      GAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSGQSFFEGSFQKIPAKRIGVPEEVSSV
GRDH_DAUCA      TATKGAIVAFTRGLSLQLISKGIRVNGVAPGPVWTPLI----PSSFDEEKQFGSEVPMKRAGQPYEIATA
HCDS_XANP2      CAAKGAVVNLTRQMAADYSGRGIRVNVVCPGTVATDMGRQLLGTDCDPEARRLAKYPMGRFGTPEDIAEA
Y484_MYCTU      TAAKHAQGALHRTLRGELLGKPVRLTEIAPGAVETE----------------------------------
HDHA_CLOSO      GVSKSGVNNITKQIAIQYAKYGIRCNAVLPGLIATDAAMNSMP--DEFRKSFLSHVPLNRIGNPEDIASV
BUTA_STAES      SATKHSVRSFTQTAAKELADKGITVNAYCPGVAKTEMWRIDEEMVGDAFEAFSSEIKLGRYQEPSDVANL
YJGI_ECOLI      XXXXXXLQGMARGLARDFGPRGITINVVQPGPIDTD----ANPANGPMRDMLHSLMAIKRHGQPEEVAGM
LINC_PSEPA      VGAKHAVVGLTRVAAADYGKHGIRVNALVPGAVRTPMLQRAMDNDAGLEPYLNSIHPIGRFSEPHEQAQA
VIBA_VIBCH      GASKAALHMLVKCIGMELAPYGIRCNLVSPGSTRTEQYGEAQVIAGDAAQFRLG-IPLNKIAEPADIAQA
VDLC_HELPY      SASKHALEAYSDALRLELKPFNVQVCLIEPGPVKS-----------------------------------
YVAG_BACSU      SATKTMQLSISRSLAELATGTNVTVNTVMPGSTLTELYPGENLTVQEAEARFMPTSIIQRLIRPEEIAHF
YUSZ_BACSU      VSSKHALEGFSESLRIELLPFGIETALIEPGSYKTSIWSTSMSVPADDSKKILSYVQKEESGDPQEVADL
BACC_BACAM      NASKG---GVLQTDAFYIAKHNIRVNCVCPGIIDTPLNELENNEGTLEEKEKAKVNPLLRLGKPEEIANV
DHRS4_RAT       NVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTHFSSVLWKEKAREE-MIKETMQIRRLGKPEDCVGI
DECR2_HUMAN     GSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISTELRRLGGPQASLSTK--VTASPLQRLGNKTEIAHS
DECR2_DANRE     GSAKAANDAMTRHLAVEWGPSGVRVNTVAPGPISTEGYRRLG--GSHAETAAFHSIPLQRAGNKTEMAHA
FABG6_BRANA     AAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASEM---TAKLGEDMEKKILGTIPLGRYGQPEDVAGL
DHRS4_MOUSE     NVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTRFSSVLWEEKARED-FIKEAMQIRRLGKPEDCAGI
BDH2_HUMAN      STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTSLQERIQARGNPEEARFLKRQKTGRFATAEEIAML
HSD_STREX       GASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTP---MTAETGIRQGEGNYPNTPMGRVGEPGEIAGA
GRDH2_ARATH     TATKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLI----PASFSEEKQFGSETPMKRAAQPVEVAPS
DECR2_PONAB     GSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISTELRRLGGPQASLSTK--VTASPLQRLGNKTEIAHS
XYLL_PSEPU      GAAKGGVNALTACLAFETAERGIRVNATAPGGTEARHGGFRNSAEPSEQEKVLDSSLMKRYGSIDEQVEA
CBR4_DANRE      SASKAGLEGFTRSLAKEVASRNIRVNLVAPGLIHTDM-----TAGLAEEAAV-RTIPLGRFGEPAEVAQA
SDH_RHIRD       GGTKAFLRQFSLGLRSDLHGKGVRVTSIEPGMCETE-FTLVRTGGNQE----------------------
GS39_BACSU      TATKGAINAFTRTMAQALVKDGIRVNAVAPGPIWTPLIPATFP--EETVAQFGQDTPMGRPGQPVEHVGC
PECR_RAT        GAARAGVYNLTKTMALTWASSGVRINCVAPGTIYSQTAVDNYELGQTMFEMAFENIPAKRVGLPEEISPL
VDLC_HELPJ      SASKHALEAYSDALRLELKPFNVQVCLIEPGPVKS-----------------------------------
ACR1_ACIBI      VASKAALDAFSRCLSAEVLKHKISITSIYMPLVRTPMIAPT---------KIYKYVPTL---SPEEAADL
ACR1_ACIAD      VASKAALDAFSRCLSAEVLKHKISITSIYMPLVRTPMIAPT---------KIYKYVPTL---SPEEAADL
YTKK_BACSU      GAAKVGLASLTKTIAIEEAEFGITANMVCPGDIVGDM-----KEASIEEARMKEKTPIGRSGTGEDIARI
YM71_YEAST      CASKFAVGAFTDSLRKELINTKIRVILIAPGLVETE-FSLVRYRGNEEQAKNVDTTPLM----ADDVADL
YAY8_SCHPO      TSTKGAITAFTRGLSNQYAQHGIRVNAVAPGPIYTPLVSSTFP---KEKIELSDQVPLGRMGQPVEVASC
MAS12_AGRRH     NMTKHALGGLTKTTQHVGWDRGVRAIDICPGFVATEMSAWTDLISSND----------------------
BDH2_BOVIN      STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARPNPEEALSDFLKRQKTGRAEEVALL
YBBO_ECOLI      AASKYALEAWSDALRMELRHSGIKVSLIEPGPIRTRFTDNVNQTQSDK----------------------
YBBO_ECOL6      AASKYALEAWSDALRMELRHSGIKVSLIEPGPIRTRFTDNVNQTQSDK----------------------
Y4LA_RHISN      AVSKAAMNMLSASLATQYGHAQIRCNAVAPGLIMTE--RLLAKLDKCMQRHLSRHQLLPRVGHPEDVAAL
Y0419_STAS1     SASKAAVHSITQGLEKELAKTGVRVTSISPGMVDTPL---------------------------------
MAS1_AGRT9      NMTKHGLAGLTKTTQHVGWDHGVRAVDICPGFVATNMSSWTNLIGPDE------------MIQPEDIAKL
GRDH_ORYSJ      TATKGAIVAFTRALALQLAEEGIRVNGVAPGPIWTPLI----PASFAEEKQFGSQVPMGRAGQPSEVAPS
DHRS4_PONAB     NVSXXXXXXXXXXXXIELAPRNIRVNCLAPGLIKTSFSRMLW-MDKEKEESMKETLRIRRLGEPEDCAGI
DHRS4_HUMAN     NVSXXXXXXXXXXXXIELAPRNIRVNCLAPGLIKTSFSRMLW-MDKEKEESMKETLRIRRLGEPEDCAGI
YXBG_BACSU      NAAKGGITNLTKAMAIDYARNGIRVNSISPGTIETPLITKEQEMGEQFREANKWITPLGRLGQPKEMATV
FABG_SCHPO      AASKAGLESFTKVLAAEVASKGIRVNAISPGYVDTPM--LSSQIRAIAEKK----VPIGRLASTDEIVDA
DECR_RAT        SSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKTKAFSRLDPTGKFE-KDMIERIPCGRLGTVEELANL
DECR_MOUSE      SSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKTKAFSRLDPTGRFE-KEMIDRIPCGRLGTMEELANL
YGHA_ECOLI      AATKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTAL-QISGGQTQDKIPQFGQQTPMKRAGQPAELAPV
YGHA_ECO57      AATKAAILNYSRGLAKQVAEKGIRVNIVAPGPIWTAL-QISGGQTQDKIPQFGQQTPMKRAGQPAELAPV
DHK1_STRVN      SASKHGVVGLTKALGLELARTGITVNAVCPGFVETPMAERVHYAGSEEEDRITNRVPLGRYVETREVAAM
DHGB_BACME      AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTP---INAEKFADPEQRVESMIPMGYIGEPEEIAA-
DHBA_BACSU      XXXXXXXVMFTKCLGLELAEYNIRCNIVSPGSTETDMWSLWADENGAEQKGSLETIPLKKLAKPSDIADA
Y2146_BRAJA     AASKAAMNMLSSSLATQYGHAQIRCNAVAPGLIMTE--RLLAKLDACMQTHLRRHQLLPRVGRPEDVAAL
DECR2_RAT       GAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISTELRRLGGPKASSKFKYLSSPIP--RLGTKTEIAHS
VER1_ASPPA      SGSKGAIDTFVRCMAIDCGDKKITVNAVAPGAIKTDMFREYIPNGTDEQVDECAASPLNRVGLPVDVARV
CBR4_XENLA      GASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIRTDM------TSDLKEDSLNKMIPLGRFGEPEEVAQS
SDR1_PICAB      TASKAAVEMMTRILAQELRGTQITANCVAPGPVATDMF-----FAGKSEAAVEAGVPFERLGKVEDVAPL
DHSO_RHOSH      CATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKFADYERQVGAAVPFGRMGRAEDLTGM
DHRS7_DROME     SASKHAMQAFADSLRAEVANKNINVSCVSPGYIRTQL---------------------------------
DHG2_BACSU      STSKGGIKMMTETLALNYADKGIRVNAIAPGTIATESNVDTKK--EESRQKQLKKIPMKAFGKP------
FABL_BACSU      GVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALK-HFPNREDLLEDARQNTPAGRMVEIKDMVDT
SDH_AGRT5       GGTKAFLRQFSLGLRSDLHGKGVRVTSIEPGMCETE-FTLVRTGGNQE----------------------
PECR_CAVPO      GAARGGVYNLTKSLALGWARSGIRINCVAPGTVYSQTAMDNY---GDMGKTLFADIPAKRLGVPEEVSSL
DHB8_RAT        ASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATP---MTQKMPEKVKDKVTAMIPLGHMGDPEDVADV
DHGA_BACME      AASKGGMKLMTETLALEYAPKGIRVNNIGPGPINAEKF-------ADPEQRVESMIPMGYIGKPEEV---
BPHB_PSES1      TGAKHAVVGMVRELAYELAP-HVRVNGVAPGGMSTDL---------------------------------
BEND_ACIAD      SASKGGVNALTASLAFEHAQHGIRVNAVATGGTKAKIPRNAQPLSKSEQVWMQQVVDLGRYGSIDEQVNA
SOU1_SCHPO      HATKAAVKHLARALAVEWAPFA-RVNSVSPGYIDTDL---TLYADENLRKKWKEYTPQARIGLPDELPGA
RDH8_BOVIN      AASKFAMEGFFESLAVQLLQFNIFISLVEPGPVVTE----------------------------------
DHG3_BACME      AASKGGMKQMTETLALEYAPKGIRVNNIGPGAMNTPIEKFADPV---QRADVESMIPMGYIGKPEEV---
DHB2_RAT        ASTKAAISMFSAVIRQELAKWGVKVVTIHPGGFQTNI------VGSQDEKEIL-----------------
BPHB_BURXL      TAAKHAIVGLVRELAFELAPY-VRVNGVGSGGINSD---LRGPSSLGMGSKAISTVPL------------
YQ53_SCHPO      NASKFAVEGLSQTIMRELDPWNIAITIVQPGGMQTE----------------------------------
DHG_BACSU       AASKGGIKLMTETLALEYAPKGIRVNNIGPGAINTPI-NAEKFADPKQKADVESMIPMGYIGEPEEIAAV
DHB2_HUMAN      GSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAG-TSDKWEKLEKDILDHLPAE-----------
PECR_MOUSE      GAAREGVYNLTKSMALAWASSGVRINCVAPGTIYSQTAVDNYEMGQTLFEMAFDSIPAKRLGVPEEISPL
HCD2_RAT        SASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLL-TTLP---DKVRNFLASVPFSRLGDPAEYAHL
DHG4_BACME      AASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPIEKFADPV---QRADVESMIPMGYIGKPEEV---
DHB8_MOUSE      ASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATP---MTQKMPEKVKDKVTAMIPLGHMGDPEDVADV
DHB2_MOUSE      AATKAALTMFSTIIRQELDKWGVKVVTIKPGGFKTNI---------------------------------
YWFH_BACSU      SMMNAALINASKNISIQLAPHNITVNCLNPGFIATDVMKKNSISKQKAEEQIASGIPMKRVG--------
T4HR_MAGGR      SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYREYIPNGENDEYAASAWSPLHRVGLPIDIARV
STCU_EMENI      SGSKGAIDTFVRCLAIDCGDKKITVNAVAPGAIKTDMFREYIPNGTDEQVDECAASPLNRVGLPVDVARV
BPHB_PSEPU      TAAKHAVVGLVRELAFELAPY-VRVNGVGPGGINSDL---------------------------------
NAHB_PSEU8      IASKHAVLGMVKALAYELAP-EVRVNAVSPGGTVTSL---------------------------------
NAHB_PSEPU      IASKHAVLGMVKALAYELAP-EVRVNAVSPGGTVTSL---------------------------------
DHB8_CALJA      AASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATP---MTQKVPQKVMNKITGMIPMGHLGDPEDVADV
CBR4_BOVIN      SASKGGLVGFSRALAKEVAKKKIRVNVVAPGFIHTDMTK------DLNEELLKKNIPLGRFGDALDVAQA
Y4MP_RHISN      SXXXXXXXXXXXXXXREFGPDSIRVNCVTPGLIQTDI--TGDKLSAEMRADIVKGIPLSRLGDARDVANI
Y1627_STAS1     CGTKYAVRAITEGLRQEEAIVGIRTTILSPGAVSTE---LTDHISDKDMKQDIDELYKNAI-KPDAIARA
DHB8_PIG        AASKAGVIGLTQAVARELGRYRIRCNSVLPGFIKTP---MAQKVPQKVLDKVVGMIPMGHLGGPPDVADV
THR1_GLOLA      SGSKGTIETFVRCMAIDFGDKKITVNAVAPGGIKTDMYRIPNGGELDDEEFAAGWSPMHRVGLPIDIARV
DHB1_PANTR      CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAF--MEKVLGSPEE---------------------
DHB1_RAT        CASKFALEGLCESLAILLPLFGVHVSLIECGAVHT-----------------------------------
YXEK_CAEEL      AVSKAGVENMTKSLASEWAKHGLRFNAIAPGPIPTEFGRLFAGELKDSGDAMKASVPVGRLGHPEEIANL
Y4EK_RHISN      GATKAAVSLFSSALRCDLIGLPIRVTELFPGRVETNLYR-------------------------------
MOAE_KLEAE      VTAKHALIGLMRSVARDYGPQGVRANAICPGWVTTEMHPLMQAEGTEAYQRVCRDVPLRRPASPEEIAQA
KDSR_BOVIN      SSSKFALRGLAEALQMEVKPYNVYVTVAYPPDTDTPGFAKENQTKPLETRLISET---TSVCKPEQVAKQ
DHRS7_HUMAN     CASKHALRGFFNGLRTELATYGIIVSNICPGPVQSNI---------------------------------
DHB14_HUMAN     VATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIMLAQPLGRMGQPAEVGAA
DHB1_MOUSE      CASKFALEGLCESLAILLPLFGVHVSLIECGAVHTAFY--------------------------------
DHB1_HUMAN      CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAF--MEKVLGSPEE---------------------
LIMC_RHOER      SAAKHGVVGLMRSLALELAPHRVRVNSLHPTQVNTPMIQLENPTREDFEIASTTTLPIPWV-ESVDVSNA
FOX2_YEAST      SAAKMGLVGLAETLAKEGAKYNINVNSIAP------LAR------SRMTENVLPPHILKQLG-PEKIVPL
YHXD_BACSU      AATKNAIIGFTVGLGKQLASKGIRVNSVAPGPIWTPL----QISGGQPTENITPPAPLNRAGQPVELADV
Y0585_STAHJ     SATKSAVLMIFNGLEKELAKTGIKTTSILPGMVDTPM---------------------------------
KDSR_HUMAN      SASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISET---TSVCKPEQVAKQ
DHRS7_MOUSE     CASKHALRGFFNALHSELGQYGITFCNVYPGPVQSDIVK-------------------------------
DHK2_STRVN      AVSNGGHRAQTRLLANTVGP-AVRVNAVAPGLIETP-WTQNSDFFAPIAEHVRQTTPLRRTGRPEDVAEA
YIV6_YEAST      GCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQM---------------------------------
LINX_PSEPA      CATKAAVRIMSKAAALEFVDRGVRVNTIVPGGMNTPI---TANVPPDVLKQQTSQIPMGKLGDPIDIANG
BDH_BOVIN       CITKFGVEAFSDCLRYEMHPLGVKVSVVEPGNAATSLYGGTERIQAIANKEELPEVVRQDYGRDEKVARM
DHB4_HUMAN      SAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGS----RMTQTVMPEDLVEAL---------KPEYVAPL
BPHB_COMTE      TATKHAVVGLVRQMAFELAP-HVRVNGVAPGGMNTDL---------------------------------
DHB12_XENTR     SATKAFVDFFSRGLQAEYRSKGVTVQSVLPFYVATKLAKIRKP---------------------------
DH12B_XENLA     SATKAFVDFFSRGLHAEYRSKGVTVQSVLPFFVATKLAKIRKP---------------------------
DH12A_XENLA     SATKAFVDFFSRGLHAEYRNKGINVQSVLPFYVATKLAKIRKP---------------------------
DHB12_ANAPL     SASKAFVDYFSRGLHAEYKSKGIIVQSVMPYYVATKMSKISKP---------------------------
MTDH_AGABI      NSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTD---QTAHMDKKIRDHQASNIPLNRFAQPEEMTGQ
UXUB_BACSU      SAAKASINNFTMWMAVHFAETGLRVNAIAPGFFLTDLLINQDGTFTSRSHKIIAGTPMKRFGKPEDLLGT
HCD2_DROME      SASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNTPMLAAL----PEKVRTFLASIPFQRLGEPSEYAHL
DHB4_MOUSE      SAAKLGILGLCNTLAIEGRKNNIHCNTIAPN------------AGSRMTETVLPEDLVEAL-KPEYVAPL
KDSR_MOUSE      SSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKTKPLETRLISET---TAICKPEQVAKQ
HCD2_HUMAN      SASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPL------LTSLPEKFLASQVPFSRLGDPAEYAHL
DHB4_RAT        SAAKLGLLGLANTLVIEGRKNNIHCNTIAPNAGS----RMTETVMPEDLVEAL---------KPEYVAPL
CBR4_MOUSE      SATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDMTRHL------KEEHFKKNIPLGRFGETLEVAHA
YQC8_SCHPO      CASKAAVRQLCKALAVEWAEFA-RINSVSPGYFATDM------PGYEFLKQWEPYVPFKRLGLTPELRGT
YOXD_BACSU      SASKFAVLGLTESLMQEVRKHNIRVSALTPSTVASDM---------------------------------
YCIK_ECOLI      AASKFATEGMMQVLADEYQQ-RLRVNCINPGGTRTAMRASAFP-----------TEDPQKLKTPADIMPL
MAS11_AGRRH     NMTKHALGGLTKTWDRRCAAIDICLGFVA-----TDMSAWTDLIASKD------------MIQPEDIAKL
DRS7B_MOUSE     SASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNL---------------------------------
ARDH_PICST      NMSKAGVIHLVRSLACEWAKYNIRVNTLSPGYILTPLTRNVISGHTEMKEAWESKIPMKRMAEPKEFVGS
YVX3_CAEEL      AVSKAGVEIMTKSLATEWSKYGLRFNAVSPGPIPTKWGRLFSGEMGDVAEKMKELNPEGRSGTPEEVANL
RIDH_KLEAE      TASKFAVQAFVHTTRRQVAQYGVRVGAVLPGPVVTALLDDWPKAKMDE------ALANGSLMQPIEVAES
HETN_ANASP      SASKAGLIMWTDAMRQELVGTGVNISVVCPGYV-------------------------------------
DRS7B_XENLA     SASKHATQAFFDCLRAEMSPYDIDVTVVNPGYIKTNL---------------------------------
DECR_HUMAN      ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKAFSRLDPTGTFE-KEMIGRIPCGRLGTVEELANL
BPHB_PSEPS      TAAKQAIVGLVRELAFELAPY-VRVNGVGPGGMNSD---MRGPSSLGMGSKAISTVPL------------
DHI2_MOUSE      GTSKAAIALLMDTFGCELLPWGIKVSIIKPGCFKTDAVTNVN-LWEKRKQLLLANIPRELL---------
BDH_RAT         CITKFGVEAFSDCLRYEMHPLGVKVSVVEPG---------------------------------------
ARDH_CANTR      NMSKAGVIHLARSLACEWAKYNIRVNTLSPGYILTPLTRNVISGHTEMKTEWESKIPMKRMAEPKEFVGS
YDFG_SHIFL      ----------------------------------------------------------------------
YDFG_SALTY      GATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLVGGTEFSSVRFKGDDEK---------------------
YDFG_SALTI      GATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLVGGTEFSSVRFKGDDEK---------------------
Y019_THEMA      SASKGGLVALTHSLAVSLSRYHIRVVSISPGWIETSEWKKK----SLRKKPDLRPIPAGRVGNPLDIAHL
HCD2_MOUSE      SASKGGIDGMTLPIARDLAPTGIRVVTIAPGLFATPLL-TTLP---EKVRNFLASVPFSRLGDPAEYAHL
DRS7B_XENTR     SASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKTNL---------------------------------
DHI2_RAT        GTSKAAIALLMDTFSCELLPWGIKVSIIQPGCFKTEAVTNVN-LWEKRKQLLLANLPRELL---------
YWC4_CAEEL      AVSKAGVETMTKSLATEWSKYGLRFNAVSPGPIPTKWGRLNSGEMGDIAEKMKFLNPEGRVGSPEEVANL
YIV5_YEAST      GSSKAALNHFAMTLANE--ERQVKAIAVAPGIVDTDM---------------------------------
RDH13_HUMAN     CQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQP
DHB11_PONAB     CSSKFAAVGFHKTLTDELAALQIT----------------------------------------------
BDH_MOUSE       CITKFGVEAFSDCLRYEMHPLGVKVSVVEPG---------------------------------------
DHRS7_ANOGA     SASKHAMQAFCDSLRAEVAKDNIKVTLISPGYINTAL---------------------------------
CBR4_RAT        SATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTKHL------KEEHFKKNIPLGRFGEALEVAHA
Y432_LISMO      GATKWAVRDLMEVLRMESAQEGTNIRTVTPAAINTELL---ETITDKETEQGMTSLYKQYGITPDRIASI
Y048_HAEIN      SGAKAAISNFTQWLAVYFSKVGIRCNAIAPGFLVSNLLFDTEGKPTDRANKILTNTPMGRFGESEELLGA
HSDL1_HUMAN     SASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSM---------------------------------
DHB11_RAT       CSSKFAAVGFHRALTDELAALGCT----------------------------------------------
DHB11_HUMAN     CSSKFAAVGFHKTLTDELAALQIT----------------------------------------------
DECR2_MOUSE     GAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISTELRRLRGSNASSKLKHFSNPIP--RLGTKTEIAHS
CBR4_HUMAN      SASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTK------DLKEEHLKKNIPLGRFGETIEVAHA
YDFG_ECOL6      ----------------------------------------------------------------------
Y5909_MYXXD     SASKAFLSTFMESLRVDLRGTGVRVTCIYPGFVKSEL---------------------------------
Y452_LISIN      GATKWAVRDLMEVLRMESAQEGIRTATIYPAAINTELL---ETITDKETEQGMTNLYKQYGVTPDRIASI
TODD_PSEP1      TAGKHAVIGLIKQLAHEWGP-RIRVNGIAPGGI-------------------------------------
BNZE_PSEPU      TAGKHAVIGLIKQLAHEWGP-RIRVNGIAPGGI-------------------------------------
YI78_SCHPO      YGTKYAIEGISEALTWEMQSIGVKVKIIEPGFTATE-FRVEEGAG-------------------------
PGDH_CAVPO      CASKHGIIGFTRSAAMKLMNSGVRMNAICPGFVNTSILQ-------------------------------
HSDL1_CHICK     GASKAYLDYFSRALYYEYASKGIFVQSLTPFVIATRM---------------------------------
DRS7C_HUMAN     AASKHAALGFFDCLRAEVEEYDVVISTVSP----------------------------------------
CSGA_MYXXA      RMSKAALNMAVRSMSTDLRPEGFVTVLLHPGWVQTDM---------------------------------
ARDH_CANAL      NMSKAGVIHLARSLACEWAKYNIRVNTLSPGYILTPLTRNVISGHTEMKTEWESKIPMKRMAEPKEFVGS
DH12A_DANRE     SSTKAFVDFFSRGLQTEYKCKGIIIQSVLPFFVATKMTKIRKP---------------------------
BDH_HUMAN       CITKFGVEAFSDCLRYEMYPLGVKVSVVEPG---------------------------------------
SOU2_CANAL      NAAKAGVKHLSKSLSVEWAPFA-RVNSVSPGYIATHLSEFADP---DVKSKWLQLTPLGREAKPREL---
SOU1_CANAL      NAAKAACTHLAKSLSVEWASFGARVNSISPGYILTDIADFADP---EMKKKWWQLTPLGREGLPQELVGA
FOLM_KLEP7      AASKAALDNMTRSFARKLAP-EVKVNAIAPSLI---MFN----EGDDERQQALDKSLMKIAPGEKEISDL
DRS7B_HUMAN     AASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNL---------------------------------
DHG_BACME       AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTP---INAEKFADPEQRVESMIPMGYIGEP------
DHG1_BACME      AASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTP---INAEKFADPEQRVESMIPMGYIGEP------
YDFG_ECO57      ----------------------------------------------------------------------
YB45_SCHPO      CCSKAAINMLVMNLGSE--EPDIMSVAVRPGVVDTPMDSNKEAMGGDTHNFFKELKTSGQLVAPQDIAKA
RDH16_HUMAN     CISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFKT-----------------------------------
HSDL1_PONAB     SASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSM---------------------------------
DHRS2_HUMAN     NVSKXXXXXXXXXXXXXXXPKDIRVNCVVPGIIKTDFSKVFH--GNESWKNFKEHHQLQRIGESEDCAGI
YDFG_ECOLI      ----------------------------------------------------------------------
Y7799_EMENI     NITQSHSYGNTKLHDVMLANAAIQVVSMHPGWVRTKMGGVMAPGALDRPARVLA----------------
MTDH_UROFA      NSSKAAVSNLGKCLAAEWAEKSIRVNMLSPGYVKTD--QTSH---MDQKLRDFQAVPLKRFAEPEEMAGQ
HSDL1_BOVIN     SASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATNV---------------------------------
DRS7B_PONAB     AASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNL---------------------------------
DLTE_BACSU      CATKAALHSFSLTLRHQLRDTSVEVIEMAPPMVDTGL---------------------------------
DHB11_MOUSE     CSSKFAAVGFHRALTDELAALGRT----------------------------------------------
YI13_SCHPO      CSTKSALAQFTSALRKETIDTRIRIMEVDPGLVETE----------------------------------
YD114_YEAST     GASKGAMIGFFRSLSTECNKTGIKTLLVCPGKIKTNMF--------------------------------
HCD2_BOVIN      SASKGGIVGMTLPIARDLAPMGIRVMTIA----XXXXXXXXXXXXXDKVRNFLASVPFSRLGDPAEYAHL
DR9C7_MOUSE     CVSKFGVEAFSDSIRRELHFFGVKVSIIEPGNYKTSI---------------------------------
DHI2_SHEEP      GTSKAALALLMGNFSCELLPWGVKVSIILPACFKTESVKDVHQ-WEERKQQLLATLPQELL---------
DCXR_TRIRE      NVAKAGCIHLARSLANEWRDFA-RVNSISPGYIDTGLSDFI-----DEKTQELSMIPMGRNGDAKELKGA
RDH1_HUMAN      CVSKFGLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPVTNL------------------------------
PGDH_MOUSE      CASKHGIIGFTRSAAMNLMKSGVRLNVICPGFVDTPILESIEKEENEYKDQIKAMMKFYGVLHPSTIANG
MKAR_MALGO      AGSKAFLIAWTQALGEEM----------------------------------------------------
HCAB_ECOLU      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECO8A      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECO7I      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
DRS7C_MOUSE     AASKHAVMGFFDCLRAEVEEYDVVVSTVSP----------------------------------------
DRS7B_RAT       AASKHATQAFFDCLRAEMKDSDIEVTVISPGYIHTNL---------------------------------
DHB13_RAT       CSSKFAAVGFHRALTAELDTLGKT----------------------------------------------
DHB12_MACFA     SATKTFVDFFSQCLHEEYRSKGIFVQSVLPYFVATKLAKLDKPTPETFVKSAIKTVGLQSRTNGYLIHVL
DHB12_HUMAN     SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSKSAIKTVGLQSRTNGYLIHAL
DHB12_BOVIN     SATKAFVDFFSQCLHEEYKSKGVIVQSVLPYYVATKLAKIKRPTWDKPSPETFVKSAMKTIG--------
RDH7_MOUSE      CISKYGVEAFSDSLRREISYFGVKVAIIEPGGFRTNVSRLSHSI--------------------------
HCAB_SHISS      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_SHIBS      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECOSM      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECOSE      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECOLI      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECOLC      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECOHS      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECODH      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECOBW      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECO55      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECO24      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
DRS7C_XENTR     AASKHAIQGFFDCLRAEVEEFDVSVSTVSP----------------------------------------
DRS7C_BOVIN     AASKHAALGFFDCLRAEVEEYDVVVSTVSP----------------------------------------
DHB13_HUMAN     CSSKFAAVGFHRGLTSELQALGKT----------------------------------------------
DHI1L_XENTR     AASKFALEGFFSSLRHELTPVSIT----------------------------------------------
DHB13_MOUSE     CSSKFAAVGFHRALTAELDTLGKT----------------------------------------------
RDH7_RAT        CISKYGVEAFSDSLRRELTYFGVKVAIIEPGGFKTNV---------------------------------
BZRD_BACSU      CSSKAGLDMFTRTFGFEQEDEELPVNMISPGVMDTEM---------------------------------
YUSR_BACSU      AVSKSAVHGLTKSLAHALAP-EIRVSGVAPGAVATRWW-----AGREEKKSMIGSLLLQCIAEPDDVAKL
RDH3_RAT        CISKYGVEAFSDSLRRELTYFGVKVAIIEPGGFKTNV---------------------------------
PGDH_MACFA      CASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTAI---------------------------------
PGDH_HUMAN      CASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTAI---------------------------------
HSDL1_RAT       SASKAYLDHFSRALQYEYASKGIFVQSLIP----------------------------------------
DR9C7_BOVIN     CISKFGVEAFSDSIRRELHYFGVKVSIIEPGNFRTAI---------------------------------
DHMA_FLAS1      ---------LTRAMAVDLARHGILVNMIAPGPVDVT----GNNTGYSEPRQVLDEVALGRPGLPEEVATA
DHI2_RABIT      GTSKAAMALLMDAFSCELLPWGVKVSVIQPGCFKTEVSNVSH--WEQRKQLLLANLP-------------
DHB3_RAT        SASKAFVCTFSKALNVEYRDKGIIIQVLTPYSVSTPM---------------------------------
RDH13_MOUSE     CQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTELGRHT-----------------------------
RDH12_MOUSE     CSAKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEITR-------------------------------
HSDL1_MOUSE     SASKAYLDHFSRALQYEYASKGIFVQSLIP----------------------------------------
HCAB_SHIFL      TTSKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_SHIF8      TTSKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECO5E      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
HCAB_ECO57      TASKHAATGLIRQLAYELAP-KVRVNGVGPCGMASDL-RGPQALGQSEPEKIAAILPLQFFPQPAD----
DRS7B_DANRE     AASKHAMQAYYDCLRAEVDSLGLHVSVLSPGYVRTNM---------------------------------
DR9C7_HUMAN     CVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAI---------------------------------
DR4L2_HUMAN     NVSKTALLGLNNTLAIELAPRNIRVNCL------------------------------------------
DHB11_MACFA     CSSKFSAVGFHKALTDELAALQIT----------------------------------------------
DH12B_DANRE     SSTKAFVDFFSRGLDAEYKSKGIIIQSVLPFYVTTKLSKIRKP---------------------------
BPHB_RHOGO      TGAKHAIVGMVKQLAYELGP-HIRVNGIAPG---------------------------------------
Y4EL_RHISN      AATKAAVVSLTRSFAHAFAKDQVLINSVAPAGMATEKAKSLGFLG-----ELAAANPLGRAAEPAEIAEF
STDH2_CAEEL     SATKKYVEWLTGCLRKEYSHHGIIFQAITPAMVATKM---------------------------------
MFEA_DICDI      GSMKMALVGLSNTLAQEGKSKNIHCNTIAP----IAASRLTESVMPPE---ILEQM------KPDYIVPL
DHB3_HUMAN      SASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAM---------------------------------
BDH_CHICK       CITKFGVEAFSDCLRYEMQPQGVMVSIVEPG---------------------------------------
YAEB_SCHPO      XXXXXXXXXXXNTLRIELAPFGVQVTSIMTGGVQTKI--QSKPLGTMTEAAI------------------
Y945_MYCTU      AASKAGVRSLGESLRAEYAQRPIRVTVLEPGYIESEM---------------------------------
STDH1_CAEEL     SATKKYVEWITGCLQKEYGHQGIIFQAITPAMVATKM---------------------------------
RDH2_RAT        CISKYGVEAFSDSLRRELSYFGVKVAIVEPGFFRTDV---------------------------------
DS7CB_DANRE     AASKHAVQAFFECLRAEVQEYGITVSTI------------------------------------------
DHRS7_DICDI     SSSKHAVMGFFNSLRNETKNIQIT--IVCPGFILTE----------------------------------
RDH12_HUMAN     CHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVR-------------------------------
RDH12_BOVIN     CHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKLVR-------------------------------
RDH11_MOUSE     CHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTR-------------------------------
RDH11_HUMAN     CHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVR-------------------------------
DHI1_RAT        SASKFALDGFFSTIRKEMTKVNVSITLCVLGFIDTE----------------------------------
DHI1_MOUSE      SASKFALDGFFSTIRTELTKVNVSITLCVLGLIDTE----------------------------------
DHB12_MOUSE     SATKAFVDFFSQCLHEEYKSKGIFVQSVMPYLVATKLAKIQKP---------------------------
PTR1_LEIMA      TMAKGALEGLTRSAALELAPLQIRVNGVGPG-----LSVLVDDMPPAVWEGHRSKVPLQRDSSAAEVSDV
MKAR_ASPTN      SGSKAFLQQWSTSLGSELAPYGITVELV------------------------------------------
KDSR_DICDI      CPSKFALRGLAETLRSELKPYKITFSVVYPPDTDTPGYQQENLTKPEE------TVAISGGGKPLEVAKS
H17B6_MOUSE     SCSKYGVEAFSDVLRHEVQDFGVKVSIIEPGSFKTEM---------------------------------
TSC10_CANAL     APMKSAIESLSIILRRELSPYNYRVTCVFPGNFQSEGFEEEQKTKPDITKKI------------------
PTR1_LEITA      TMAKEALEGLTRSAALELASLQIRVNGVSPG---LSVLPDDMPFSVQEDYR--RKVPLQRNSSAEEVSDV
DHI2_BOVIN      GTSKAALALLMGNFSCELLPWGVKVSIIQPACFKTESVKDVHQ-WEERKQQLLATLPQELL---------
YBPE_SCHPO      SSSKAALVSLHET---------------------------------------------------------
RDH14_MOUSE     SRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIH----------------------------
MKAR_NEUCR      SGSKAFLQHWSSALSAELKDQGVDVHLVVSYLVTTAMSKI------------------------------
HSDL2_XENLA     ----------------------------------------------------------------------
DHB14_BOVIN     VATKGAVTAMTKALALDESQYGVRVNCISPGNIWTPLWEELAASTPDPTATITLAQPLGRMGQP------
DRS7B_BOVIN     AASKHATQAFFDCLRAEVEQHDIEVTVISPGYIHTNL---------------------------------
DHI1_HUMAN      SASKFALDG-------------------------------------------------------------
ADH_DROLE       SASKAAVVSFTNSLA-KLAPIGVTAYSINPGITRTPL---------------------------------
MKAR_PODAN      SGSKAFLQHWSSSLASELAPHGVDVQFVISYLVTTAMSKV------------------------------
HCAB_PHOLL      TASKHGAVGMIRQLAYELAPV-IRVNGVAPCGMPSDL---------------------------------
DHB12_RAT       SATKAFVDFFSQCLHEEYKSKGIFVQSVLPFFVATKLAKIRKP---------------------------
BZRD_BACCE      CTTKAGVNMFTQCVATEEVPVKIV--AFAPGVVDTNMQAQIRETAKEDFTNLDRFIALKEEGKPEYVAKA
PGDH_BOVIN      CASKHGIVGFTRSAAMNLMNSGVRLNAICPGFVDTPILK-------------------------------
ADH_ZAPTU       SASKAAVVSFTQSIA-KLAPIGVTAYSINPGITKTTL---------------------------------
MKAR_CHAGB      SGSKAFLQHWSSSLASELKPHGVDVQLVVSYLVTTAMSKI------------------------------
DHRS9_MOUSE     TPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTE---LADPIKTTEKK--------------------
DHI1_SAISC      SASKFALYG-------------------------------------------------------------
ABA2_ARATH      XXXKHAVLGLTRSVAAELGQHGIRVNCVSPYAVATKLALAHLP---EEERTEDAFVGFRNFAAADDVANA
Y1570_MYCBO     IASKAAL---------------------------------------------------------------
Y1543_MYCTU     IASKAAL---------------------------------------------------------------
HSDL2_XENTR     ----------------------------------------------------------------------
CBR1_MOUSE      ----------------------------------------------------------------------
RDH14_HUMAN     SRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIH----------------------------
MKAR_EMENI      SGSKAFLQQWSTALGSELQPYGITVELV------------------------------------------
LE767_CAEEL     SATKKYVSWLTAILRKEYEHQGITVQTIAPMMVATKMSKVKRTSFFTPDGAVFAKSALNTVGNTSDTTGY
DHI1_MESAU      SASKFALDG-------------------------------------------------------------
CBR1_PIG        ----------------------------------------------------------------------
MKAR_KLULA      ----------------------------------------------------------------------
H17B6_RAT       SCSKYGVEAFSDVLRREIRDFGVKVSIIEPGSFKTRM---------------------------------
FOLM_ENT38      AASKAALDNMTRSFARKLAP-EVKVNAIAP-----SLILFNEEDDAEYRQKALNKSLMKIVPGEKEVIDL
ADH_DROVI       SASKAAALSFTNSLA-RLAPIGVTAYSINPGITRTPL---------------------------------
ADH_DROFL       SASKAAALSFTNSLA-RLAPIGVTAYSINPGITRTPL---------------------------------
ADH2_DROMN      SASKAAALSFTNSLA-RLAPIGVTAYSINPGITRTPL---------------------------------
ADH1_DROMT      SASKAAAISFTNSLA-KLAPIGVTAYSINPGITKTPL---------------------------------
TS2_MAIZE       TASKHAIVGLTKNAACELRAHGVRVNCVSPFGVATPMLXVTVPSDQEVEKRGLATLKGPTL-RPRDIAEA
RDHE2_HUMAN     CASKFAAFGFAESVFVETKQKGIKTTIVCPFFIKTGMF--------------------------------
MKAR_NEOFI      SGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSKVRRTSATIPDPRAFVKAVLSKIGR-------
DHRS9_RAT       TPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKT---GLADPIKTTEKK--------------------
DHI1_SHEEP      SASKFALDG-------------------------------------------------------------
ADH_DROLA       SASKAAALSFTNSLA-RLAPIGVTAYSINPGITRTPL---------------------------------
YXNA_BACSU      ASAKFALHGWTESIRMELAPVSVT--LIHPGRIDT-----------------------------------
RDHE2_MOUSE     CASKFAALGFAESMFIETKQWGIKTTIVCPFFIKTGMF--------------------------------
RDH1_BOVIN      CVSKFGLEAFSDSLRRDVAPFGVRVSIVEPGFFRTPVTNL------------------------------
MKAR_AJECN      CGSKAFLQYWSIALGAELQPYGVQVELVQSHLVTSAMSKIRRPTVTVPIPRDLVRAVLSKIGR-------
LE767_CAEBR     SATKKYVSWLTAILRKEYEHQGITIQTIAPMMVATKMSKVKRPDGATFAKSALNTV--------------
DHI1_RABIT      SASKFALDG-------------------------------------------------------------
ADH_DROMY       SASKAAALSFTNSLA-KLAPIGVTAYSINPGITKTTL---------------------------------
ADH_DROBO       SASKAAALSFTNSLA-RLAPIGVTAYSINPGITRTPL---------------------------------
ADH2_DROMU      SASKAAALSFTNSLA-KLAPIGVTAYSINPGITKTTL---------------------------------
ADH2_DROHY      SASKAAALSFTNSLA-KLAPIGVTAYSINPGITKTTL---------------------------------
ADH2_DROBU      SASKAAALSFTNSLA-KLAPIGVTAYSINPGITKTTL---------------------------------
ADH1_DRONA      SASKAAALSFTNSLA-KLAPIGVTAYSINPGITKTTL---------------------------------
ADH1_DROHY      SASKAAALSFTNSLA-KLAPIGVTAYSINPGITKTTL---------------------------------
S16C6_BOVIN     CASKFAAYGFAESLHFELKLLKINTTIVCPYFIKTGMF--------------------------------
CBR1_MACFA      ----------------------------------------------------------------------
ADH2_DROAR      SASKAAALSFTNSLA-RLAPIGVTAYSINPGITKTTL---------------------------------
ADH1_DROMU      SASKAAALSSTNSLA-KLAPIGVTAYSINPGITKTPL---------------------------------
ADH1_DROMN      SASKAAALSFTNSLA-RLAPIGVTAYSINPGITRTPL---------------------------------
MKAR_PHANO      SGSKAFLQQWSSALGSELEPHGVHVQCVQSHLITTAMSKIRKPSALVPNPKQFVKATLSKLGR-------
DHRSX_HUMAN     AQSKLALVLFTYHLQRLLAAEGVTANVVDPGVVNTDVYK-------------------------------
ADH2_CERCA      CASKFGVMGFSRSIGYYYNITGVAVVTFCPGLTETP---LKNNIGSEYSKKISEELNSTKTQKPEVCGAH
MKAR_ASPCL      SGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSKVRRTSALIPSPRAFVSSVLSKIGR-------
HSDL2_PONAB     ----------------------------------------------------------------------
FABG_YEAST      SASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNLPV--EAKEMLERTIGASGTSAPAEIAEE
ADH_DROIM       SASKAAVVSFTSSLA-KLAPIGVIAYSINPGITKTTL---------------------------------
ADH2_DROWH      SASKAAALSFTNSLA-KLAPIGVTAYSINPGITVTPL---------------------------------
ADH1_CERCA      CASKFGVVGFSRSLGFYYEHTGVAVVTFCPGLTDTP---LKNNIGSDYSKEIGEKLNSSKTQKPEVCGAH
HSDL2_HUMAN     ----------------------------------------------------------------------
DHI1B_XENLA     CASKFALEGLRREFALQNSKMSVTVAVL--GYIDTE----------------------------------
CBR3_HUMAN      ----------------------------------------------------------------------
ADH_DRONI       SASKAAALSFTGSIA-KLAPIGVTAYSINPGITKTVL---------------------------------
ADH1_DROMO      SASKAAALSFTNSLA-KLAPIGVTAYSINPGITKTPL---------------------------------
YL426_YEAST     ----------------------------------------------------------------------
INHA_MYCS2      TVAKSALESVNRFVAREAGKVGVRSNLVAAGPIRT-----------------------------------
CBR1_PONAB      ----------------------------------------------------------------------
CBR1_HUMAN      ----------------------------------------------------------------------
ADH_SCAAL       SASKAAALSFTSSLA-RLAPIGVTVYSINPGITDTTL---------------------------------
ADH2_DROMO      SASKAAALSFTNSLA-RLAPIGVTAYSINPGITKTTL---------------------------------
SPRE_XENLA      CSGKAARDMMFRVLAEEEDDVRVL--SYAPGPLDTDMHEVACTQTADPELR-------------------
MKAR_PICGU      LATYSGSKAFLQSWSNELQPQGVDVELVISYLVTSAMSKIRRSSASIPNPKAFVKSVLRNVGR-------
MKAR_MAGGR      LATYSGSKAFLQHWSTSLA---------------------------------------------------
FOLM_SHIBS      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
DHRS9_BOVIN     SPSKYAVEGFNDSLRRDMKAFGVHVACIEPGLFKTNL---------------------------------
SPRE_XENTR      CSGKAARDMIFRVLAEEEKDVRVL--NYAPGPLDTDMHVVARTQTADPELR-------------------
DS7CA_DANRE     AASKHAVQAFFDCLRAEVEEFGISVSTIS-----------------------------------------
DHI2_HUMAN      GTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVR-------------------------------
ADH_DROPL       SASKAAALSFTTSLAKLAHITGVTAYSINPGITKTVL---------------------------------
ADH_DROMM       SASKAAALSFTNSLARLASVTGVTAYSINPGITKTVL---------------------------------
ADH_DROGR       SASKAAALSFTTSIAKLAHITGVTAYSINPGITKTVL---------------------------------
ADH_DRODI       SASKAAALSFTTSLAKLAHITGVTAYSINPGITKTVL---------------------------------
RD10A_DANRE     CASKFGAIGFHESLSHEIQASGIKMTLVCPYLVDTGMFR-------------------------------
MKAR_BOTFB      ----------------------------------------------------------------------
MKAR_ASPFU      SGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSKVRRTSATIPDPRAFVKAVLSKIGR-------
MKAR_ASPFC      SGSKAFLQQWSTSLGSELEPYGITVELVQAYLITSAMSKVRRTSATIPDPRAFVKAVLSKIGR-------
FABI2_RHIME     GVAKAALEASVRYLAADYGSRGIRVNAISAGPIRT-----LAGAGISDARAMLSNSPLRRTVTIEDVGSS
ADH_DROSU       SGSKAAVVNFTSSLA-KLAPIGVTAYTVNPGITKTTL---------------------------------
ADH_DROPS       SGSKAAVVNFTSSLA-KLAPIGVTAYTVNPGITKTTL---------------------------------
ADH_DROPI       SASKAAALSFTMSIAKLAHITGVTAYSINPGITKTIL---------------------------------
ADH_DROPB       SGSKAAVVNFTSSLA-KLAPIGVTAYTVNPGITKTTL---------------------------------
ADH_DROMD       SGSKAAVVNFTSSLA-KLAPIGVTAYTVNPGITKTTL---------------------------------
ADH_DROHA       SASKAAALSFTTSIAKLAHITGVTAYSINPGITKTVL---------------------------------
ADH_DROGU       SGSKAAVVNFTSSLA-KLAPIGVTAYTVNPGITKTTL---------------------------------
ADH_DROCR       SASKAAALSFTSSIAKLATITGVTVYSINPGITDTTL---------------------------------
ADH_DROAM       SGSKAAVVNFTSSLA-KLAPIGVTAYTVNPGITKTTL---------------------------------
ADH_DROAD       SASKAAALSFTTSFRKLAGITGVTAYSINPGITKTVL---------------------------------
STDH3_CAEEL     SASKKYVEWLTGCLRKEYEHQGIIIQAITPALVATKLSGHTETSLFCPDSATFAKSALNTVGHTSQTTGY
RDH10_RAT       CASKFGVVGFHESLSHELKAAGIKTTLVCPYLVDTGMFR-------------------------------
RDH10_MOUSE     CASKFGVVGFHESLSHELKAAGIKTTLVCPYLVDTGMFR-------------------------------
RDH10_HUMAN     CASKFGVVGFHESLSHELKAAGIKTTLVCPYLVDTGMFR-------------------------------
RDH10_BOVIN     CASKFGVVGFHESLSHELKAAGIKTTLVCPYLVDTGMFR-------------------------------
RD10B_DANRE     CASKFGAIGFHESLSHELKAAGIKMTLVCPFLVDTGMF--------------------------------
DHI1L_DANRE     ----------------------------------------------------------------------
DHB3_MOUSE      SASKAFVYTFSKALSVEYRDKGIIIQVLTPYSISTPM---------------------------------
ADH_DROYA       SGTKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
ADH_DROTE       SGTKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
ADH_DROPE       SGSKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
ADH_DROAF       SASKAAALSFTTSIAKLAHITGVTAYSINPGITKTVL---------------------------------
MKAR_PICST      LATYSGSKSFLQAWSAALA---------------------------------------------------
MKAR_ASPOR      SGSKAFLQQWSTALGSELEEHGITVELVQAYLITSAMSKIRRASATIPDPRSFVKSVLSKIGR-------
DHI1A_XENLA     CASKFALEGLRREFALQNSNMSVTVAVL--GYIDTE----------------------------------
ADH_DROSI       SGTKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
ADH_DROSE       SGTKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
ADH_DROME       SGTKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
ADH_DROMA       SGTKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
ADH_DROER       SGTKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
RDH10_XENTR     CASKFGVVGFHESLSHELKAAGIKTTLVCPYLVDTGMFR-------------------------------
RD10B_XENLA     CASKFGVVGFHESLSHELKAAGIKTTLVCPYLVDTGMFR-------------------------------
MKAR_SCLS1      ----------------------------------------------------------------------
MKAR_PYRTR      SGSKAFLQQWSTALASELEPHGVYVQCVQSHLVTTAMSKI------------------------------
FOLM_ECOSM      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
ADH_DROTS       SGTKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
ADH_DROOR       SGTKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
ADH_DROHE       SASKAAALSFTTSLAKLAHITGVTVYSINPGITKTVL---------------------------------
SRLD_ECOLI      SAAKFGGVGLTQSLALDLAEYGITVHSLMLGNLKSPMFQSLLPIKPDQEQYYIDKVPLKRGCDYQDVLNM
FOLM_SHIFL      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FOLM_SHIF8      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FOLM_SHIDS      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FOLM_ECOLI      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FOLM_ECOLC      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FOLM_ECOHS      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FOLM_ECO57      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FOLM_ECO24      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FABI_HAEIN      CLAKASLEAATRVMAADLGKEGIRVNAISAGPIRT-----LAASGIKNFKKMLSTFALRRTVTIEDVGNS
YDFG_DICNO      ----------------------------------------------------------------------
HSDL2_DANRE     ----------------------------------------------------------------------
HSDL1_DANRE     SASTAFLDNFSRSLHYEYGDQGVFVQSLLPFRVASQ----------------------------------
FOLM_ECOUT      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FOLM_ECOL6      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FOLM_ECOL5      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FOLM_ECOK1      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FABI_SALTY      GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-----LAASGIKDFRKMLAVTPIRRTVTIEDVGNS
ADH_DROWI       SASKAAVVSFTQSIAKLANVTGVTAFTVNPGITKTTL---------------------------------
ADH_DROPU       SASKAAVVSFTQSIAKLANVTGVTAFTVNPGITKTTL---------------------------------
ADH_DROIN       SASKAAVVSFTQSIAKLANVTGVTAFTVNPGITKTTL---------------------------------
ADH_DROEQ       SASKAAVVSFTQSIAKLANVTGVTAFTVNPGITKTTL---------------------------------
YUXG_BACSU      SSVKALETHLARCIAAEGGEFGIRVNSVLPDAV-------------------------------------
YR419_MIMIV     SACKAFIHSMTQTIATQSAKLGIRVNCIAPGPILTP---LEIPIFLPDKKNVFEPVPMKRTGTTNEISPT
YMP3_STRCO      GSSKAGLDAFAQGLGDALYGTGVRVMVVRPGTV-------------------------------------
RL6_PSEU5       ALVNNMVIGVSQGFERKLQLVGVGYKAQAKGQVLSLALGFSHPVDYELPQGVTAETPSQ-----------
FABI_ANASP      GVAKAGLEASVRYLASELGSQNIRVNAISAGPIRT---LASSAVGGDMIHHVEQVAPLRRTVTQLEVGNT
DHRS3_MOUSE     CTSKASAFAFMESLTLGLLDCGVSATTVLPFHTSTEMFQ-------------------------------
AYR1_YEAST      SASKAAIHQYARGLHLEMKPFNVRVINAITGGVATDI---------------------------------
TSC10_NEUCR     TPTKWALRGLADTLAMEV----------------------------------------------------
RD10A_XENLA     CASKFGVVGFHESLSHEIKASGIKTTLVCPYLVDTGMFR-------------------------------
POR_PLEBO       ----------------------------------------------------------------------
FOLM_SHISS      AASKAALDNMTRSFARKLAP-EVKVNSIAP-----SLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDL
FABI1_RHIME     --AKAALEASVRYLAVDLGNRGIRVNAISAGPIKT-----LAASGIGDFRYILKNAPLKRTVSIEEVGNS
ADH_DROSL       SASKAAALSFTTSLAKLAHITGVTVYSINPGITKTVL---------------------------------
ADH_DROAN       SGTKAAVVNFTSSLA-KLAPIGVTAYTVNPGITRTTL---------------------------------
WWOX_HUMAN      GKLDFSRLSPTKNWAMRLSPRGVTSNAVHPGNVYTLLFTLARPFTKSMQQGAATTV--------------
NOR1_ASPPA      SRAPLTAYGVSKLAAFHFENKWLTAFIIDPGHVQTDM---------------------------------
FOLM_CITK8      AASKAALDNMTRSFARKLAP-EVKVNAIAP-----SLILFNENDDAEYRQQALNKSLMKTAPGEKEVIDL
DHRSX_MOUSE     AAYXXXXXXXXXXXXXXXXXXDVTSNMADPGVVDTELYR-------------------------------
WWOX_PONAB      GKLDFSRLSPTKNWAMRLSPRGVTSNAVHPGNVYTLLFTLARPFTKSMQQGAATTV--------------
PORB_HORVU      NVPPKANLGDLRGLAAGLNGVGSAA---------------------------------------------
FABI_SHIFL      GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-----LAASGIKDFRKMLAVTPIRRTVTIEDVGNS
FABI_ECOLI      GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-----LAASGIKDFRKMLAVTPIRRTVTIEDVGNS
FABI_ECO57      GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRT-----LAASGIKDFRKMLAVTPIRRTVTIEDVGNS
Y1430_HAEIN     GGTKAFVTQFSLNLRADLAGTKIRVSNVEPGLCGGTEFSNVRFHGDDE--RAAKVYENVQSVQPEDIANI
POR_SYNY3       ----------------------------------------------------------------------
MKAR_CRYNE      ----------------------------------------------------------------------
INHA_MYCTU      TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
INHA_MYCBO      TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRT-----------------------------------
HSDL2_MOUSE     ----------------------------------------------------------------------
FABI_NEIMB      GMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKT----LAASGIADFGKHVAAHNPLRRNVTIEEVGNT
SPRE_MOUSE      CAGKAARDMLYQVLAAEEPSVRVL--SYAPGPLDNDMQQLARETSKDPELR-------------------
POR_DAUCA       ----------------------------------------------------------------------
MKAR_ASHGO      ----------------------------------------------------------------------
DHI1_CAVPO      SASKFALDGFFSTLRSEVNKVNVSITLCILGLIDTE----------------------------------
DHI1L_CHICK     SATKFALDG-------------------------------------------------------------
Y2073_MYCBO     ----------------------------------------------------------------------
Y2047_MYCTU     ----------------------------------------------------------------------
POR_MARPA       ----------------------------------------------------------------------
CBR1_RAT        ----------------------------------------------------------------------
TSC10_CRYNE     SPAKYALRGLS-----------------------------------------------------------
PORB_ARATH      ----------------------------------------------------------------------
MOMAS_ORYSJ     TTSKHALVGFTENAAGELGRHGIRVNCVSPAGVATPLARAA--MGMDDE---------------------


                         .         .         .         +         .         .         .:280
query           ISYLISDGASFVTxxxxxxxxxxxxxxx
FABG_VIBHA      VVFLASPEAAYIT---------------
NODG_AZOBR      VSYLASEIAGYVT---------------
FIXR_BRAJA      IFFLCSDAASYVT---------------
FABG_CUPLA      VEFLINPASSYVT---------------
FABG_SHIFL      VAFLASDEAAYIT---------------
FABG_ECOLI      VAFLASDEAAYIT---------------
FABG_PSEAE      VGFLASDGAAYVT---------------
FABG_BACSU      VTFLASEGARYMT---------------
FABG_BUCAP      VIFLSSEKASYIT---------------
FABG_HAEIN      VAFLASDDAGYIT---------------
FABG_CHLTR      ALFLASDGSSYIT---------------
FABG_THEMA      ILFLASDESSYVT---------------
FABG1_SYNY3     IRFLATDAAAYIT---------------
BUDC_KLEPN      VSYLASPDSDYMT---------------
FABG_STAES      VAFLASDKAKYIT---------------
FABG_STAEQ      VAFLASDKAKYIT---------------
FABG_RICPR      VAFLASNNASYIT---------------
FABG_MYCTU      VSFLASEDASYIS---------------
FABG_MYCBO      VSFLASEDASYIS---------------
FABG_MYCS2      VSFLASEDASYI----------------
PHAB_ACISR      VMYLVSEHGAYVT---------------
NODG_RHIS3      VAYLASNEAAYVT---------------
PHBB_RALEH      CAWLSSEESGFST---------------
FABG_STAAW      VAFLASDKAKYIT---------------
FABG_STAAS      VAFLASDKAKYIT---------------
FABG_STAAR      VAFLASDKAKYIT---------------
FABG_STAAN      VAFLASDKAKYIT---------------
FABG_STAAM      VAFLASDKAKYIT---------------
FABG_STAAC      VAFLASDKAKYIT---------------
FABG_AQ