[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08812.1

[Show Plain Result]


## Summary of Sequence Search
    1::316
    6::313     4e-59  38%  315 aa  Y209_BRUME RecName: Full=Putative peptide transport system permease
    5::312     4e-59  38%  314 aa  Y1050_BRUA2 RecName: Full=Putative peptide transport system
    5::312     4e-59  38%  314 aa  Y1031_BRUAB RecName: Full=Putative peptide transport system
    5::311     6e-59  38%  314 aa  Y1092_BRUSU RecName: Full=Putative peptide transport system
   13::332     6e-59  37%  333 aa  DPPB_BACPF RecName: Full=Dipeptide transport system permease
    2::309     7e-57  38%  314 aa  NIKB_ECOLI RecName: Full=Nickel transport system permease protein
    2::336     1e-54  36%  339 aa  DPPB_ECOLI RecName: Full=Dipeptide transport system permease
    2::336     1e-54  36%  339 aa  DPPB_ECOL6 RecName: Full=Dipeptide transport system permease
    2::336     1e-54  36%  339 aa  DPPB_ECO57 RecName: Full=Dipeptide transport system permease
    4::312     3e-53  33%  313 aa  Y4TP_RHISN RecName: Full=Probable peptide ABC transporter permease
    4::315     1e-52  33%  316 aa  APPB_BACSU RecName: Full=Oligopeptide transport system permease
    4::332     5e-48  33%  333 aa  DPPB_HAEIN RecName: Full=Dipeptide transport system permease
    2::304     9e-47  32%  306 aa  GSIC_SALTI RecName: Full=Glutathione transport system permease
    2::304     9e-47  32%  306 aa  GSIC_SALCH RecName: Full=Glutathione transport system permease
    2::304     2e-46  32%  306 aa  GSIC_SALTY RecName: Full=Glutathione transport system permease
    2::304     2e-45  31%  306 aa  GSIC_SALPA RecName: Full=Glutathione transport system permease
    2::304     1e-44  32%  306 aa  GSIC_ERWCT RecName: Full=Glutathione transport system permease
    2::304     2e-43  30%  306 aa  GSIC_ECOL6 RecName: Full=Glutathione transport system permease
    2::304     6e-43  30%  306 aa  GSIC_SHIDS RecName: Full=Glutathione transport system permease
    2::304     6e-43  30%  306 aa  GSIC_ECOUT RecName: Full=Glutathione transport system permease
    2::304     6e-43  30%  306 aa  GSIC_ECOLI RecName: Full=Glutathione transport system permease
    2::304     6e-43  30%  306 aa  GSIC_ECOL5 RecName: Full=Glutathione transport system permease
    2::304     6e-43  30%  306 aa  GSIC_ECOK1 RecName: Full=Glutathione transport system permease
    2::304     7e-43  30%  306 aa  GSIC_ECO57 RecName: Full=Glutathione transport system permease
    2::304     1e-42  30%  306 aa  GSIC_SHIF8 RecName: Full=Glutathione transport system permease
    4::304     2e-42  30%  306 aa  GSIC_SHIFL RecName: Full=Glutathione transport system permease
    2::304     2e-42  33%  306 aa  GSIC_SHISS RecName: Full=Glutathione transport system permease
    2::304     5e-42  30%  306 aa  GSIC_SHIBS RecName: Full=Glutathione transport system permease
    2::305     2e-37  30%  306 aa  OPPB_SALTY RecName: Full=Oligopeptide transport system permease
    2::305     8e-37  30%  306 aa  OPPB_SHIFL RecName: Full=Oligopeptide transport system permease
    2::305     8e-37  30%  306 aa  OPPB_ECOLI RecName: Full=Oligopeptide transport system permease
    2::305     8e-37  30%  306 aa  OPPB_ECOL6 RecName: Full=Oligopeptide transport system permease
    2::305     8e-37  30%  306 aa  OPPB_ECO57 RecName: Full=Oligopeptide transport system permease
   29::303     2e-34  32%  308 aa  DPPB_BACSU RecName: Full=Dipeptide transport system permease
    5::317     1e-33  26%  319 aa  OPPB_LACLS RecName: Full=Oligopeptide transport system permease
    5::317     1e-33  26%  319 aa  OPPB_LACLA RecName: Full=Oligopeptide transport system permease
    2::305     1e-32  28%  306 aa  OPPB_HAEIN RecName: Full=Oligopeptide transport system permease
   31::317     5e-31  31%  319 aa  Y3860_BRUME RecName: Full=Putative peptide permease protein
   31::317     5e-31  31%  319 aa  Y2551_BRUO2 RecName: Full=Putative peptide permease protein
    6::336     2e-30  28%  340 aa  DDPB_ECOLI RecName: Full=Probable D,D-dipeptide transport system
   31::317     7e-30  30%  319 aa  Y3408_BRUSU RecName: Full=Putative peptide permease protein
    2::303     6e-29  28%  311 aa  OPPB_BACSU RecName: Full=Oligopeptide transport system permease
    7::303     3e-28  25%  328 aa  OPPB2_STAAB RecName: Full=Putative oligopeptide transport system
    7::303     4e-28  25%  328 aa  OPPB2_STAAR RecName: Full=Putative oligopeptide transport system
    7::303     7e-28  25%  328 aa  OPPB2_STAAW RecName: Full=Putative oligopeptide transport system
    7::303     7e-28  25%  328 aa  OPPB2_STAAS RecName: Full=Putative oligopeptide transport system
    7::303     7e-28  25%  328 aa  OPPB2_STAAN RecName: Full=Putative oligopeptide transport system
    7::303     7e-28  25%  328 aa  OPPB2_STAAM RecName: Full=Putative oligopeptide transport system
    7::303     7e-28  25%  328 aa  OPPB2_STAAC RecName: Full=Putative oligopeptide transport system
    7::303     7e-28  25%  328 aa  OPPB2_STAA8 RecName: Full=Putative oligopeptide transport system
    7::303     7e-28  25%  328 aa  OPPB2_STAA3 RecName: Full=Putative oligopeptide transport system
   44::311     3e-24  30%  321 aa  SAPB_SALTY RecName: Full=Peptide transport system permease protein
   44::311     3e-24  30%  321 aa  SAPB_SALTI RecName: Full=Peptide transport system permease protein
   44::311     1e-23  28%  321 aa  SAPB_ECOLI RecName: Full=Peptide transport system permease protein
   44::311     1e-23  28%  321 aa  SAPB_ECO57 RecName: Full=Peptide transport system permease protein
    4::359     1e-18  26%  364 aa  YEJB_ECOLI RecName: Full=Inner membrane ABC transporter permease
    4::359     1e-18  26%  364 aa  YEJB_ECO57 RecName: Full=Inner membrane ABC transporter permease
   25::323     3e-16  25%  325 aa  Y1314_MYCBO RecName: Full=Putative peptide transport permease
   25::323     3e-16  25%  325 aa  Y1283_MYCTU RecName: Full=Putative peptide transport permease
   45::282     3e-14  24%  321 aa  SAPB_HAEIN RecName: Full=Peptide transport system permease protein
    4::296     2e-12  21%  389 aa  OPPB_MYCPN RecName: Full=Oligopeptide transport system permease
  353::491     3e-12  29%  498 aa  AMIC_STRR6 RecName: Full=Oligopeptide transport system permease
  353::491     3e-12  29%  498 aa  AMIC_STRPN RecName: Full=Oligopeptide transport system permease
  154::293     1e-05  27%  296 aa  Y207_BRUME RecName: Full=Putative peptide transport system permease
  154::293     1e-05  27%  296 aa  Y1093_BRUSU RecName: Full=Putative peptide transport system
  154::293     1e-05  27%  296 aa  Y1051_BRUA2 RecName: Full=Putative peptide transport system
  154::293     1e-05  27%  296 aa  Y1032_BRUAB RecName: Full=Putative peptide transport system
  168::375     1e-05  25%  376 aa  OPPC_MYCPN RecName: Full=Oligopeptide transport system permease
   89::300     1e-05  27%  301 aa  GSID_ERWCT RecName: Full=Glutathione transport system permease
   91::302     2e-05  29%  303 aa  GSID_SALTY RecName: Full=Glutathione transport system permease
   91::302     2e-05  29%  303 aa  GSID_SALTI RecName: Full=Glutathione transport system permease
   91::302     2e-05  29%  303 aa  GSID_SALPA RecName: Full=Glutathione transport system permease
   91::302     2e-05  29%  303 aa  GSID_SALCH RecName: Full=Glutathione transport system permease
  157::302     8e-05  32%  302 aa  Y3861_BRUME RecName: Full=Putative peptide permease protein
  157::302     8e-05  32%  302 aa  Y3407_BRUSU RecName: Full=Putative peptide permease protein
  157::302     8e-05  32%  302 aa  Y3315_BRUA2 RecName: Full=Putative peptide permease protein
  157::302     8e-05  32%  302 aa  Y3094_BRUAB RecName: Full=Putative peptide permease protein
  157::302     8e-05  32%  302 aa  Y2550_BRUO2 RecName: Full=Putative peptide permease protein
  195::320     1e-04  30%  320 aa  DPPC_BACSU RecName: Full=Dipeptide transport system permease
  169::302     2e-04  27%  303 aa  GSID_ECOLI RecName: Full=Glutathione transport system permease
  169::302     3e-04  26%  303 aa  GSID_SHISS RecName: Full=Glutathione transport system permease
  169::302     3e-04  26%  303 aa  GSID_SHIFL RecName: Full=Glutathione transport system permease
  169::302     3e-04  26%  303 aa  GSID_SHIF8 RecName: Full=Glutathione transport system permease
  169::302     3e-04  27%  303 aa  GSID_SHIDS RecName: Full=Glutathione transport system permease
  169::302     3e-04  26%  303 aa  GSID_SHIBS RecName: Full=Glutathione transport system permease
  169::302     3e-04  26%  303 aa  GSID_ECOUT RecName: Full=Glutathione transport system permease
  169::302     3e-04  26%  303 aa  GSID_ECOL6 RecName: Full=Glutathione transport system permease
  169::302     3e-04  26%  303 aa  GSID_ECOL5 RecName: Full=Glutathione transport system permease
  169::302     3e-04  26%  303 aa  GSID_ECOK1 RecName: Full=Glutathione transport system permease
  169::302     3e-04  26%  303 aa  GSID_ECO57 RecName: Full=Glutathione transport system permease
  198::289     5e-04  32%  291 aa  Y4TQ_RHISN RecName: Full=Probable peptide ABC transporter permease
    1::316

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTYLLRRIAYALPILLGVALLCFSLVHIAPGDPLVSVLPPDASEDLRRQLTALYGFDKPFLEQFLHWLLR
Y209_BRUME      ---ILKRVAQAIPVMLIVAILTFLLMKLLPGDPAILIAGDGASPETVERIRVELGLDQPTVVQLGQWLWN
Y1050_BRUA2     ---ILKRVAQAIPVMLIVAILTFLLMKLLPGDPAILIAGDGASPETVERIRVELGLDQPTVVQLGQWLWN
Y1031_BRUAB     ---ILKRVAQAIPVMLIVAILTFLLMKLLPGDPAILIAGDGASPETVERIRVELGLDQPTVVQLGQWLWN
Y1092_BRUSU     ---ILKRVAQAIPVMLIVAILTFLLMKLLPGDPAILIAGDGASPETVERIRVELGLDQPTVVQLGQWLWN
DPPB_BACPF      -----------IPVLIGMTIVTFSIIHLIPGNPAQTILGEQASPQAIADLEERLGLNEPYWVQYGLYMKD
NIKB_ECOLI      LRYVLRRFLLLIPMVLAASVIIFLMLRLGTGDPALSNLPP--TPEMLASTRTMLGLDQPLYVQYGTWLWK
DPPB_ECOLI      LQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGSPERHAQLLAELGLDKPMWQQYLHYIWG
DPPB_ECOL6      LQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGSPERHAQLLAELGLDKPMWQQYLHYIWG
DPPB_ECO57      LQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGSPERHAQLLAELGLDKPMWQQYLHYIWG
Y4TP_RHISN      --YILRRLVSTIAVMAMVGIFIFLLLRLAPGDPAAVIAGPTATEQMVANIREELGLNEPLPVQFVHWASD
APPB_BACSU      --YIIRRTLMSIPILLGITILSFVIMKAAPGDPMTLMMDPKISQADREQFIEKYGLNDPQYVQYLKWLGN
DPPB_HAEIN      --FVFKRILMVIPTFIAITLITFALVHFIPGDPVEIMMGERGTAEVHQQMMHQLGLDLPLYQQYFHYIGN
GSIC_SALTI      LNYVLKRLLGLIPTXXXXXXXXXXXXXXXPGDPARLIAGPEADAQVIALVRQQLGLDQPLHVQFWHYITH
GSIC_SALCH      LNYVLKRLLGLIPTXXXXXXXXXXXXXXXPGDPARLIAGPEADAQVIALVRQQLGLDQPLHVQFWHYITH
GSIC_SALTY      LNYVLKRLLGLIPTXXXXXXXXXXXXXXXPGDPARLIAGPEADAQVIALVRQQLGLDQPLHVQFWHYITH
GSIC_SALPA      LNYVLKRLLGLIPTXXXXXXXXXXXXXXXPGDPARLIAGPEADAQVIALVRQQLGLDQPLHVQFWRYITH
GSIC_ERWCT      LNYFIKRLLGLIPTXXXXXXXXXXXXXXXPGDPXXXXXXXXXXXXVIEMVRQDLGLDKPLPHQFWHFLTN
GSIC_ECOL6      LNYVIKRLLGLIPTXXXXXXXXXXXXHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPLYHQFWHYISN
GSIC_SHIDS      LNYVIKRLLGLIPTXXXXXXXXXXXXHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPLYHQFWHYISN
GSIC_ECOUT      LNYVIKRLLGLIPTXXXXXXXXXXXXHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPLYHQFWHYISN
GSIC_ECOLI      LNYVIKRLLGLIPTXXXXXXXXXXXXHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPLYHQFWHYISN
GSIC_ECOL5      LNYVIKRLLGLIPTXXXXXXXXXXXXHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPLYHQFWHYISN
GSIC_ECOK1      LNYVIKRLLGLIPTXXXXXXXXXXXXHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPLYHQFWHYISN
GSIC_ECO57      LNYVIKRLLGLIPTXXXXXXXXXXXXHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPLYHQFWHYISN
GSIC_SHIF8      LNYVIKRLLGLIPTXXXXXXXXXXXXHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPLYHQFWHYISN
GSIC_SHIFL      --YVIKRLLGLIPTXXXXXXXXXXXXHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPLYHQFWHYISN
GSIC_SHISS      LNYVIKRLLGLIPTXXXXXXXXXXXXHMLPGDPLIAGLEADAQELVRQQL----GLDQPLYHQFWHYISN
GSIC_SHIBS      LNYVIKRLLGLIPTXXXXXXXXXXXXHMLPGDPARLIAGPEADAQVIELVRQQLGLDQPLYHQFWHYISN
OPPB_SALTY      LKFILRRCLEAIPTLFILITISFFMMRLAPGSPFTGALPPEVLANIE----AKYHLNDPIMTQYFSYLKQ
OPPB_SHIFL      LKFILRRCLEAIPTLFILITISFFMMRLAPGSPFTGTLPPEVMANIE----AKYHLNDPIMTQYFSYLKQ
OPPB_ECOLI      LKFILRRCLEAIPTLFILITISFFMMRLAPGSPFTGTLPPEVMANIE----AKYHLNDPIMTQYFSYLKQ
OPPB_ECOL6      LKFILRRCLEAIPTLFILITISFFMMRLAPGSPFTGTLPPEVMANIE----AKYHLNDPIMTQYFSYLKQ
OPPB_ECO57      LKFILRRCLEAIPTLFILITISFFMMRLAPGSPFTGTLPPEVMANIE----AKYHLNDPIMTQYFSYLKQ
DPPB_BACSU      ---------------------------VIPGSPFNE--ERGTNEAVQKNLEAYYHLDDPLIFQYIFYLKS
OPPB_LACLS      ---IIRRILLMIPQLFILSILVFFFAKLMPGDPFSGLIGPHTDPHEVEALRRAAGLYDPWWEQYLRWLGN
OPPB_LACLA      ---IIRRILLMIPQLFILSILVFFFAKLMPGDPFSGLIGPHTDPHEVEALRRAAGLYDPWWEQYLRWLGN
OPPB_HAEIN      LKFIFKRLLEAXXXXXXXXXXXXXXMRLAPGSPFTSAYPPEVMANIE----AKYHLNEPLYKQYFLYLEN
Y3860_BRUME     -----------------------------PGDPIDAYINPNVAMTQAEMLRAQLGLDRPLPVQYLAWLGQ
Y2551_BRUO2     -----------------------------PGDPIDAYINPNVAMTQAEMLRAQLGLDRPLPVQYLAWLGQ
DDPB_ECOLI      ---ILRQRCWGLVLVVGVCVITFIISHLIPGDPARLLAGDRASDAIVENIRQQLGLDQPLYVQFYRYVSD
Y3408_BRUSU     -----------------------------PGDPIDAYINPNVAMTQAEMLRAQLGLDRPLPVQYLAWLGQ
OPPB_BACSU      LKYIGRRLVYMIITLFVIVTVTFFLMQAAPGGPFSGELPPE----IEANLNAHYGLDKPLFVQYVSYLKS
OPPB2_STAAB     ---MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSMEQINATLGLNDSLLVQWWHWMNH
OPPB2_STAAR     ---ILYRLIQMIVVLFVISTLAFILMKLSPGNPVDKILHLDVAQVSTEQINATLGLNDSLLVQWWHWMNH
OPPB2_STAAW     ---MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATLGLNDSLLVQWWHWMNH
OPPB2_STAAS     ---MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATLGLNDSLLVQWWHWMNH
OPPB2_STAAN     ---MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATLGLNDSLLVQWWHWMNH
OPPB2_STAAM     ---MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATLGLNDSLLVQWWHWMNH
OPPB2_STAAC     ---MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATLGLNDSLLVQWWHWMNH
OPPB2_STAA8     ---MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATLGLNDSLLVQWWHWMNH
OPPB2_STAA3     ---MLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATLGLNDSLLVQWWHWMNH
SAPB_SALTY      ---------------------------------------------------------------WVFWFNG
SAPB_SALTI      ---------------------------------------------------------------WVFWFNG
SAPB_ECOLI      ---------------------------------------------------------------WVFWFNG
SAPB_ECO57      ---------------------------------------------------------------WVFWFNG
YEJB_ECOLI      --YLIRRLLLVIPTLWAIITINFFIVQIAPGGPVAGVLPGAGGEGVRAEITHRYGFDKPIHERYFKMLWD
YEJB_ECO57      --YLIRRLLLVIPTLWAIITINFFIVQIAPGGPVAGVLPGAGGEGVRAEITHRYGFDKPIHERYFKMLWD
Y1314_MYCBO     ---------------------CLTSLAFSPLESLMSPRPPQAVIDAKAHDL---GLDRPILARYANWVSH
Y1283_MYCTU     ---------------------CLTSLAFSPLESLMSPRPPQAVIDAKAHDL---GLDRPILARYANWVSH
SAPB_HAEIN      ---------------------------------------------------------------YFHYLGT
OPPB_MYCPN      -----------------VMTIVFFLVNSTGQTPLSATSSKDL-EAVKTQLDA-FGFNDPLIVRYGRYWQT
AMIC_STRR6      ----------------------------------------------------------------------
AMIC_STRPN      ----------------------------------------------------------------------
Y207_BRUME      ----------------------------------------------------------------------
Y1093_BRUSU     ----------------------------------------------------------------------
Y1051_BRUA2     ----------------------------------------------------------------------
Y1032_BRUAB     ----------------------------------------------------------------------
OPPC_MYCPN      ----------------------------------------------------------------------
GSID_ERWCT      ----------------------------------------------------------------------
GSID_SALTY      ----------------------------------------------------------------------
GSID_SALTI      ----------------------------------------------------------------------
GSID_SALPA      ----------------------------------------------------------------------
GSID_SALCH      ----------------------------------------------------------------------
Y3861_BRUME     ----------------------------------------------------------------------
Y3407_BRUSU     ----------------------------------------------------------------------
Y3315_BRUA2     ----------------------------------------------------------------------
Y3094_BRUAB     ----------------------------------------------------------------------
Y2550_BRUO2     ----------------------------------------------------------------------
DPPC_BACSU      ----------------------------------------------------------------------
GSID_ECOLI      ----------------------------------------------------------------------
GSID_SHISS      ----------------------------------------------------------------------
GSID_SHIFL      ----------------------------------------------------------------------
GSID_SHIF8      ----------------------------------------------------------------------
GSID_SHIDS      ----------------------------------------------------------------------
GSID_SHIBS      ----------------------------------------------------------------------
GSID_ECOUT      ----------------------------------------------------------------------
GSID_ECOL6      ----------------------------------------------------------------------
GSID_ECOL5      ----------------------------------------------------------------------
GSID_ECOK1      ----------------------------------------------------------------------
GSID_ECO57      ----------------------------------------------------------------------
Y4TQ_RHISN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALHGDLGTSIATNRPVMSEVSVAVVNSVRLAAVATLIGFTFGCLFGFVAGYLRDSVPDRVASFLSVLGVS
Y209_BRUME      LFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRDSWFDTGVMSLALLGVS
Y1050_BRUA2     LFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRDSWFDTGVMSLALLGVS
Y1031_BRUAB     LFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRDSWFDTGVMSLALLGVS
Y1092_BRUSU     LFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRDSWFDMGVMSLALLGVS
DPPB_BACPF      LATGDLGTSLRTNKPIMEEIWPYLAATIELTIFAMIFAIIIGVNAGIVSAWKQNSWFDYLSMFIALVGVS
NIKB_ECOLI      ALHLDFGISFASQRPVLDDMLNFLPATLELAGAALVLILLTSVPLGIWAARHRDRLPDFAVRFIAFLGVS
DPPB_ECOLI      VMHGDLGISMKSRIPVWEEFVPRFQATLELGVCAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALTGYS
DPPB_ECOL6      VMHGDLGISMKSRIPVWEEFVPRFQATLELGVCAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALTGYS
DPPB_ECO57      VMHGDLGISMKSRIPVWEEFVPRFQATLELGVCAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALTGYS
Y4TP_RHISN      VLRGNFGASVFTGVPVLQLLSQRLEPTISLSVLTMILSVTVGVSFGVLAAWRSGGFVDRALATFSAIGYS
APPB_BACSU      MVQGDFGTSIVRKGTPVSELIMALPNTLLLMLVSTILALMISIPFGVLSAKRPYSKIDYGITFTSFIGLA
DPPB_HAEIN      VIQGDFGASFRTQQPVLTEFFTLFPATAELAFFALFWSLLGGIILGTIAAVKKDSWISHTVTAASLTGYS
GSIC_SALTI      VLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRNRWPDRVGMTLAVTGIS
GSIC_SALCH      VLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRNRWPDRVGMTLAVTGIS
GSIC_SALTY      VLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRNRWPDRLGMTLAVTGIS
GSIC_SALPA      VLQGDFGTSMVSRRPVSEEIASRFLPTLWLTITSMIWAVLFGMAIGIAAAVWRNRWPDRLGMTLAVTGIS
GSIC_ERWCT      ILQGDLGTSMVSKRPVTQEIALRFMPTFWLTVCSMAWAVIFGMAIGIVSAVWRNGWPDRIGMTLAVSGLS
GSIC_ECOL6      AVQGDLGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS
GSIC_SHIDS      AVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS
GSIC_ECOUT      AVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS
GSIC_ECOLI      AVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS
GSIC_ECOL5      AVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS
GSIC_ECOK1      AVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS
GSIC_ECO57      AVQGDFGLSMVSRRPVADEIARRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS
GSIC_SHIF8      AVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS
GSIC_SHIFL      AVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS
GSIC_SHISS      AVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS
GSIC_SHIBS      AVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIAAVWRNRWPDRLSMTIAVSGIS
OPPB_SALTY      LAHGDFGPSFKYKDYTVNDVAASFPVSAKLGAAAFLLAVIIGVSAGVIAALKQNTRWDYTVMGFAMTGVV
OPPB_SHIFL      LAHGDFGPSFKKDYSVNDLVASSFPVSAKLGAAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMTGVV
OPPB_ECOLI      LAHGDFGPSFKKDYSVNDLVASSFPVSAKLGAAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMTGVV
OPPB_ECOL6      LAHGDFGPSFKKDYSVNDLVASSFPVSAKLGAAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMTGVV
OPPB_ECO57      LAHGDFGPSFKKDYSVNDLVASSFPVSAKLGAAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMTGVV
DPPB_BACSU      IITFDFGPSIKKPSDSVNDMERGFPVSFELGMTAIVIAVISGLVLGVIAALRRNGFLDYAAMSLAVLGIS
OPPB_LACLS      AIHGNLGMSYNLKEPVMTVIGHRAINTFWMSLLSVILTYLFAIPMSIVAARNEGKWQDQLWLTYNSITFG
OPPB_LACLA      AIHGNLGMSYNLKEPVMTVIGHRAINTFWMSLLSVILTYLFAIPMSIVAARNEGKWQDQLWLTYNSITFG
OPPB_HAEIN      LSKGDFGPSFKKDQSVNDLIASAFPVSIKLGMVAFAFAVVLGVTAGTLAALNQNSRWDYILMSFSMLGVI
Y3860_BRUME     AVQGNLGHSLQRNETVSGLIASRIGPTXXXXXXXXXXXXXXXXXXXXXSAVRRNSFPDYSFSVLALLGIS
Y2551_BRUO2     AVQGNLGHSLQRNETVSGLIASRIGPTXXXXXXXXXXXXXXXXXXXXXSAVRRNSFPDYSFSVLALLGIS
DDPB_ECOLI      LFHGDLGTSIRTGRPVLEELRIFFPATXXXXXXXXXXXXXXXXXXXXXSAVWRNRWLDHLVRIMAITGIS
Y3408_BRUSU     AVQGNLGHSLQRNETVSGLIASRIGPTXXXXXXXXXXXXXXXXXXXXXSAVRRNSFLDYSFSVLALLGIS
OPPB_BACSU      VAMWDFGPSFKKGQSVNDLISSGFPVSFTXXXXXXXXXXXXXXXXXXXXXXYHNKWQDYTVAILTIFGIS
OPPB2_STAAB     LLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVLSLCISIPLGIIAAKRFHKLSDKVIRVISTLSIS
OPPB2_STAAR     LLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKLSDKVIRVISTLSIS
OPPB2_STAAW     LLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTLSIS
OPPB2_STAAS     LLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTLSIS
OPPB2_STAAN     LLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTLSIS
OPPB2_STAAM     LLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTLSIS
OPPB2_STAAC     LLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTLSIS
OPPB2_STAA8     LLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTLSIS
OPPB2_STAA3     LLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIPLGIIAAKRFHKWTDKVIRVISTLSIS
SAPB_SALTY      LLHWDFGVSSINGQLISEQLKEVFPATMELCILAFGFALMVGIPVGMLAGVTRSKWPDRFISALALLGFS
SAPB_SALTI      LLHWDFGVSSINGQLISEQLKEVFPATMELCILAFGFALMVGIPVGMLAGVTRSKWPDRFISALALLGFS
SAPB_ECOLI      LIHWDFGVSSINGQPIAEQLKEVFPATMELCILAFGFALIVGIPVGMIAGITRHKWQDNLINAIALLGFS
SAPB_ECO57      LIHWDFGVSSINGQPIAEQLKEVFPATMELCILAFGFALIVGIPVGMIAGITRHKWQDNLINAIALLGFS
YEJB_ECOLI      YIRFDFGDSLFRSASVLTLIKDSLPVSITLGLWSTLIIYLVSIPLGIRKAVYNGSRFDVWSSAFIIIGYX
YEJB_ECO57      YIRFDFGDSLFRSASVLTLIKDSLPVSITLGLWSTLIIYLVSIPLGIRKAVYNGSRFDVWSSAFIIIGYX
Y1314_MYCBO     AVRGDFGTTI-TGQPVGTEXXXXXXXXXXXXXXXXXXXTVAGVVIGAWGAIRQYRLSDRVMTTLALLVLS
Y1283_MYCTU     AVRGDFGTTI-TGQPVGTEXXXXXXXXXXXXXXXXXXXTVAGVVIGAWGAIRQYRLSDRVMTTLALLVLS
SAPB_HAEIN      LLQGDFGITYNGGKSLMNLILTVLPPTLELCFITLFLAFIFGLPLGIISAVNSEQVFAKSLQILSYVGLS
OPPB_MYCPN      LFSGSLGTYYSSNQTIDQIVFGRVPNTLYVVLISFFIGSLLGIIFGMISGLFRGKLIDAVINVLVVLFVS
AMIC_STRR6      ----------------------------------------------------------------------
AMIC_STRPN      ----------------------------------------------------------------------
Y207_BRUME      ----------------------------------------------------------------------
Y1093_BRUSU     ----------------------------------------------------------------------
Y1051_BRUA2     ----------------------------------------------------------------------
Y1032_BRUAB     ----------------------------------------------------------------------
OPPC_MYCPN      ----------------------SMAKSLWIAIVVALVSMVFGTIYGAIAGSFVGRAADNIMSRIIEIIDL
GSID_ERWCT      -------------RDIFSRILMGTRISLAAGIFSVLVGMMIGTTLGLLAGYY-EGWADRIIMRICDVLFA
GSID_SALTY      -------------RDIFSRVLVGAQISLAAGVFAVFIGAIIGTVLGLLAGYYEGWWDRFIMRICDVL-FA
GSID_SALTI      -------------RDIFSRVLVGAQISLAAGVFAVFIGAIIGTVLGLLAGYYEGWWDRFIMRICDVL-FA
GSID_SALPA      -------------RDIFSRVLVGAQISLAAGVFAVFIGAIIGTVLGLLAGYYEGWWDRFIMRICDVL-FA
GSID_SALCH      -------------RDIFSRVLVGAQISLAAGVFAVFIGAIIGTVLGLLAGYYEGWWDRFIMRICDVL-FA
Y3861_BRUME     ----------------------------------------------------------------------
Y3407_BRUSU     ----------------------------------------------------------------------
Y3315_BRUA2     ----------------------------------------------------------------------
Y3094_BRUAB     ----------------------------------------------------------------------
Y2550_BRUO2     ----------------------------------------------------------------------
DPPC_BACSU      ----------------------------------------------------------------------
GSID_ECOLI      ----------------------------------------------------------------------
GSID_SHISS      ----------------------------------------------------------------------
GSID_SHIFL      ----------------------------------------------------------------------
GSID_SHIF8      ----------------------------------------------------------------------
GSID_SHIDS      ----------------------------------------------------------------------
GSID_SHIBS      ----------------------------------------------------------------------
GSID_ECOUT      ----------------------------------------------------------------------
GSID_ECOL6      ----------------------------------------------------------------------
GSID_ECOL5      ----------------------------------------------------------------------
GSID_ECOK1      ----------------------------------------------------------------------
GSID_ECO57      ----------------------------------------------------------------------
Y4TQ_RHISN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IPHYWLGMVLVIAFSVLLGWLPATGAGPNGSGDWGWDWEHIQYMLLPAVTMSVIPMGIVARTIRALVAEI
Y209_BRUME      VPSFWLAILAVILFSVTLGWFPSAGYVPFLDSPLGW----LRSLILPASILALFQIGYLARMTRSEMLEV
Y1050_BRUA2     VPSFWLAILAVILFSVTLGWFPSAGYVPFLDSPLGW----LRSLILPASILALFQIGYLARMTRSEMLEV
Y1031_BRUAB     VPSFWLAILAVILFSVTLGWFPSAGYVPFLDSPLGW----LRSLILPASILALFQIGYLARMTRSEMLEV
Y1092_BRUSU     VPSFWLAILAVILFSVTLGWFPSAGYVPFLDSPLGW----LRSLILPASILALFQIGYLARMTRSEMLEV
DPPB_BACPF      MPIFWLALMEQWIFAQELGWLPAFGRNPRDSGQFDKTWESIKHLILPGIALGTIPMAIIARMTRSSMLEV
NIKB_ECOLI      MPNFWLAFLLVMAFSVYLQWLPAMGYG-------GW-----QHIILPAVSIAFMSLAINARLLRASMLDV
DPPB_ECOLI      MPIFWWGMMLIMLVSVHWNLTPVSGRVSDDTAIWGEDGNFIDHMILPAIVLGTIPLAVIVRMTRSSMLEV
DPPB_ECOL6      MPIFWWGMMLIMLVSVHWNLTPVSGRVSDDTAIWGEDGNFIDHMILPAIVLGTIPLAVIVRMTRSSMLEV
DPPB_ECO57      MPIFWWGMMLIMLVSVHWNLTPVSGRVSDDTAIWGEDGNFIDHMILPAIVLGTIPLAVIVRMTRSSMLEV
Y4TP_RHISN      VPVFVIGYILIYFFAIQTRWLPVQGYTSINQGVAPW----FLHLILPTVTLSVPYIAFIARITRGSMLEV
APPB_BACSU      IPNFWFGLILIMVLSVNLGWFP-TGGVETLNTEFNI-FDRIHHLILPAFVLATADMAGLTRYTRSNMLDV
DPPB_HAEIN      MPIFWWGLILILYVSPQLG-LPQGGRTPTGSGVSGAFENAVKSLILPAIVLGTVPLAIITRMTRSAMLEV
GSIC_SALTI      FPAFALGMLLMQIFSVDLGWLPTVGAD---------SWQH---YILPSLTLGAAVASVMARFTRSSFVDV
GSIC_SALCH      FPAFALGMLLMQIFSVDLGWLPTVGAD---------SWQH---YILPSLTLGAAVASVMARFTRSSFVDV
GSIC_SALTY      FPAFALGMLLMQIFSVDLGWLPTVGAD---------SWQH---YILPSLTLGAAVASVMARFTRSSFVDV
GSIC_SALPA      FPAFALGMLLMQIFSVDLGWLPTVGAD---------SWQH---YILPSLTLGAAVASVMARFTRSSFVDV
GSIC_ERWCT      FPAFALGMLLMQIFSVELGWLPTVGAD---------TWLH---YILPSLTLGAAVAAVMARFTRASFVDV
GSIC_ECOL6      FPAFALGMLLIQVFSVELGWLPTVGAD---------SWQH---YILPSLTLGAAVAAVMARFTRASFVDV
GSIC_SHIDS      FPAFALGMLLIQVFSVELGWLPTVGAD---------SWQH---YILPSLTLGAAVAAVMARFTRASFVDV
GSIC_ECOUT      FPAFALGMLLIQVFSVELGWLPTVGAD---------SWQH---YILPSLTLGAAVAAVMARFTRASFVDV
GSIC_ECOLI      FPAFALGMLLIQVFSVELGWLPTVGAD---------SWQH---YILPSLTLGAAVAAVMARFTRASFVDV
GSIC_ECOL5      FPAFALGMLLIQVFSVELGWLPTVGAD---------SWQH---YILPSLTLGAAVAAVMARFTRASFVDV
GSIC_ECOK1      FPAFALGMLLIQVFSVELGWLPTVGAD---------SWQH---YILPSLTLGAAVAAVMARFTRASFVDV
GSIC_ECO57      FPAFALGMLLIQVFSVELGWLPTVGAD---------SWQH---YILPSLTLGAAVAAVMARFTRASFVDV
GSIC_SHIF8      FPAFALGMFLIQVFSVELGWLPTVGAD---------SWQH---YILPSLTLGAAVAAVMARFTRASFVDV
GSIC_SHIFL      FPAFALGMFLIQVFSVELGWLPTVGAD---------SWQH---YILPSLTLGAAVAAVMARFTRASFVDV
GSIC_SHISS      FPAFALGMLLIQVFSVELGWLPTVGAD---------SWQH---YILPSLTLGAAVAAVMARFTRASFVDV
GSIC_SHIBS      FPAFALGMLLIQVFSVELGWLPTVGAD---------SWQH---YILSSLTLGAAVAAVMARFTRASFVDV
OPPB_SALTY      IPSFVVAPLLVMVFAITLQWLPGGG----------WNGGALKFMILPMVALSLAYIASIARITRGSMIEV
OPPB_SHIFL      IPSFVVAPLLVMIFAIILHWLPGGG----------WNGGALKFMILPMVALSLAYIASIARITRGSMIEV
OPPB_ECOLI      IPSFVVAPLLVMIFAIILHWLPGGG----------WNGGALKFMILPMVALSLAYIASIARITRGSMIEV
OPPB_ECOL6      IPSFVVAPLLVMIFAIILHWLPGGG----------WNGGALKFMILPMVALSLAYIASIARITRGSMIEV
OPPB_ECO57      IPSFVVAPLLVMIFAIILHWLPGGG----------WNGGALKFMILPMVALSLAYIASIARITRGSMIEV
DPPB_BACSU      IPNFILATLLIQQFAVNLKLFPAA------------TWTSPIHMVLPTAALAVGPMAIIARLTRSSMVEV
OPPB_LACLS      IPPYVFYLLIIFIFGYSLNWFPTGGVSPDAMGIIPVFFSKIYHMILPAFSLAVFGTVGIFTYFRSGILDE
OPPB_LACLA      IPPYVFYLLIIFIFGYSLNWFPTGGVSPDAMGIIPVFFSKIYHMILPAFSLAVFGTVGIFTYFRSGILDE
OPPB_HAEIN      MPSFVFAPVLVLIFAIYLGWLPAGG----------WNGGTAMYMILPVASLTIAYVAGIARIMRGSMIEV
Y3860_BRUME     SPAFLTALLGLYVFSVRLKWAPSGG------------------MLTPATDFSIPDXALIMRYMRSSMLET
Y2551_BRUO2     SPAFLTALLGLYVFSVRLKWAPSGG------------------MLTPATDFSIPDXALIMRYMRSSMLET
DDPB_ECOLI      TPAFWLGLGVIVLFYGHLQILPGGGALLEGNGEVFFN--ALQHLILPALTLAFVHLGIVARQIRSAMLEQ
Y3408_BRUSU     SPAFLTALLGLYVFSVRLKWAPSGG------------------MLTPATDFSIPDXALIMRYMRSSMLET
OPPB_BACSU      VPSFIMAAVLQYVFSMKLGLFPVAG------------WDSWAYTFLPSIALASMPMAFIARLSRSSMIEV
OPPB2_STAAB     LPAFFIGIILLFIVTNLMNI----------------DSVILSQFILPVITLSLGMCAYIIRLVRSNLLML
OPPB2_STAAR     LPAFFIGIILLFIVTNLMNI----------------DSVILSQFILPVLTLSLGMCAYIIRLVRSNLLIL
OPPB2_STAAW     LPAFFIGIILLFIVTNLMNI----------------DSVILSQFILPVITLSLGMCAYIIRLVRSNLLML
OPPB2_STAAS     LPAFFIGIILLFIVTNLMNI----------------DSVILSQFILPVITLSLGMCAYIIRLVRSNLLML
OPPB2_STAAN     LPAFFIGIILLFIVTNLMNI----------------DSVILSQFILPVITLSLGMCAYIIRLVRSNLLML
OPPB2_STAAM     LPAFFIGIILLFIVTNLMNI----------------DSVILSQFILPVITLSLGMCAYIIRLVRSNLLML
OPPB2_STAAC     LPAFFIGIILLFIVTNLMNI----------------DSVILSQFILPVITLSLGMCAYIIRLVRSNLLML
OPPB2_STAA8     LPAFFIGIILLFIVTNLMNI----------------DSVILSQFILPVITLSLGMCAYIIRLVRSNLLML
OPPB2_STAA3     LPAFFIGIILLFIVTNLMNI----------------DSVILSQFILPVITLSLGMCAYIIRLVRSNLLML
SAPB_SALTY      IPVXXXXXXXXXRFDLLYEVKPVTGFAIIDASDSPWRDEAIRHMVLPVLTLSVAPTTEVIRLMRISTIEV
SAPB_SALTI      IPVXXXXXXXXXRFDLLYEVKPVTGFAIIDASDSPWRDEAIRHMVLPVLTLSVAPTTEVIRLMRISTIEV
SAPB_ECOLI      IPVXXXXXXXXXXFDLLYEVKPITGFALIDASDSPWRDEMIRHMILPVITLSVAPTTEVIRLMRISTIEV
SAPB_ECO57      IPVXXXXXXXXXXFDLLYEVKPITGFALIDASDSPWRDEMIRHMILPVITLSVAPTTEVIRLMRISTIEV
YEJB_ECOLI      XXXXXXXXXXXXXXGSYFDLFPLRGLVSANFDSLPWYQDYLWHITLPVLATVIGGFAALTMLTKNSFLDE
YEJB_ECO57      XXXXXXXXXXXXXXGSYFDLFPLRGLVSANFDSLPWYQDYLWHITLPVLATVIGGFAALTMLTKNSFLDE
Y1314_MYCBO     TPTFVVANLLILGWAVGIQLFDYTGETSPGVAGGVWDGDRLQHXXXXXXXXXXXXXXGFSRYQRNAMLDV
Y1283_MYCTU     TPTFVVANLLILGWAVGIQLFDYTGETSPGVAGGVWDGDRLQHXXXXXXXXXXXXXXGFSRYQRNAMLDV
SAPB_HAEIN      IPIFWLAPILLYVAALSHWEIAAIGTGFPVIDMWFMEVPYLQHLALPTLVLCILPTMEIIRIIHQRAEYI
OPPB_MYCPN      IPSF----VVXXXXXXXXXXFRLPPRFIXXXXXXXXXXXXXXXSIIPILSLVFYTSAAFTYRVRNEVVEV
AMIC_STRR6      -----------------------------GAGDW-------RSYVLPAVILGLLGAPGTAIWIRRYMIDL
AMIC_STRPN      -----------------------------GAGDW-------RSYVLPAVILGLLGAPGTAIWIRRYMIDL
Y207_BRUME      ---------------------------------------HLSSVII-ALTSAYIPR--CARIVRASALVL
Y1093_BRUSU     ---------------------------------------HLSSVII-ALTSAYIPR--CARIVRASALVL
Y1051_BRUA2     ---------------------------------------HLSSVII-ALTSAYIPR--CARIVRASALVL
Y1032_BRUAB     ---------------------------------------HLSSVII-ALTSAYIPR--CARIVRASALVL
OPPC_MYCPN      VP------------SIL--WIIVLGATFRFGGVKQFDDSVVIFTLI------FVFWTWPAATTRIYILKN
GSID_ERWCT      FP----GILLAIAVVAIM-----------GSG-----------MANVVVAVAIFSIPAFARLVRGNTLVL
GSID_SALTY      FP----GILLAIAVVAVLG---------SGIAN-----------VIVAVAIFSIPA--FARLVRGNTLVL
GSID_SALTI      FP----GILLAIAVVAVLG---------SGIAN-----------VIVAVAIFSIPA--FARLVRGNTLVL
GSID_SALPA      FP----GILLAIAVVAVLG---------SGIAN-----------VIVAVAIFSIPA--FARLVRGNTLVL
GSID_SALCH      FP----GILLAIAVVAVLG---------SGIAN-----------VIVAVAIFSIPA--FARLVRGNTLVL
Y3861_BRUME     -----------------------------GSGIWS-----------TVVVIALLSWPVLSRMIRAXXXXX
Y3407_BRUSU     -----------------------------GSGIWS-----------TVVVIALLSWPVLSRMIRAXXXXX
Y3315_BRUA2     -----------------------------GSGIWS-----------TVVVIALLSWPVLSRMIRAXXXXX
Y3094_BRUAB     -----------------------------GSGIWS-----------TVVVIALLSWPVLSRMIRAXXXXX
Y2550_BRUO2     -----------------------------GSGIWS-----------TVVVIALLSWPVLSRMIRAXXXXX
DPPC_BACSU      ----------------------------------------------------------MARIVRGQVLQI
GSID_ECOLI      ------------------------------------------------IAVAIFSIPAFARLVRGNTLVL
GSID_SHISS      ------------------------------------------------IAVAIFSIPAFARLVRGNTLVL
GSID_SHIFL      ------------------------------------------------IAVAIFSIPAFARLVRGNTLVL
GSID_SHIF8      ------------------------------------------------IAVAIFSIPAFARLVRGNTLVL
GSID_SHIDS      ------------------------------------------------IAVAIFSIPAFARLVRGNTLVL
GSID_SHIBS      ------------------------------------------------IAVAIFSIPAFARLVRGNTLVL
GSID_ECOUT      ------------------------------------------------IAVAIFSIPAFARLVRGNTLVL
GSID_ECOL6      ------------------------------------------------IAVAIFSIPAFARLVRGNTLVL
GSID_ECOL5      ------------------------------------------------IAVAIFSIPAFARLVRGNTLVL
GSID_ECOK1      ------------------------------------------------IAVAIFSIPAFARLVRGNTLVL
GSID_ECO57      ------------------------------------------------IAVAIFSIPAFARLVRGNTLVL
Y4TQ_RHISN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LSNEFIAGLRARGLSDLAVFRHVVKNVTPTALSVMGLQLGYLLGGSILIETVFSWPGTGFLLNSAIFQRD
Y209_BRUME      MDQDYIRTARSKGVSEYSVLTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQAILARD
Y1050_BRUA2     MDQDYIRTARSKGVSEYSVLTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQAILARD
Y1031_BRUAB     MDQDYIRTARSKGVSEYSVLTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQAILARD
Y1092_BRUSU     MDQDYIRTARSKGVSEYSVLTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQAILARD
DPPB_BACPF      LRSDYIRTVNAKGSGQVVIYKHALKNALIPVLTVVGLQTGNLLGGAILTETIFSWPGIGRYIFEAINYRD
NIKB_ECOLI      AGQRHVTWARLRGLNDKQTRRHILRNASLPMITAVGMHIGELIGGTMIIENIFAWPGVGRYAVSAIFNRD
DPPB_ECOLI      LGEDYIRTARAKGLTRMRVIIHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQRRD
DPPB_ECOL6      LGEDYIRTARAKGLTRMRVIIHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQRRD
DPPB_ECO57      LGEDYIRTARAKGLTRMRVIIHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQRRD
Y4TP_RHISN      LSEDYMRTAAAKGASPFALFHHALKNAGVPILTVIGISFAYMIGGVVLTETVFNVPGIGRLVVDAIKNRD
APPB_BACSU      LNQDYIRTARAKGFKENRVFKHGLRNALLPVITIFGLMIPSFIGGSVVVEQIFTWPGLGKLFVDSAFQRD
DPPB_HAEIN      LGEDYIRTAKAKGLSTRIVIVHALRNALIPVVTVVGLIVAQLLSGAVLTETIFSWPGIGKWIIDAIQARD
GSIC_SALTI      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVDMRD
GSIC_SALCH      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVDMRD
GSIC_SALTY      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVDMRD
GSIC_SALPA      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVDMRD
GSIC_ERWCT      LQEDYMRTARAKGVRELVVLKHGLRNALIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
GSIC_ECOL6      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
GSIC_SHIDS      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
GSIC_ECOUT      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
GSIC_ECOLI      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
GSIC_ECOL5      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
GSIC_ECOK1      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
GSIC_ECO57      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
GSIC_SHIF8      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
GSIC_SHIFL      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
GSIC_SHISS      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
GSIC_SHIBS      LSEDYMRTARAKGVSETVVLKHGLRNAMIPVVTMMXXXXXXXXXXSIVVEKVFNWPGLGRLLVDSVEMRD
OPPB_SALTY      LHSNFIRTARAKGLPRRIIFRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNGALNRD
OPPB_SHIFL      LHSNFIRTARAKGLPRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNGALNRD
OPPB_ECOLI      LHSNFIRTARAKGLPRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNGALNRD
OPPB_ECOL6      LHSNFIRTARAKGLPRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNGALNRD
OPPB_ECO57      LHSNFIRTARAKGLPRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNGALNRD
DPPB_BACSU      LTQDYIRTAKAKGLSPFKIIKHALRNALMPVITVLGTLVASILTGSFVIEKIFAIPGMGKYFVESINQRD
OPPB_LACLS      QTQDYVRTARAKGVKEKVIFRHILRNASLPIASNFGFVITGLLGGAIFAETIFGYPGLGQLFITSISGRD
OPPB_LACLA      QTQDYVRTARAKGVKEKVIFRHILRNASLPIASNFGFVITGLLGGAIFAETIFGYPGLGQLFITSISGRD
OPPB_HAEIN      LHSNFIRTAKAKGLSSRIILKHALRPALLPVITYLGPAFVGIITGSMVIESVFGLPGMGLLFVNGALNRD
Y3860_BRUME     LNQDYVRTARAKGVREFVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLINAVETRD
Y2551_BRUO2     LNQDYVRTARAKGVREFVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLINAVETRD
DDPB_ECOLI      LSEDYIRTARASGLPGYIVLCYALPNALIPSITXXXXXXXXXXXXXXXTETVFAWPGMGAWVVTSIQALD
Y3408_BRUSU     LNQDYVRTARAKGVREFVVVKHTLRNAMLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLINAVETRD
OPPB_BACSU      LNSDYIRTAKAKGLSRPAVVRHAIRNALLPVVTYMGPMAAQVLTGSFIIETIFGIPGLGAHFVNSITNRD
OPPB2_STAAB     LQSNIVQASRLRGMNERYILIHLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRD
OPPB2_STAAR     LKSNIVQASRLRGMNERYILIHLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRD
OPPB2_STAAW     LQSNIVQASRLRGMNERYILIHLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRD
OPPB2_STAAS     LQSNIVQASRLRGMNERYILIHLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRD
OPPB2_STAAN     LQSNIVQASRLRGMNERYILIHLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRD
OPPB2_STAAM     LQSNIVQASRLRGMNERYILIHLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRD
OPPB2_STAAC     LQSNIVQASRLRGMNERYILIHLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRD
OPPB2_STAA8     LQSNIVQASRLRGMNERYILIHLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRD
OPPB2_STAA3     LQSNIVQASRLRGMNERYILIHLLKPTXXXXXXXXXXXXXXXXXXTVVIENLFDIPGIGYLLMDSIKSRD
SAPB_SALTY      YDQNYVKAAATRGLSRFTILRHVLHNALPPVIPRLGLQFSTMLTLAMITEMVFSWPGLGRWLIHAIRQQD
SAPB_SALTI      YDQNYVKAAATRGLSRFTILRHVLHNALPPVIPRLGLQFSTMLTLAMITEMVFSWPGLGRWLIHAIRQQD
SAPB_ECOLI      YDQNYVKAAATRGLSRFTILRHVLHNALPPVIPRLGLQFSTMLTLAMITEMVFSWPGLGRWLINAIRQQD
SAPB_ECO57      YDQNYVKAAATRGLSRFTILRHVLHNALPPVIPRLGLQFSTMLTLAMITEMVFSWPGLGRWLINAIRQQD
YEJB_ECOLI      VRKQYVVTARAKGVSEKNIWKHVFRNAM--LLVIAGFPATFIFTGSLLIEVMFSLNGLGLLGYEATVSRD
YEJB_ECO57      VRKQYVVTARAKGVSEKNIWKHVFRNAM--LLVIAGFPATFIFTGSLLIEVMFSLNGLGLLGYEATVSRD
Y1314_MYCBO     LGQDFIRTARAKGLTRR---RALLKHGLRTALIPMATLFAYLVTGAVFVEKIFGWHGMGEWMVRGISTQD
Y1283_MYCTU     LGQDFIRTARAKGLTRR---RALLKHGLRTALIPMATLFAYLVTGAVFVEKIFGWHGMGEWMVRGISTQD
SAPB_HAEIN      LNQNFSKVATTRGWSKWKILQYVFRNTFPLLVPQVPRVFTLVLTQCMLVETALGWPGIGRWLINAVNEQD
OPPB_MYCPN      MNQDYIKTARSKGLSTFAVLYHIFRNSIIPSVPLFVXXXXXXXXXXXXXXXLFGVQGVSRILIDSVQSNE
AMIC_STRR6      QSQDFVRFARAKGLSEKEISKHIFKNAMVPLVSXXXXXXXXXXXXXTLTETVFAFPGMGKMLIDSVKASN
AMIC_STRPN      QSQDFVRFARAKGLSEKEISKHIFKNAMVPLVSXXXXXXXXXXXXXTLTETVFAFPGMGKMLIDSVKASN
Y207_BRUME      RETDYVDAARLAGASDLRI---ITRHILPNCLAPLLVTLTFVFAYAILAEATLSFLGIGTSWGSIVAQRD
Y1093_BRUSU     RETDYVDAARLAGASDLRI---ITRHILPNCLAPLLVTLTFVFAYAILAEATLSFLGIGTSWGSIVAQRD
Y1051_BRUA2     RETDYVDAARLAGASDLRI---ITRHILPNCLAPLLVTLTFVFAYAILAEATLSFLGIGTSWGSIVAQRD
Y1032_BRUAB     RETDYVDAARLAGASDLRI---ITRHILPNCLAPLLVTLTFVFAYAILAEATLSFLGIGTSWGSIVAQRD
OPPC_MYCPN      KDTEYIQAARTLGAKQIRIFVHMLPVVTGRLVSLIPAVIGYEASLVFLGLKPATEVGLGALLNQVTSSGN
GSID_ERWCT      KQLTYIESARSMGANDWTIFRHIL----PGSVSSIVVFFSMRIGMSIITAASLSFPEWGAMLNEARSDMV
GSID_SALTY      KQQTFIESARSIGASDTTIFSHILPGTVSSIVVFFTMRIGIISAASLSFLGLGAQPPTGAMLNEA--RAD
GSID_SALTI      KQQTFIESARSIGASDTTIFSHILPGTVSSIVVFFTMRIGIISAASLSFLGLGAQPPTGAMLNEA--RAD
GSID_SALPA      KQQTFIESARSIGASDTTIFSHILPGTVSSIVVFFTMRIGIISAASLSFLGLGAQPPTGAMLNEA--RAD
GSID_SALCH      KQQTFIESARSIGASDTTIFSHILPGTVSSIVVFFTMRIGIISAASLSFLGLGAQPPTGAMLNEA--RAD
Y3861_BRUME     XXXXFVMASRGMGAGGHLLFRHGL----PNSIDILVVYATLQVANAILLEAGLSFLGLGVMLNAAAVLEQ
Y3407_BRUSU     XXXXFVMASRGMGAGGHLLFRHGL----PNSIDILVVYATLQVANAILLEAGLSFLGLGVMLNAAAVLEQ
Y3315_BRUA2     XXXXFVMASRGMGAGGHLLFRHGL----PNSIDILVVYATLQVANAILLEAGLSFLGLGVMLNAAAVLEQ
Y3094_BRUAB     XXXXFVMASRGMGAGGHLLFRHGL----PNSIDILVVYATLQVANAILLEAGLSFLGLGVMLNAAAVLEQ
Y2550_BRUO2     XXXXFVMASRGMGAGGHLLFRHGL----PNSIDILVVYATLQVANAILLEAGLSFLGLGVMLNAAAVLEQ
DPPC_BACSU      KNYEYVLASKTFGAK---TFRIIRKNLLPNTMGAIIVQMTLTVPAAIFAESFLSFLGLGFASWGVMANDG
GSID_ECOLI      KQQTFIESARSIGASDMTV---LLRHILPGTVSSIVVFFTMRIGTSIISAASLSFPEWGAMLNEARADMV
GSID_SHISS      KQQTFIESARSIGASDMTI---LLRHILPGTVSSIVVFFTMRIGTSIISAASLSFPEWGAMLNEARADMV
GSID_SHIFL      KQQTFIESARSIGASDMTI---LLRHILPGTVSSIVVFFTMRIGTSIISAASLSFPEWGAMLNEARADMV
GSID_SHIF8      KQQTFIESARSIGASDMTI---LLRHILPGTVSSIVVFFTMRIGTSIISAASLSFPEWGAMLNEARADMV
GSID_SHIDS      KQQTFIESARSIGASDMTV---LLRHILPGTVSSIVVFFTMRIGTSIISAASLSFPEWGAMLDEARADMV
GSID_SHIBS      KQQTFIESARSIGASDMTI---LLRHILPGTVSSIVVFFTMRIGTSIISAASLSFPEWGAMLNEARADMV
GSID_ECOUT      KQQTFIESARSIGASDMTI---LLRHILPGTVSSIVVFFTMRIGTSIISAASLSFPEWGAMLNEARADMV
GSID_ECOL6      KQQTFIESARSIGASDMTI---LLRHILPGTVSSIVVFFTMRIGTSIISAASLSFPEWGAMLNEARADMV
GSID_ECOL5      KQQTFIESARSIGASDMTI---LLRHILPGTVSSIVVFFTMRIGTSIISAASLSFPEWGAMLNEARADMV
GSID_ECOK1      KQQTFIESARSIGASDMTI---LLRHILPGTVSSIVVFFTMRIGTSIISAASLSFPEWGAMLNEARADMV
GSID_ECO57      KQQTFIESARSIGASDMTI---LLRHILPGTVSSIVVFFTMRIGTSIISAASLSFPEWGAMLNEARADMV
Y4TQ_RHISN      ------------------------RHILPSTIPPLMVQSATVCASAIMTEAGLSFIGVGMIANSRLFLAI


                         .         *         .         .         .         .         +:350
query           FPLLQGTILVLAVFFVMLNLLVDALQTLFDPRIQRN
Y209_BRUME      LPVVQGTMLFLGFLFVAINVLVDILYTIADPRVR--
Y1050_BRUA2     LPVVQGTMLFLGFLFVAINVLVDILYTIADPRVR--
Y1031_BRUAB     LPVVQGTMLFLGFLFVAINVLVDILYTIADPRVR--
Y1092_BRUSU     LPVVQGTMLFLGFLFVAINVLVDILYTIADPRV---
DPPB_BACPF      YPVIQSGILVVATIFVLINLFVDLLYSYIDPRIK--
NIKB_ECOLI      YPVIQCFTLMMVVVFVVCNLIVDLLNAALDPRIRRH
DPPB_ECOLI      YPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIR--
DPPB_ECOL6      YPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIR--
DPPB_ECO57      YPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIR--
Y4TP_RHISN      YPIIQTVLVLISGLYVLINLLVDLAYTLIDPRIR--
APPB_BACSU      YPVIMAMTVISAVLVVVGNLIADILYAIVDPRIE--
DPPB_HAEIN      YPVLQGSVLIIATIIIVVNLTVDLLYGVVNPRIR--
GSIC_SALTI      YPVIQAEVLLFSLEFILINLVVDVLYAAINPAIR--
GSIC_SALCH      YPVIQAEVLLFSLEFILINLVVDVLYAAINPAIR--
GSIC_SALTY      YPVIQAEVLLFSLEFILINLVVDVLYAAINPAIR--
GSIC_SALPA      YPVIQAEVLLFSLEFILINLVVDVLYAAINPAIR--
GSIC_ERWCT      YPVIQAEVLLFSLEFILINLLVDMLYAAINPAIR--
GSIC_ECOL6      YPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_SHIDS      YPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_ECOUT      YPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_ECOLI      YPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_ECOL5      YPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_ECOK1      YPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_ECO57      YPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_SHIF8      YPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_SHIFL      YPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_SHISS      YPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
GSIC_SHIBS      YPVIQAXXXXXXXXXXXXXXVVDVLYAAINPAIR--
OPPB_SALTY      YSLVLSLTILVGALTILFNAIVDVLYAVIDPKIR--
OPPB_SHIFL      YSLVLSLTILVGALTILFNAIVDVLYAVIDPKIR--
OPPB_ECOLI      YSLVLSLTILVGALTILFNAIVDVLYAVIDPKIR--
OPPB_ECOL6      YSLVLSLTILVGALTILFNAIVDVLYAVIDPKIR--
OPPB_ECO57      YSLVLSLTILVGALTILFNAIVDVLYAVIDPKIR--
DPPB_BACSU      YPVIMGTTVFYSVILIIMLFLVDLAYGLLDPRIK--
OPPB_LACLS      YSMITAXXXXXXXXXXXXXXXSDIIMAMVDPRIR--
OPPB_LACLA      YSMITAXXXXXXXXXXXXXXXSDIIMAMVDPRIR--
OPPB_HAEIN      YSLVLSLTILVGTLTILFNAIVDILYAIIDPKIR--
Y3860_BRUME     YPVIMGATLVIGACVIIVNILTDLAYAVIDPRIK--
Y2551_BRUO2     YPVIMGATLVIGACVIIVNILTDLAYAVIDPRIK--
DDPB_ECOLI      FPAVMGFAVVVSFAXXXXXXXXXXXXXWIDPRIGR-
Y3408_BRUSU     YPVIMGATLVIGACVIIVNILTDLAYAVIDPRIK--
OPPB_BACSU      YTVIMGVTXXXXXXXXXXXXXXXXXYGIIDPRIK--
OPPB2_STAAB     YPVIQGCVLFIGFFVVIINTIADLLTLLLDPK----
OPPB2_STAAR     YPVIQGCVLFIGFFVVIINTIADLLTLLLDPK----
OPPB2_STAAW     YPVIQGCVLFIGFFVVIINTIADLLTLLLDPK----
OPPB2_STAAS     YPVIQGCVLFIGFFVVIINTIADLLTLLLDPK----
OPPB2_STAAN     YPVIQGCVLFIGFFVVIINTIADLLTLLLDPK----
OPPB2_STAAM     YPVIQGCVLFIGFFVVIINTIADLLTLLLDPK----
OPPB2_STAAC     YPVIQGCVLFIGFFVVIINTIADLLTLLLDPK----
OPPB2_STAA8     YPVIQGCVLFIGFFVVIINTIADLLTLLLDPK----
OPPB2_STAA3     YPVIQGCVLFIGFFVVIINTIADLLTLLLDPK----
SAPB_SALTY      YAAISAGVMVIGSLVIVVNVISDILGAMANP-----
SAPB_SALTI      YAAISAGVMVIGSLVIVVNVISDILGAMANP-----
SAPB_ECOLI      YAAISAGVMVCGSLVIIVNVISDILGAMANP-----
SAPB_ECO57      YAAISAGVMVCGSLVIIVNVISDILGAMANP-----
YEJB_ECOLI      YPVMFGTLYIFTLIGLLLNIVSDISYTLVDPRI---
YEJB_ECO57      YPVMFGTLYIFTLIGLLLNIVSDISYTLVDPRI---
Y1314_MYCBO     TNIVAAITVFSGAVVLLAGLLSDVIYAALDPRVR--
Y1283_MYCTU     TNIVAAITVFSGAVVLLAGLLSDVIYAALDPRVR--
SAPB_HAEIN      Y-----------------------------------
OPPB_MYCPN      TNLVMFNIMFIQGIPLLASVFIELIYVLVDPRIR--
AMIC_STRR6      NSMVVGLVFIFTCISIFSRLLGDIWMTIIDPRIK--
AMIC_STRPN      NSMVVGLVFIFTCISIFSRLLGDIWMTIIDPRIK--
Y207_BRUME      YSVDAWWIMLITISALAINLIGDGLRDVLDPRLK--
Y1093_BRUSU     YSVDAWWIMLITISALAINLIGDGLRDVLDPRLK--
Y1051_BRUA2     YSVDAWWIMLITISALAINLIGDGLRDVLDPRLK--
Y1032_BRUAB     YSVDAWWIMLITISALAINLIGDGLRDVLDPRLK--
OPPC_MYCPN      IALITSSIVSFAILTVSTRVFANALNDAIDPRVIR-
GSID_ERWCT      IAPHVAIFPSLAIFLTVLNLLGDGLRDALDPKLK--
GSID_SALTY      MVIAPHVALAVAIFLTVLNLLGDGLRDALDPKIK--
GSID_SALTI      MVIAPHVALAVAIFLTVLNLLGDGLRDALDPKIK--
GSID_SALPA      MVIAPHVALAVAIFLTVLNLLGDGLRDALDPKIK--
GSID_SALCH      MVIAPHVALAVAIFLTVLNLLGDGLRDALDPKIK--
Y3861_BRUME     FPLFPGGALVLAV--LAINFIGDGLRDAFDPRAELN
Y3407_BRUSU     FPLFPGGALVLAV--LAINFIGDGLRDAFDPRAELN
Y3315_BRUA2     FPLFPGGALVLAV--LAINFIGDGLRDAFDPRAELN
Y3094_BRUAB     FPLFPGGALVLAV--LAINFIGDGLRDAFDPRAELN
Y2550_BRUO2     FPLFPGGALVLAV--LAINFIGDGLRDAFDPRAELN
DPPC_BACSU      LPILSGWRLFFPAFFISLNVLGDGLQDALDPKLRR-
GSID_ECOLI      IAPHVAVFPALAIFLTVLNLLGDGLRDALDPKIK--
GSID_SHISS      IAPHVAVFPALAIFLTVLNLLGDGLRDALDPKIK--
GSID_SHIFL      IAPHVAVFPALAIFLTVLNLLGDGLRDALDPKIK--
GSID_SHIF8      IAPHVAVFPALAIFLTVLNLLGDGLRDALDPKIK--
GSID_SHIDS      IAPHVAVFPVLAIFLTVLNLLGDGLRDALDPKIK--
GSID_SHIBS      IAPHVAVFPALAIFLTVLNLLGDGLRDALDPKIK--
GSID_ECOUT      IAPHVAVFPALAIFLTVLNLLGDGLRDALDPKIK--
GSID_ECOL6      IAPHVAVFPALAIFLTVLNLLGDGLRDALDPKIK--
GSID_ECOL5      IAPHVAVFPALAIFLTVLNLLGDGLRDALDPKIK--
GSID_ECOK1      IAPHVAVFPALAIFLTVLNLLGDGLRDALDPKIK--
GSID_ECO57      IAPHVAVFPALAIFLTVLNLLGDGLRDALDPKIK--
Y4TQ_RHISN      APLIFAPGLCLAVTVLAVNLLGDGLRDMFDPRSKR-