[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF08950.1

[Show Plain Result]


## Summary of Sequence Search
    1::114
    1::91      1e-52 100%   91 aa  FETP_RALME RecName: Full=Probable Fe(2+)-trafficking protein;
    1::91      3e-49  91%   91 aa  FETP_RALPJ RecName: Full=Probable Fe(2+)-trafficking protein;
    1::91      4e-49  91%   91 aa  FETP_RALSO RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      3e-47  91%   90 aa  FETP_RALEJ RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      7e-47  92%   90 aa  FETP_CUPTR RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-46  92%   90 aa  FETP_RALEH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      9e-44  84%   91 aa  FETP_BURTA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-43  85%   91 aa  FETP_BURM1 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-43  85%   91 aa  FETP_BURVG RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-43  85%   91 aa  FETP_BURS3 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-43  85%   91 aa  FETP_BURCJ RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-43  85%   91 aa  FETP_BURCH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-43  85%   91 aa  FETP_BURCC RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-43  85%   91 aa  FETP_BURCA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      5e-43  84%   91 aa  FETP_BURA4 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      1e-42  83%   91 aa  FETP_POLNS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-42  82%   91 aa  FETP_BURPS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-42  82%   91 aa  FETP_BURP6 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-42  82%   91 aa  FETP_BURP1 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-42  82%   91 aa  FETP_BURP0 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-42  82%   91 aa  FETP_BURMS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-42  82%   91 aa  FETP_BURMA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-42  82%   91 aa  FETP_BURM9 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-42  82%   91 aa  FETP_BURM7 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-42  83%   91 aa  FETP_BURCM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-41  81%   91 aa  FETP_BURP8 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      7e-41  84%   90 aa  FETP_POLSQ RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      7e-41  79%   90 aa  FETP_BURXL RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      1e-40  79%   91 aa  FETP_BURPP RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      2e-40  78%   90 aa  FETP_VEREI RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      6e-40  78%   90 aa  FETP_VARPS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-39  77%   90 aa  FETP_JANMA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      2e-39  77%   90 aa  FETP_DIAST RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      2e-39  77%   90 aa  FETP_ACISJ RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      3e-39  76%   90 aa  FETP_RHOFD RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      7e-39  76%   90 aa  FETP_LARHH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      9e-39  74%   90 aa  FETP_POLSJ RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      9e-39  76%   90 aa  FETP_HERAR RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      4e-38  74%   93 aa  FETP_POLNA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-37  74%   88 aa  FETP_NEIMF RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-37  74%   88 aa  FETP_NEIMB RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-37  74%   88 aa  FETP_NEIMA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-37  74%   88 aa  FETP_NEIM0 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-37  74%   88 aa  FETP_NEIG1 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::89      5e-37  75%   91 aa  FETP_THIDA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      8e-37  71%   90 aa  FETP_LEPCP RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-36  73%   91 aa  FETP_METPP RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-36  70%   90 aa  FETP_CHRVO RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      2e-35  71%   90 aa  FETP_ACIAC RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      6e-35  69%   90 aa  FETP_NITEU RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      8e-35  69%   90 aa  FETP_AZOSB RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-34  69%   90 aa  FETP_NITEC RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      4e-34  67%   90 aa  FETP_DECAR RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-33  66%   90 aa  FETP_NITMU RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      3e-33  67%   90 aa  FETP_DELAS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-32  68%   93 aa  FETP_ACIF5 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-32  68%   93 aa  FETP_ACIF2 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      4e-32  62%   90 aa  FETP_BORPE RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      4e-32  62%   90 aa  FETP_BORPA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      4e-32  62%   90 aa  FETP_BORBR RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-31  60%   90 aa  FETP_NITOC RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      4e-31  60%   90 aa  FETP_BORA1 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      7e-31  62%   90 aa  FETP_THISH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-29  61%   88 aa  FETP_ALHEH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::85      2e-27  58%   89 aa  FETP_LEGPL RecName: Full=Probable Fe(2+)-trafficking protein;
    1::85      6e-27  56%   89 aa  FETP_LEGPH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::85      6e-27  56%   89 aa  FETP_LEGPC RecName: Full=Probable Fe(2+)-trafficking protein;
    1::85      6e-27  56%   89 aa  FETP_LEGPA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::83      1e-26  59%   90 aa  FETP_HALHL RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-26  57%   91 aa  FETP_CELJU RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      7e-26  59%   88 aa  FETP_TERTT RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      9e-26  57%   90 aa  FETP_SACD2 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-25  56%   89 aa  FETP_HAHCH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-25  57%   90 aa  FETP_ALTMD RecName: Full=Probable Fe(2+)-trafficking protein;
    1::76      2e-25  59%   90 aa  FETP_THICR RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-25  57%   90 aa  FETP_PSEA6 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-24  55%   90 aa  FETP_METCA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-24  51%   90 aa  FETP_ACIBL RecName: Full=Probable Fe(2+)-trafficking protein;
    1::85      3e-24  49%   90 aa  FETP_COXB2 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::85      5e-24  49%   90 aa  FETP_COXBU RecName: Full=Probable Fe(2+)-trafficking protein;
    1::85      5e-24  49%   90 aa  FETP_COXBN RecName: Full=Probable Fe(2+)-trafficking protein;
    1::85      5e-24  49%   90 aa  FETP_COXB1 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::85      8e-24  49%   90 aa  FETP_COXBR RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-23  55%   91 aa  FETP_TOLAT RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-23  53%   90 aa  FETP_IDILO RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-23  56%   90 aa  FETP_VIBFM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-23  56%   90 aa  FETP_VIBF1 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-23  52%   90 aa  FETP_EDWI9 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-23  50%   91 aa  FETP_ACIC5 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-23  55%   91 aa  FETP_SHEDO RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-23  50%   90 aa  FETP_PSEU5 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      4e-23  53%   90 aa  FETP_MARAV RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      4e-23  56%   90 aa  FETP_ALISL RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      7e-23  50%   91 aa  FETP_XANAC RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      7e-23  52%   91 aa  FETP_HAES2 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      7e-23  52%   91 aa  FETP_HAES1 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      7e-23  50%   92 aa  FETP_ANADF RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      9e-23  50%   92 aa  FETP_XANOR RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      9e-23  50%   92 aa  FETP_XANOM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      9e-23  52%   90 aa  FETP_AZOVD RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      9e-23  47%   92 aa  FETP_ANADE RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      9e-23  52%   89 aa  FETP_ACIBY RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      9e-23  52%   89 aa  FETP_ACIBT RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      9e-23  52%   89 aa  FETP_ACIBC RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      9e-23  52%   89 aa  FETP_ACIB5 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-22  50%   91 aa  FETP_XANC5 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-22  54%   92 aa  FETP_SHESR RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-22  54%   92 aa  FETP_SHESM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-22  54%   92 aa  FETP_SHESA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-22  53%   92 aa  FETP_SHEPC RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-22  55%   92 aa  FETP_SHEPA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-22  53%   92 aa  FETP_SHEB9 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-22  53%   92 aa  FETP_SHEB8 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-22  53%   92 aa  FETP_SHEB5 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-22  53%   92 aa  FETP_SHEB2 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-22  53%   92 aa  FETP_SHESW RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-22  52%   92 aa  FETP_SHEFN RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-22  50%   90 aa  FETP_PSEPW RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-22  51%   90 aa  FETP_PSEPF RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-22  53%   90 aa  FETP_PSEHT RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-22  51%   90 aa  FETP_VIBVY RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-22  51%   90 aa  FETP_VIBVU RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-22  53%   92 aa  FETP_SHEON RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-22  55%   92 aa  FETP_SHEHH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      3e-22  49%   89 aa  FETP_STRM5 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      3e-22  55%   92 aa  FETP_SHEPW RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-22  50%   90 aa  FETP_PSEPK RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-22  50%   90 aa  FETP_PSEPG RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-22  50%   90 aa  FETP_PSEP1 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      3e-22  50%   90 aa  FETP_PSEAE RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      3e-22  50%   90 aa  FETP_PSEAB RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      3e-22  50%   90 aa  FETP_PSEA8 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      3e-22  50%   90 aa  FETP_PSEA7 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      3e-22  53%   94 aa  FETP_HAEDU RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      3e-22  47%   92 aa  FETP_ANASK RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-22  51%   90 aa  FETP_ACIAD RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-22  51%   90 aa  FETP_VIBCM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-22  51%   90 aa  FETP_VIBCH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-22  51%   90 aa  FETP_VIBC3 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      4e-22  55%   90 aa  FETP_VIBSL RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      4e-22  49%   90 aa  FETP_PSEE4 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      4e-22  51%   89 aa  FETP_ACIBS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      6e-22  51%   90 aa  FETP_VIBPA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      6e-22  51%   90 aa  FETP_VIBHB RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      8e-22  49%   89 aa  FETP_STRMK RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-21  48%   92 aa  FETP_XANCP RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-21  48%   92 aa  FETP_XANCB RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-21  48%   92 aa  FETP_XANC8 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-21  49%   90 aa  FETP_PSEFS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-21  50%   94 aa  FETP_MARMS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-21  51%   91 aa  FETP_HAEPS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-21  51%   90 aa  FETP_CHRSD RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-21  51%   90 aa  FETP_PSEMY RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-21  51%   90 aa  FETP_AERS4 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-21  51%   90 aa  FETP_AERHH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      4e-21  50%   90 aa  FETP_PSEF5 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      4e-21  50%   90 aa  FETP_HAEIE RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      4e-21  49%   90 aa  FETP_ACTSZ RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      5e-21  52%   92 aa  FETP_SHESH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      5e-21  50%   90 aa  FETP_HAEIN RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      5e-21  50%   90 aa  FETP_HAEIG RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      5e-21  50%   90 aa  FETP_HAEI8 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      8e-21  50%   90 aa  FETP_COLP3 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      8e-21  45%   94 aa  FETP_ALCBS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-20  50%   90 aa  FETP_PHOPR RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-20  48%   90 aa  FETP_PSEU2 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-20  48%   90 aa  FETP_PSESM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-20  48%   90 aa  FETP_PSE14 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-20  47%   90 aa  FETP_PROMH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-20  48%   90 aa  FETP_PASMU RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-20  47%   91 aa  FETP_ENTS8 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      5e-20  52%   92 aa  FETP_SHEWM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      5e-20  48%   90 aa  FETP_PHOLL RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-19  50%   91 aa  FETP_SHEAM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-19  47%   91 aa  FETP_ACTPJ RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-19  47%   91 aa  FETP_ACTP7 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-19  47%   91 aa  FETP_ACTP2 RecName: Full=Probable Fe(2+)-trafficking protein;
    4::80      2e-19  47%   87 aa  FETP_FRAP2 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-19  47%   90 aa  FETP_ENT38 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::75      2e-19  51%   77 aa  FETP_BAUCH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      3e-19  46%   91 aa  FETP_MANSM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-19  48%   92 aa  FETP_SHELP RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      5e-19  45%   90 aa  FETP_SERP5 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      5e-19  44%   90 aa  FETP_ERWT9 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      6e-19  44%   91 aa  FETP_KLEP7 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      8e-19  44%   91 aa  FETP_KLEP3 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-18  45%   90 aa  FETP_ERWCT RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-18  43%   90 aa  FETP_YERPY RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-18  43%   90 aa  FETP_YERPS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-18  43%   90 aa  FETP_YERPP RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-18  43%   90 aa  FETP_YERPG RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-18  43%   90 aa  FETP_YERPB RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-18  43%   90 aa  FETP_YERP3 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      2e-18  45%   90 aa  FETP_PECCP RecName: Full=Probable Fe(2+)-trafficking protein;
    4::74      2e-18  48%   87 aa  FETP_FRATT RecName: Full=Probable Fe(2+)-trafficking protein;
    4::74      2e-18  48%   87 aa  FETP_FRATN RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      3e-18  43%   90 aa  FETP_YERE8 RecName: Full=Probable Fe(2+)-trafficking protein;
    4::74      3e-18  48%   87 aa  FETP_FRATH RecName: Full=Probable Fe(2+)-trafficking protein;
    4::74      3e-18  48%   87 aa  FETP_FRATF RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      4e-18  43%   90 aa  FETP_SODGM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_SHISS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_SHIFL RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_SHIF8 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_SHIDS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_SHIBS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_SHIB3 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ESCF3 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECOUT RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECOSM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECOSE RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECOLU RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECOLI RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECOLC RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECOL5 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECOK1 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECODH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECOBW RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECO8A RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECO81 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECO7I RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECO5E RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECO57 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECO55 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECO45 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECO27 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      4e-18  45%   91 aa  FETP_ECO24 RecName: Full=Probable Fe(2+)-trafficking protein;
    9::94      7e-18  41%   96 aa  FETP_PSYCK RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      9e-18  45%   91 aa  FETP_CITK8 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-17  42%   90 aa  FETP_HAMD5 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      1e-17  44%   91 aa  FETP_ECOL6 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-17  42%   90 aa  FETP_YERPN RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-17  42%   90 aa  FETP_YERPE RecName: Full=Probable Fe(2+)-trafficking protein;
    1::88      1e-17  42%   90 aa  FETP_YERPA RecName: Full=Probable Fe(2+)-trafficking protein;
    9::94      1e-17  40%   96 aa  FETP_PSYA2 RecName: Full=Probable Fe(2+)-trafficking protein;
    4::74      1e-17  46%   87 aa  FETP_FRATM RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALTY RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALTI RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALSV RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALPK RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALPC RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALPB RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALPA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALNS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALHS RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALG2 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALEP RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALDC RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALCH RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALAR RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-17  43%   91 aa  FETP_SALA4 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      3e-17  42%   90 aa  FETP_XYLFT RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      3e-17  42%   90 aa  FETP_XYLF2 RecName: Full=Probable Fe(2+)-trafficking protein;
    1::73      1e-16  48%   79 aa  FETP_BLOFL RecName: Full=Probable Fe(2+)-trafficking protein;
    1::90      2e-16  41%   90 aa  FETP_XYLFA RecName: Full=Probable Fe(2+)-trafficking protein;
    1::87      2e-16  44%   89 aa  FETP_PSYIN RecName: Full=Probable Fe(2+)-trafficking protein;
    1::76      4e-16  46%   84 aa  FETP_BLOPB RecName: Full=Probable Fe(2+)-trafficking protein;
    1::75      1e-15  44%   78 aa  FETP_WIGBR RecName: Full=Probable Fe(2+)-trafficking protein;
    1::77      2e-15  43%   78 aa  FETP_BUCAP RecName: Full=Probable Fe(2+)-trafficking protein;
    1::75      9e-15  43%   77 aa  FETP_BUCAI RecName: Full=Probable Fe(2+)-trafficking protein;
    2::81      4e-12  36%   87 aa  FETP_BUCBP RecName: Full=Probable Fe(2+)-trafficking protein;
    1::114

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxNKESLMARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKEAWAGWLKHQT
FETP_RALME      -----------------------MARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKEAWAGWLKHQT
FETP_RALPJ      -----------------------MARMVHCVKLNKEAEGLDFPPLPGELGKKLWQSVSKEAWAGWLKHQT
FETP_RALSO      -----------------------MARMVHCVKLNKEAEGLDFPPLPGELGKKIWQSVSKEAWAGWLKHQT
FETP_RALEJ      -----------------------MARMVQCIKLNKEAEGLDFPPLPGELGKKIWQSVSKEAWAGWLKHQT
FETP_CUPTR      -----------------------MARTVHCIKLNKEAEGLDFPPLPGELGKKIWQSVSKEAWAGWLKHQT
FETP_RALEH      -----------------------MARMVQCIKLNKEAEGLDFPPLPGELGKKIWQSVSKEAWAGWLKHQT
FETP_BURTA      -----------------------MARMIHCAKLGKEAEGLDFPPLPGELGKRLYESVSKEAWQGWLKQQT
FETP_BURM1      -----------------------MARMIQCAKLGKEAEGLDFPPLPGELGKRIYENVSKEAWQGWLKQQT
FETP_BURVG      -----------------------MARMIQCAKLGKEAEGLDFPPLPGELGKRIYESVSKEAWQGWLKQQT
FETP_BURS3      -----------------------MARMIQCAKLGKEAEGLDFPPLPGELGKRIYESVSKEAWQGWLKQQT
FETP_BURCJ      -----------------------MARMIQCAKLGKEAEGLDFPPLPGELGKRIYESVSKEAWQGWLKQQT
FETP_BURCH      -----------------------MARMIQCAKLGKEAEGLDFPPLPGELGKRIYESVSKEAWQGWLKQQT
FETP_BURCC      -----------------------MARMIQCAKLGKEAEGLDFPPLPGELGKRIYESVSKEAWQGWLKQQT
FETP_BURCA      -----------------------MARMIQCAKLGKEAEGLDFPPLPGELGKRIYESVSKEAWQGWLKQQT
FETP_BURA4      -----------------------MARMIQCAKLGKEAEGLDFPPLPGELGKRIYESVSKEAWQGWLKQQT
FETP_POLNS      -----------------------MARMVQCIKLNKEAEGMDFAPLPGELGKRIWNQVSKEAWAGWLKQQT
FETP_BURPS      -----------------------MARMIHCAKLGKEAEGLDFPPLPGELGKRLYESVSKQAWQDWLKQQT
FETP_BURP6      -----------------------MARMIHCAKLGKEAEGLDFPPLPGELGKRLYESVSKQAWQDWLKQQT
FETP_BURP1      -----------------------MARMIHCAKLGKEAEGLDFPPLPGELGKRLYESVSKQAWQDWLKQQT
FETP_BURP0      -----------------------MARMIHCAKLGKEAEGLDFPPLPGELGKRLYESVSKQAWQDWLKQQT
FETP_BURMS      -----------------------MARMIHCAKLGKEAEGLDFPPLPGELGKRLYESVSKQAWQDWLKQQT
FETP_BURMA      -----------------------MARMIHCAKLGKEAEGLDFPPLPGELGKRLYESVSKQAWQDWLKQQT
FETP_BURM9      -----------------------MARMIHCAKLGKEAEGLDFPPLPGELGKRLYESVSKQAWQDWLKQQT
FETP_BURM7      -----------------------MARMIHCAKLGKEAEGLDFPPLPGELGKRLYESVSKQAWQDWLKQQT
FETP_BURCM      -----------------------MARMIQCAKLGKEAEALDFPPLPGELGKRIYESVSKEAWQGWLKQQT
FETP_BURP8      -----------------------MTRMVQCTKLGKEAEGLDFPPLPGELGKRIYESISKEAWQQWLKQQT
FETP_POLSQ      -----------------------MARMVQCIKLNKEAEGMDFAPLPGELGKKIWNQVSKEAWAAWLKQQT
FETP_BURXL      -----------------------MTRMVQCAKLGKEAEGLDFPPLPGELGKRIYESISKEAWQAWLKQQT
FETP_BURPP      -----------------------MTRMVQCAKLGKEAEGLDFPPLPGELGKRIYEGISKEAWQAWLKQQT
FETP_VEREI      -----------------------MARTVQCIKLGKEAEGLDFPPYPGELGQRIWANVSKQAWAGWLKHQT
FETP_VARPS      -----------------------MARMVQCIKLGKEAEGLDFPPYPGELGKRLWENVSKEAWAAWLKQQT
FETP_JANMA      -----------------------MTRMIHCIKLDKEAEGLDFPPYPGELGKRIYETVSKEAWAAWLKHQT
FETP_DIAST      -----------------------MARTVHCIKLGKEAEGLDFAPYPGDLGKRIYDNVSKQAWADWIKHQT
FETP_ACISJ      -----------------------MARTVHCIKLGKEAEGLDFAPYPGDLGKRIYDNVSKQAWADWIKHQT
FETP_RHOFD      -----------------------MARTVNCIKLGKEAEGLDFPPYPGELGKRIWESVSKQAWADWLKHQT
FETP_LARHH      -----------------------MARMVQCIKLGREAEGLDFPPLPGELGKKVYENVSKEAWQAWLRHQT
FETP_POLSJ      -----------------------MARMVKCIKLGREAEGLDFPPYPGPLGKRLWEEVSKEAWADWMKQQT
FETP_HERAR      -----------------------MTRMVHCIKLDKEAEALDFPPYPGELGKRIYESVSKEAWAAWLKHQT
FETP_POLNA      -----------------------MARLVNCIKLGREAEGLDFPPYPGALGKRIWEEVSKQAWADWMKQQT
FETP_NEIMF      -----------------------MARMVFCVKLNKEAEGMKFPPLPNELGKRIFENVSQEAWAAWTRHQT
FETP_NEIMB      -----------------------MARMVFCVKLNKEAEGMKFPPLPNELGKRIFENVSQEAWAAWTRHQT
FETP_NEIMA      -----------------------MARMVFCVKLNKEAEGMKFPPLPNELGKRIFENVSQEAWAAWTRHQT
FETP_NEIM0      -----------------------MARMVFCVKLNKEAEGMKFPPLPNELGKRIFENVSQEAWAAWTRHQT
FETP_NEIG1      -----------------------MARMVFCVKLNKEAEGMKFPPLPNELGKRIFENVSQEAWAAWTRHQT
FETP_THIDA      -----------------------MTRMVNCVKLGREAEGLAFQPVPGDLGKKIFENVSKEAWAGWQRHQT
FETP_LEPCP      -----------------------MARTVQCVLLKKEADGLDFSPYPGELGKRIYEQVSKEAWQQWLKHQT
FETP_METPP      -----------------------MARTVHCALLKKDADGLDFAPYPGELGQRIFDNVSKEAWAQWLKHQT
FETP_CHRVO      -----------------------MSRTVNCIKLGREAEGLDFPPLPGELGKRVYESVSKEAWQGWLRYQT
FETP_ACIAC      -----------------------MARTVQCIKLGKEAEGLDFPPYPGELGKRIFENVSKEAWAGWLKHQT
FETP_NITEU      -----------------------MVRSVKCIRLGCEAEGLDFPPYPGELGKRIFDNVSKEAWSQWIKHQT
FETP_AZOSB      -----------------------MARMVNCIKLGREAEGLDLPPVPGELGKRIYESVSKEAWQQWVKYQT
FETP_NITEC      -----------------------MARNVQCIKLGCEAEGLDFPPYPGELGKRIFENVSREAWGQWIKHQT
FETP_DECAR      -----------------------MARTVNCIKLGREAEGLDFPPYPGPLGQRIFEHVSKEAWQQWIKMQT
FETP_NITMU      -----------------------MGRTVNCIKLGRELEGLDFPPYPGELGKRIFENVSKEAWAGWIRHQT
FETP_DELAS      -----------------------MARTVHCIKLGVDAEGLDFPPYPGELGKRIFEGVSKQAWADWLKHQT
FETP_ACIF5      -----------------------MSRMVQCVKLGHEAEGLDRPPYPGALGARIYQEVSKEAWQGWLKHQT
FETP_ACIF2      -----------------------MSRMVQCVKLGHEAEGLDRPPYPGALGARIYQEVSKEAWQGWLKHQT
FETP_BORPE      -----------------------MSRIVNCVKLKREAEGLDFPPYPGELGTRIWQQISKEAWEEWKQIQT
FETP_BORPA      -----------------------MSRIVNCVKLKREAEGLDFPPYPGELGTRIWQQISKEAWEEWKQIQT
FETP_BORBR      -----------------------MSRIVNCVKLKREAEGLDFPPYPGELGTRIWQQISKEAWEEWKQIQT
FETP_NITOC      -----------------------MSRTVHCVKLDHEAEGLDFPPYPGELGKRLYEQVSKEAWQMWMKHQT
FETP_BORA1      -----------------------MARTVNCVKLKREAEGLDYPPYPGELGARIWREISKESWEEWKQIQT
FETP_THISH      -----------------------MARMVNCVLLGKEAEGLDFPPYPGELGKKIYEGVSKEAWQKWVKHQT
FETP_ALHEH      -----------------------MTRMVQCVRLGREAEGLPRPPYPGELGKRIYENVSKEAWQEWLRHQT
FETP_LEGPL      -----------------------MSRTVFCCKLKQEAEGLEKQPFPGELGKKVFNEVSKQAWNMWLSHQT
FETP_LEGPH      -----------------------MSRTVFCCKLKQEAEGLEKQPFPGELGKKVFNEVSKQAWNMWLSHQT
FETP_LEGPC      -----------------------MSRTVFCCKLKQEAEGLEKQPFPGELGKKVFNEVSKQAWNMWLSHQT
FETP_LEGPA      -----------------------MSRTVFCCKLKQEAEGLEKQPFPGELGKKVFNEVSKQAWNMWLSHQT
FETP_HALHL      -----------------------MSRKVHCVKLQQEADGLDRPPYPGELGQRIYDNVSKQAWSMWVQQQT
FETP_CELJU      -----------------------MARMVFCRKYKQQLEGLDFPPYPGAKGQDLFDNVSKKAWQEWMAHQT
FETP_TERTT      -----------------------MTRTVHCRKYNKEMEGLAVPPLPGAKGTELFNSVSKQAWQEWLQHQT
FETP_SACD2      -----------------------MSRTVNCRKFKQELEGLDFPPMPGAKGQDIFENVSKKAWQEWLSHQT
FETP_HAHCH      -----------------------MARMVFCKKYQQELEGLALPPMPGARGKELFETVSKKAWQEWLQHQT
FETP_ALTMD      -----------------------MARTVFCRKLQKEADGLDFQLYPGELGKRIFDNISKEAWGEWQKKQT
FETP_THICR      -----------------------MTRMVNCVKMEQELEGLDFPPFPGDLGQKIYENVSKEAWKQWLAQQT
FETP_PSEA6      -----------------------MSRTVFCQHLNKEADGLDFQLYPGELGKKIFDNISKEAWTEWQKKQT
FETP_METCA      -----------------------MARRIICAKLGIEADGLDAPPFPGPQGQRIFEHVSKEAWQDWLKLQT
FETP_ACIBL      -----------------------MAHMVKCVKLGREAEGLEEPPFDSELGQKIYNNVSAEAWRGWTEHQK
FETP_COXB2      -----------------------MTRRIFCQKLGKEADALNYSPYPGELGERIYNHISEQAWQAWLSHQT
FETP_COXBU      -----------------------MTRRIICQKLGKEADALNYSPYPGELGERIYNHISEQAWQAWLSHQT
FETP_COXBN      -----------------------MTRRIICQKLGKEADALNYSPYPGELGERIYNHISEQAWQAWLSHQT
FETP_COXB1      -----------------------MTRRIICQKLGKEADALNYSPYPGELGERIYNHISEQAWQAWLSHQT
FETP_COXBR      -----------------------MTRRIICQKLGKEADALNYSPYPGELGERIYNHISEQAWQAWLSHQT
FETP_TOLAT      -----------------------MTRMVFCQRLKKEAPGMAFQLVPGELGKRIFDNICQEAWAEWQKKQT
FETP_IDILO      -----------------------MSRTVFCEHFQKEAEGLDFQLYPGELGERIFNHISKDAWAEWQKKQT
FETP_VIBFM      -----------------------MSRTVFCVRLNKEADGLDFQLYPGELGKRIFDNISKEAWGQWQHKQT
FETP_VIBF1      -----------------------MSRTVFCVRLNKEADGLDFQLYPGELGKRIFDNISKEAWGQWQHKQT
FETP_EDWI9      -----------------------MSRTVFCTFLNREAEGLDFQSYPGDLGKRIYDHISKEAWGQWMAKQT
FETP_ACIC5      -----------------------MAHNVFCARYKQEMEGLDEPPFDSDFGHKIYNNVSKRAWGEWIEHQK
FETP_SHEDO      -----------------------MARNVNCVYLNKEAPGLDFQLYPGDLGKRIFDNISKEAWGLWQQKQT
FETP_PSEU5      -----------------------MTRTVNCRKYNQELPGLERPPFPGQKGEDIYNNISRQAWDDWQKHQT
FETP_MARAV      -----------------------MSRTVFCRKYQKELEGLAMPPMPGPKGQDIYENVSKLAWEEWQNQQT
FETP_ALISL      -----------------------MSRTVFCVLLNKEADGLDFQLYPGELGKRIFDNISKEAWGQWQHKQT
FETP_XANAC      -----------------------MSRTVFCHYQQSDAEGLDFVPYPGELGQRIFAQIGKNAWQAWLAHQT
FETP_HAES2      -----------------------MARNVFCTYLNQEAEGLDFQLYPGELGKRIFDNISKQAWAEWMKKQT
FETP_HAES1      -----------------------MARNVFCTYLNQEAEGLDFQLYPGELGKRIFDNISKQAWAEWMKKQT
FETP_ANADF      -----------------------MARMVMCKKLGKELPGLTFKPFPNELGQRIYDSVSQDAWKLWLEHFK
FETP_XANOR      -----------------------MSRTVFCHYQQSDAEGLDFVPYPGELGQRIFAHIGKTAWQAWLAHQT
FETP_XANOM      -----------------------MSRTVFCHYQQSDAEGLDFVPYPGELGQRIFAHIGKTAWQAWLAHQT
FETP_AZOVD      -----------------------MTRTVHCRKYKEELPGLDRPPYPGPKGEDIYNNVSRQAWDEWQKHQT
FETP_ANADE      -----------------------MARMVMCKKLGRELPGLAYKPFPNELGQRIYDSISQDAWKLWLEHFK
FETP_ACIBY      -----------------------MSRQVFCRKYQKEMEGLDFAPFPGAKGQEFFENVSKQAWQEWLQHQT
FETP_ACIBT      -----------------------MSRQVFCRKYQKEMEGLDFAPFPGAKGQEFFENVSKQAWQEWLQHQT
FETP_ACIBC      -----------------------MSRQVFCRKYQKEMEGLDFAPFPGAKGQEFFENVSKQAWQEWLQHQT
FETP_ACIB5      -----------------------MSRQVFCRKYQKEMEGLDFAPFPGAKGQEFFENVSKQAWQEWLQHQT
FETP_XANC5      -----------------------MSRTVFCHYQQSDAEGLDFVPYPGELGQRIFVQIGKTAWQAWLAHQT
FETP_SHESR      -----------------------MARTVNCVYLNKEADGLDFQLYPGDLGKRIFDNVSKEAWGLWQKKQT
FETP_SHESM      -----------------------MARTVNCVYLNKEADGLDFQLYPGDLGKRIFDNVSKEAWGLWQKKQT
FETP_SHESA      -----------------------MARTVNCVYLNKEADGLDFQLYPGDLGKRIFDNVSKEAWGLWQKKQT
FETP_SHEPC      -----------------------MARTVNCVYLNKEADGLDFQLYPGDLGKRIFDNISKEAWGLWQKKQT
FETP_SHEPA      -----------------------MARTVNCVYLNKEAEGLGFQLYPGDLGKRIFDNVSKEAWALWQSKQT
FETP_SHEB9      -----------------------MARTVNCVYLNKEADGLDFQLYPGDLGKRIFDNISKEAWGLWQKKQT
FETP_SHEB8      -----------------------MARTVNCVYLNKEADGLDFQLYPGDLGKRIFDNISKEAWGLWQKKQT
FETP_SHEB5      -----------------------MARTVNCVYLNKEADGLDFQLYPGDLGKRIFDNISKEAWGLWQKKQT
FETP_SHEB2      -----------------------MARTVNCVYLNKEADGLDFQLYPGDLGKRIFDNISKEAWGLWQKKQT
FETP_SHESW      -----------------------MARTVNCVYLNKEADGLDFQLYPGDLGKRIFDNISKEAWGLWQKKQT
FETP_SHEFN      -----------------------MARTVHCQHLNKSADGLDFQLYPGELGKRIFDNIGKEAWGLWQKKQT
FETP_PSEPW      -----------------------MTRTVMCRKYKEQLPGLERPPYPGAKGQDIFEHISQQAWADWQKHQT
FETP_PSEPF      -----------------------MTRTVMCRKYKEQLEGLERPPYPGAKGQDIFEHVSAKAWADWQKHQT
FETP_PSEHT      -----------------------MARTVFCQKLQKEAEGLGFQLYPGEIGEKIFNNISKEAWAQWQHKQT
FETP_VIBVY      -----------------------MSRTVFCARLNKEADGLDFQLYPGELGKRIFDNISKEAWGQWQHKQT
FETP_VIBVU      -----------------------MSRTVFCARLNKEADGLDFQLYPGELGKRIFDNISKEAWGQWQHKQT
FETP_SHEON      -----------------------MARTVNCVHLNKEADGLDFQLYPGDLGKRIFDNISKEAWGLWQKKQT
FETP_SHEHH      -----------------------MARTVNCVYLNKEAEGLGFQLYPGDLGKRIFDNVSKEAWALWQSKQT
FETP_STRM5      -----------------------MSRTVFCQYEQRDAEGLDFVPYPGELGQRIFNNIGKQAWAAWLAHQT
FETP_SHEPW      -----------------------MARTVNCVYLKKEAEGLGFQLYPGDLGKRIFDNVSKEAWALWQSKQT
FETP_PSEPK      -----------------------MTRTVMCRKYQEELPGLERPPYPGAKGQDIFEHISQKAWADWQKHQT
FETP_PSEPG      -----------------------MTRTVMCRKYQEELPGLERPPYPGAKGQDIFEHISQKAWADWQKHQT
FETP_PSEP1      -----------------------MTRTVMCRKYQEELPGLERPPYPGAKGQDIFEHISQKAWADWQKHQT
FETP_PSEAE      -----------------------MSRTVMCRKYHEELPGLDRPPYPGAKGEDIYNNVSRKAWDEWQKHQT
FETP_PSEAB      -----------------------MSRTVMCRKYHEELPGLDRPPYPGAKGEDIYNNVSRKAWDEWQKHQT
FETP_PSEA8      -----------------------MSRTVMCRKYHEELPGLDRPPYPGAKGEDIYNNVSRKAWDEWQKHQT
FETP_PSEA7      -----------------------MSRTVMCRKYHEELPGLDRPPYPGAKGEDIYNNVSRKAWDEWQKHQT
FETP_HAEDU      -----------------------MARMVFCEYLKKEAEGLDFQLYPGELGKRIFNSISKQAWAEWIKKQT
FETP_ANASK      -----------------------MARMVMCKKLGRELPGLAYKPFPNELGQRIYDSISQDAWKLWLEHFK
FETP_ACIAD      -----------------------MTRLVFCRKYQQEMEGLDFAPFPGAKGQEFFDNVSKQAWQEWLQHQT
FETP_VIBCM      -----------------------MARTVFCTRLQKEADGLDFQLYPGELGKRIFDNICKEAWAQWQTKQT
FETP_VIBCH      -----------------------MARTVFCTRLQKEADGLDFQLYPGELGKRIFDNICKEAWAQWQTKQT
FETP_VIBC3      -----------------------MARTVFCTRLQKEADGLDFQLYPGELGKRIFDNICKEAWAQWQTKQT
FETP_VIBSL      -----------------------MSRTVFCARLQKDAEGLDFQLYPGDLGKRIFDNVSKEAWGQWQSKQT
FETP_PSEE4      -----------------------MTRTVKCRKYNEELPGLDRPPYPGAKGQDIFEHISQKAWKEWQDHQT
FETP_ACIBS      -----------------------MSRQVFCRKYQMEMEGLDFAPFPGAKGQEFFENVSKQAWQEWLQHQT
FETP_VIBPA      -----------------------MSRTVFCARLKKEGEGLDFQLYPGELGKRIFDNISKEAWAQWQHKQT
FETP_VIBHB      -----------------------MSRTVFCARLKKEGEGLDFQLYPGELGKRIFDNISKEAWAQWQHKQT
FETP_STRMK      -----------------------MPRTVFCQYEQRDAEGLDFVPYPGELGQRIFNNIGKQAWAAWLAHQT
FETP_XANCP      -----------------------MSRTVFCQYQQCDTEGLDFAPYPGELGQRIFAQIGKAGWQAWLAHQT
FETP_XANCB      -----------------------MSRTVFCQYQQCDTEGLDFAPYPGELGQRIFAQIGKAGWQAWLAHQT
FETP_XANC8      -----------------------MSRTVFCQYQQCDTEGLDFAPYPGELGQRIFAQIGKAGWQAWLAHQT
FETP_PSEFS      -----------------------MTRTIICRKYKEELPGLERPPYPGAKGQDIFDHVSAKAWGDWLKHQT
FETP_MARMS      -----------------------MANTVFCKKFQKEMEALDRAPLPGAKGQEILQNVSKQAWQEWQHLQT
FETP_HAEPS      -----------------------MARNVFCAYLKQEAEGLDFQLYPGELGKRIFDSISKQAWAEWIKKQT
FETP_CHRSD      -----------------------MSDTVFCRKYQKELDALPFPPLPGAKGQEIQQTVSKQAWDEWQALQT
FETP_PSEMY      -----------------------MTRTVLCRKYKQELPGLDRAPYPGPKGEDIFANVSKQAWDEWQKHQT
FETP_AERS4      -----------------------MSRTVFCQRLKKEGPGLDFQLYPGELGKRIFDNISKEAWTEWQKKQV
FETP_AERHH      -----------------------MSRTVFCQRLKKEGPGLDFQLYPGELGKRIFDNISKEAWTEWQKKQV
FETP_PSEF5      -----------------------MTRTVMCRKYQEELPGLERPPYPGAKGQDIFDHVSAKAWADWQKHQT
FETP_HAEIE      -----------------------MARTVFCEYLKKEAEGLDFQLYPGELGKRIFDSVSKQAWSEWIKKQT
FETP_ACTSZ      -----------------------MARTVFCEHLKQEAEGLDFQLYPGELGKRIFEHISKQAWGDWLKKQT
FETP_SHESH      -----------------------MARTVNCVYLKKESEGLGFQLYPGELGKRIFDNVSKEAWALWQSKQT
FETP_HAEIN      -----------------------MARTVFCEYLKKEAEGLDFQLYPGELGKRIFDSVSKQAWGEWIKKQT
FETP_HAEIG      -----------------------MARTVFCEYLKKEAEGLDFQLYPGELGKRIFDSVSKQAWGEWIKKQT
FETP_HAEI8      -----------------------MARTVFCEYLKKEAEGLDFQLYPGELGKRIFDSVSKQAWGEWIKKQT
FETP_COLP3      -----------------------MSRTVFCQNLNKEAEGLGFQLYPGEIGKRIFDNISKEAWTIWQKKQT
FETP_ALCBS      -----------------------MSRTVFCRKYQSDMEGLPRPPFPGPKGQDIFDHVSQQAWKEWLHEQT
FETP_PHOPR      -----------------------MSRTVFCTRLKKDAEGLDFQLYPGDLGKRIFDNISKEAWAEWQSKQT
FETP_PSEU2      -----------------------MTRTVMCRKYKEELPGLERAPYPGAKGEDIFNHVSQKAWADWQKHQT
FETP_PSESM      -----------------------MTRTVMCRKYKEELPGLERAPYPGAKGEDIFNHVSQKAWADWQKHQT
FETP_PSE14      -----------------------MTRTVMCRKYKEELPGLERAPYPGAKGEDIFNHVSQKAWADWQKHQT
FETP_PROMH      -----------------------MSRTIFCTFLNKEADGLDFQLYPGELGKRIFNEISKEAWGQWMAKQT
FETP_PASMU      -----------------------MARTVFCEYLKQESEGLDFQLYPGELGKRIFDSISKQAWREWMKKQT
FETP_ENTS8      -----------------------MSRTIFCTFLQRDAEGQDFQLYPGELGKRIYNEISKEAWAQWQKKQT
FETP_SHEWM      -----------------------MARTVNCVYLKKEAEGLGFQLYPGPLGKRIFDNVSKEAWGLWQAKQT
FETP_PHOLL      -----------------------MNRTVFCTFLQREAEGLDFQLYPGELGKRIFNEISKEAWRQWMSKQT
FETP_SHEAM      -----------------------MARTVQCVYLGKEAEGLDFQLYPGELGKRIFDTISKEAWGEWQKKQT
FETP_ACTPJ      -----------------------MARTVFCEYLKQEAEGLDFQLYPGELGKRIFDSISKQAWSEWIKKQT
FETP_ACTP7      -----------------------MARTVFCEYLKQEAEGLDFQLYPGELGKRIFDSISKQAWSEWIKKQT
FETP_ACTP2      -----------------------MARTVFCEYLKQEAEGLDFQLYPGELGKRIFDSISKQAWSEWIKKQT
FETP_FRAP2      ---------------------------VLCKKYNEELDAIPFQPLPGELGKKIHSEISNKAWQAWLAHQT
FETP_ENT38      -----------------------MARTIFCTYLQRDAEGQDFQLYPGDLGKRIFNEISKEAWAQWQQKQT
FETP_BAUCH      -----------------------MSKNIYCVFLRKQAEGQDFQSYPGELGKHIFNNISKEAWAKWQQKQT
FETP_MANSM      -----------------------MSRTVFCEYLKQEAEGLDFQLYPGELGKRIFDNISKRAWGEWMKKQT
FETP_SHELP      -----------------------MARTVNCQYLKKEADGLAFQLYPGELGKRIFDNISQEAWSLWQAKQT
FETP_SERP5      -----------------------MSRTIFCTFLQRDAEGQDFQLYPGEVGKRIYNEISKEAWAEWMKKQT
FETP_ERWT9      -----------------------MSRTIFCTFLQRDAEGQDFQLYPGDTGKRIFNEISKEAWSKWMAKQT
FETP_KLEP7      -----------------------MSRTIFCTFLQREADGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_KLEP3      -----------------------MSRTIFCTFLQREADGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ERWCT      -----------------------MSRTIFCTVLQRDAEGQDFQLYPGDLGKRIYNEISKEAWAQWQTKQT
FETP_YERPY      -----------------------MSRTIFCTFLKKDAEGQDFQLYPGEIGKRIYNEISKEAWSQWITKQT
FETP_YERPS      -----------------------MSRTIFCTFLKKDAEGQDFQLYPGEIGKRIYNEISKEAWSQWITKQT
FETP_YERPP      -----------------------MSRTIFCTFLKKDAEGQDFQLYPGEIGKRIYNEISKEAWSQWITKQT
FETP_YERPG      -----------------------MSRTIFCTFLKKDAEGQDFQLYPGEIGKRIYNEISKEAWSQWITKQT
FETP_YERPB      -----------------------MSRTIFCTFLKKDAEGQDFQLYPGEIGKRIYNEISKEAWSQWITKQT
FETP_YERP3      -----------------------MSRTIFCTFLKKDAEGQDFQLYPGEIGKRIYNEISKEAWSQWITKQT
FETP_PECCP      -----------------------MSRTIFCTFLQRDAEGQDFQLYPGDLGKRIYNEISKEAWAQWQTKQT
FETP_FRATT      ---------------------------VFCKKYHQELDAIPFQPLPGELGKKIHNEISNKAWQAWLAHQT
FETP_FRATN      ---------------------------VFCKKYHQELDAIPFQPLPGELGKKIHNEISNKAWQAWLAHQT
FETP_YERE8      -----------------------MSRTIFCTFLKKEAEGQDFQLYPGEIGKRIYNEISKEAWSQWVTKQT
FETP_FRATH      ---------------------------VFCKKYHQELDAIPFQPLPGELGKKIHNEISNKAWQAWLAHQT
FETP_FRATF      ---------------------------VFCKKYHQELDAIPFQPLPGELGKKIHNEISNKAWQAWLAHQT
FETP_SODGM      -----------------------MSRTIYCTFLKREAEGQDFQFYPGELGKRIYDNISKEAWTQWQTKQT
FETP_SHISS      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_SHIFL      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_SHIF8      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_SHIDS      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_SHIBS      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_SHIB3      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ESCF3      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECOUT      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECOSM      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECOSE      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECOLU      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECOLI      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECOLC      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECOL5      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECOK1      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECODH      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECOBW      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECO8A      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECO81      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECO7I      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECO5E      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECO57      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECO55      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECO45      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECO27      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_ECO24      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_PSYCK      ------------------------ANTVFCRKYQQELPKMPHPPFPNKKGQELQETVSEKAWKEWLEQQT
FETP_CITK8      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_HAMD5      -----------------------MSRTIFCTFLKKEAIGQDFQIYPGDIGRRIYDDISQEAWSLWLNKQT
FETP_ECOL6      -----------------------MSRTIFCTFLQREAEGQDFQLYPGELGKRIYNEISKEAWAQWQHKQT
FETP_YERPN      -----------------------MSRTIFCTFLKKDAERQDFQLYPGEIGKRIYNEISKEAWSQWITKQT
FETP_YERPE      -----------------------MSRTIFCTFLKKDAERQDFQLYPGEIGKRIYNEISKEAWSQWITKQT
FETP_YERPA      -----------------------MSRTIFCTFLKKDAERQDFQLYPGEIGKRIYNEISKEAWSQWITKQT
FETP_PSYA2      ------------------------ANTVFCRKYQQDLPKMPHPPFPNKKGQELQETVSEKAWKEWLEQQT
FETP_FRATM      ---------------------------VFCKKYHQELDAIPFQPLPGELGKKIHNEISNKAWQAWLAHQT
FETP_SALTY      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALTI      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALSV      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALPK      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALPC      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALPB      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALPA      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALNS      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALHS      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALG2      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALEP      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALDC      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALCH      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALAR      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_SALA4      -----------------------MSRTIFCTYLQRDAEGQDFQLYPGELGKRIYNEISKDAWAQWQHKQT
FETP_XYLFT      -----------------------MQRIIFCEYEKRDTEGLDFVPYPGELGQKIFACIGKVGWAAWLAHQT
FETP_XYLF2      -----------------------MQRIIFCEYEKRDTEGLDFVPYPGELGQKIFACIGKVGWAAWLAHQT
FETP_BLOFL      -----------------------MTKIIYCIYLKKYAEGLKFPCYPGKLGEYIYKNISQEAWNKWQNVQT
FETP_XYLFA      -----------------------MQRIIFCEYEQRDTEGLDFVPYPGELGQKIFACIGKVGWAAWLVHQT
FETP_PSYIN      -----------------------MTRTVFCSYLKKEAPGLAFQLIPGALGKRIFDNISQEAWSEWQKKQT
FETP_BLOPB      -----------------------MSKIIYCVFLKKYAEGLDAPCYPGALGKYIYEHISNIAWMQWQDKQT
FETP_WIGBR      -----------------------MKRNIFCHFMKNFHERLDFPPYPGSIGKKIYKNISKKAWEIWKNHQT
FETP_BUCAP      -----------------------MNRIIFCTFLQKKSEGQDYPPYPGKLGEKIYNQISKIAWKEWKLQQT
FETP_BUCAI      -----------------------MNRIIFCTFFKKKSEGQDFQSYPGKLGKKIYDQISKKAWEKWIEKQT
FETP_BUCBP      ------------------NKKNDINRKIFCNFFKKYEEGLTYIPYPGLLGHKIYNEISKLAWNKWILQQT


                         .         .         *         .         .         .         .:140
query           MLINENRLNMADPRARQYLIKQTEKYFFGDGADQAAGYVPPPAA
FETP_RALME      MLINENRLNMADPRARQYLIKQTEKYFFGDGADQAAGYVPPPAA
FETP_RALPJ      MLINENRLNMADSRARQYLLKQTEKYFFGDGADEAAGYVPPPSA
FETP_RALSO      MLINENRLNMADTRARQYLLKQTEKYFFGEGADQASGYVPPPSA
FETP_RALEJ      MLINENRLNMADARARQYLLKQTEKYFFGEGADEAAGYVPPQA-
FETP_CUPTR      MLINENRLNMADARARQYLLKQTEKYFFGEGADQAQGYVPP---
FETP_RALEH      MLINENRLNMADARARQYLLKQTEKYFFGEGADQAQGYVPP---
FETP_BURTA      MLINENRLNMADPRARQYLMKQTEKYFFGEGADQASGYVPP---
FETP_BURM1      MLINENRLNMADPRARQYLMKQTEKYFFGEGADQASGYVPP---
FETP_BURVG      MLINENRLNMADPRARQYLMKQTEKYFFGDGADQASGYVPP---
FETP_BURS3      MLINENRLNMADPRARQYLMKQTEKYFFGDGADQASGYVPP---
FETP_BURCJ      MLINENRLNMADPRARQYLMKQTEKYFFGDGADQASGYVPP---
FETP_BURCH      MLINENRLNMADPRARQYLMKQTEKYFFGDGADQASGYVPP---
FETP_BURCC      MLINENRLNMADPRARQYLMKQTEKYFFGDGADQASGYVPP---
FETP_BURCA      MLINENRLNMADPRARQYLMKQTEKYFFGDGADQASGYVPP---
FETP_BURA4      MLINENRLNMADPRARQYLMKQTEKYFFGDGADQASGFVPP---
FETP_POLNS      MLINENRLNMADPRARQYLLKQVEKHFFEGGADTAQGYVPPPA-
FETP_BURPS      MLINENRLNMADPRARQYLMKQTEKYFFGEGADQASGYVPP---
FETP_BURP6      MLINENRLNMADPRARQYLMKQTEKYFFGEGADQASGYVPP---
FETP_BURP1      MLINENRLNMADPRARQYLMKQTEKYFFGEGADQASGYVPP---
FETP_BURP0      MLINENRLNMADPRARQYLMKQTEKYFFGEGADQASGYVPP---
FETP_BURMS      MLINENRLNMADPRARQYLMKQTEKYFFGEGADQASGYVPP---
FETP_BURMA      MLINENRLNMADPRARQYLMKQTEKYFFGEGADQASGYVPP---
FETP_BURM9      MLINENRLNMADPRARQYLMKQTEKYFFGEGADQASGYVPP---
FETP_BURM7      MLINENRLNMADPRARQYLMKQTEKYFFGEGADQASGYVPP---
FETP_BURCM      MLINENRLNMADPRARQYLMKQTEKYFFGDGADQASGFVPP---
FETP_BURP8      MLINENRLNMADPRARQYLMKQTEKFFFGEGADQASGYVPP---
FETP_POLSQ      MLINENRLNMADPRARQYLLKQVEKYFFEGGADMAQGYVP----
FETP_BURXL      MLINENRLNMADPRARQYLMKQTEKFFFGEGADTAQGYVPPSA-
FETP_BURPP      MLINENRLNMADPRARQYLMKQTEKFFFGEGADTAQGYVPPSA-
FETP_VEREI      MLVNENRLNLADARARQYLARQMENHFFGSGADAAAGYVPPSA-
FETP_VARPS      MLVNENRLNLADLRARQYLARQMEKHFFGEGADVAQGYVPP---
FETP_JANMA      MLVNENRLNLADVRARKYLATQMEKHFFGDGADAAQGYVPP---
FETP_DIAST      MLVNENRLNLADARARQYLARQMENHFFGSGADAAAGYVPPSA-
FETP_ACISJ      MLVNENRLNLADARARQYLARQMENHFFGSGADAAAGYVPPSA-
FETP_RHOFD      MLVNENRLNLADARARQYLARQMENHFFGGGADAAQGYVPPSA-
FETP_LARHH      MLINENRLNLADSRARQYLTQQLQNYFFGTGADMPAGFVPP---
FETP_POLSJ      MLVNENRLNLADARARQYLARQMEKHFFGDGADAVQGYVPPSA-
FETP_HERAR      MLVNENRLNLADVRARKYLATQMEKHFFGEGADAAQGYVPP---
FETP_POLNA      MLVNENRLNLADARARQYLARQMEKHFFGDGADAVQGYVPP---
FETP_NEIMF      MLINENRLSLADPRAREYLAQQMEQYFFGDGADAVQGYVP----
FETP_NEIMB      MLINENRLSLADPRAREYLAQQMEQYFFGDGADAVQGYVP----
FETP_NEIMA      MLINENRLSLADPRAREYLAQQMEQYFFGDGADAVQGYVP----
FETP_NEIM0      MLINENRLSLADPRAREYLAQQMEQYFFGDGADAVQGYVP----
FETP_NEIG1      MLINENRLSLADPRAREYLAQQMEQYFFGDGADAVQGYVP----
FETP_THIDA      MLINENRLNLADPQARSYLMEQMERYFFGGGVDAAAGYVPP---
FETP_LEPCP      MLVNENRLNLADARARQYLARQMERYFFGEGADQPTGYVPPTA-
FETP_METPP      MLVNENRLNLADARARQYLARQMENYFFGAGAEQPAGYVPP---
FETP_CHRVO      MLINENRLSLADARARQYLASQLDAYFFGQGADAPAGYTPP---
FETP_ACIAC      MLVNENRLNLADARARQYLARQMEQHFFXXXXXXXXXYVPPSA-
FETP_NITEU      MLVNEMRLNLADIKARKYLASQMEAYFFGEGADQPAGYIPP---
FETP_AZOSB      MLINENRLNLMDPRARKYLSEQMEKHFFEGGADAIGGFVPP---
FETP_NITEC      MLVNEMRLSMADIKARKYLATQMEAYFFGEGAEQPVGYVPP---
FETP_DECAR      MIINENRLNLVDAKHRKYLAEQVEKHFFGEGADQIQGYVPPAA-
FETP_NITMU      MLVNEYHLNLSDIKARKYLAEQLDAYFFGSGAEQPRGYVP----
FETP_DELAS      MLVNENRLNLADARARQYLARQMENHFFXXXXXXXXXYVPPTA-
FETP_ACIF5      MLINEYRLSPIDPKSRTFLEKQMEAYFFGDGAQSPEGYVPP---
FETP_ACIF2      MLINEYRLSPIDPKSRTFLEKQMEAYFFGDGAQSPEGYVPP---
FETP_BORPE      RLVNENRLNLADARARKYLQQQMERFLFEDGTVEAQGYVPPSA-
FETP_BORPA      RLVNENRLNLADARARKYLQQQMERFLFEDGTVEAQGYVPPSA-
FETP_BORBR      RLVNENRLNLADARARKYLQQQMERFLFEDGTVEAQGYVPPSA-
FETP_NITOC      ILINEYRLTLVDPKARQFLEQEMEKFFFGEGSTPPQEYTPP---
FETP_BORA1      RLVNENRLNLADARARKYLQQQMERFLFEDGTVEAQGYVPPSA-
FETP_THISH      MLINEYRLTPVDPKARKFLEEEMDKFFFSGGSTKPEGYVAP---
FETP_ALHEH      MLINEYRLTPVEPRARQFLEKEMENFFFGDGSSAPPDYQP----
FETP_LEGPL      MLINEYRLNLIEARAREFLKEEMQKYFFGEGSDKPSGY------
FETP_LEGPH      MLINEYRLNLIEARAREFLKEEMQKYFFGEGSEKPSGY------
FETP_LEGPC      MLINEYRLNLIEARAREFLKEEMQKYFFGEGSEKPSGY------
FETP_LEGPA      MLINEYRLNLIEARAREFLKEEMQKYFFGEGSEKPSGY------
FETP_HALHL      MLINEYRLTPADPKARSFLEREMENFFFGQGS------APPP--
FETP_CELJU      MLINEKRLNVMDMGTKVYLTEQMHKFLSGEGYDQADGYVPP---
FETP_TERTT      MLINEKQLNLMDLTARAYLTEQMEKFLSGADYDQADGYVP----
FETP_SACD2      MLINEKHLNMMDLTDRTYLNQQMDKFLSGEEYDQAEGYVAP---
FETP_HAHCH      MLINEKRLNLMDPDARTYLTEQMEKFLNNENFDAAEGFVP----
FETP_ALTMD      MLINEHKLNMMEPNARAFLEEKMSAYLFDDVEPTIEGYVPP---
FETP_THICR      ILINEYRLSSLDPKAQNFLKEEMQKFLFG---------------
FETP_PSEA6      MLINEKKLNMMEPTARNFLETQMQAYLFEGKEPDIEGYVPP---
FETP_METCA      MLINEHRLTPFEASARKFLEQEREKFLFGGGTSTPQGYVPP---
FETP_ACIBL      MLLNEYRLQPWKKEHQEFLVQQMEAYFFGEGSEAPKEFVPP---
FETP_COXB2      MLINEYRLSLIDPKARQFLEQEMINFLFGTGSEKPAGY------
FETP_COXBU      MLINEYRLSLIDPKARQFLEQEMINFLFGTGSEKPAGY------
FETP_COXBN      MLINEYRLSLIDPKARQFLEQEMINFLFGTGSEKPAGY------
FETP_COXB1      MLINEYRLSLIDPKARQFLEQEMINFLFGTGSEKPAGY------
FETP_COXBR      MLINEYRLSLIDPKARQFLEQEMINFLFGIGSEKPAGY------
FETP_TOLAT      MLINEKKLNMMNAEHRALLQTEMEKYLFEDGDVQIEGYVPP---
FETP_IDILO      MLINEKRLNMMDPTDREFLEKQMTAFLFEGKAPEIEGYTPP---
FETP_VIBFM      MLINEKKLNMMDPEHRKLLETEMEGFLF-DGKDVVIGYTPP---
FETP_VIBF1      MLINEKKLNMMDPEHRKLLETEMEGFLF-DGKDVVIGYTPP---
FETP_EDWI9      MLINEKKLNMMNPDDRSLLAREMEKFLFEGHDVHIEGYTPP---
FETP_ACIC5      MLLNEYRLQPWTPQAQEFLVEQMNQYFFGEGAQLPKEYVPP---
FETP_SHEDO      MLINEKKLNMMNLEDRQFLEQQMINFLFEGKQVEIEGYVPP---
FETP_PSEU5      MLINERRLNMMNAEDRKFLQGEMDKFFSGEDYAKAEGYVPP---
FETP_MARAV      MLINEKHLNLMDVNNRKYLQAQMERFFNNEPFDQAEGYVPP---
FETP_ALISL      MLINEKKLNMMDPEHRKMLETEMEGFLF-DGKDVVIGYTPP---
FETP_XANAC      MLINENRLSPRDPKHRAFLEAELQKFLFERNADKPEGYVAP---
FETP_HAES2      MLVNEKKLNMMNSEHRQLLEQEMTNFLFEGKDVHIEGYVPP---
FETP_HAES1      MLVNEKKLNMMNSEHRQLLEQEMTNFLFEGKDVHIEGYVPP---
FETP_ANADF      MIMNEYRLSPADPRSQEILYQQAEQFFFSEGAQLPPDYRPP---
FETP_XANOR      MLINENRLSPRDPKHRAFLETELQKFLFERNADKPDGYVAP---
FETP_XANOM      MLINENRLSPRDPKHRAFLETELQKFLFERNADKPDGYVAP---
FETP_AZOVD      MLINERRLNMMNAEDRKFLQAEMEKFLSGEEYAQAEGYVQP---
FETP_ANADE      MILNEYRLSPADPRTTEILFQQAEQFFFGENAQLPPDYRPPPS-
FETP_ACIBY      TLINEKRLNVFEPEAKKFLEEQREKFFNNDSVEKAEGWKP----
FETP_ACIBT      TLINEKRLNVFEPEAKKFLEEQREKFFNNDSVEKAEGWKP----
FETP_ACIBC      TLINEKRLNVFEPEAKKFLEEQREKFFNNDSVEKAEGWKP----
FETP_ACIB5      TLINEKRLNVFEPEAKKFLEEQREKFFNNDSVEKAEGWKP----
FETP_XANC5      MLINENRLSPRDPKHRAFLEAELQKFLFERNADKPEGYVAP---
FETP_SHESR      MLINEKKLNMMNVDDRKFLEEQMTSFLFEGKDVEIEGFVP----
FETP_SHESM      MLINEKKLNMMNVDDRKFLEEQMTSFLFEGKDVEIEGFVP----
FETP_SHESA      MLINEKKLNMMNVDDRKFLEEQMTSFLFEGKDVEIEGFVP----
FETP_SHEPC      MLINEKKLNMMNVDDRKFLEEQMTSFLFEGKEVEIEGFVP----
FETP_SHEPA      MLINEKKLNMMNVEDRKFLEEQMVNFLFEGKDVEIEGYVP----
FETP_SHEB9      MLINEKKLNMMNVDDRKFLEEQMTSFLFEGKEVEIEGFVP----
FETP_SHEB8      MLINEKKLNMMNVDDRKFLEEQMTSFLFEGKEVEIEGFVP----
FETP_SHEB5      MLINEKKLNMMNVDDRKFLEEQMTSFLFEGKEVEIEGFVP----
FETP_SHEB2      MLINEKKLNMMNVDDRKFLEEQMTSFLFEGKEVEIEGFVP----
FETP_SHESW      MLINEKKLNMMNVDDRKFLEEQMTSFLFEGKDVEIEGFVP----
FETP_SHEFN      MLINEKKLNMMNVDDRKFLEEQMTNFLFEGKDVEIEGYVPP---
FETP_PSEPW      MLINEKRLNMMNAEDRKYLQGEMDKFFAGEDYAQAEGYVPP---
FETP_PSEPF      LLINEKRLNMMNAEDRKFLQGEMDKYFSGEEYAQAEGYVPP---
FETP_PSEHT      MLINEKHLNMMDPEHRSFLEQQMVGFLFENKEVEIEGYKPP---
FETP_VIBVY      MLINEKKLNMMDPEHRKLLETEMVNFLFEGKEVHIEGYTPP---
FETP_VIBVU      MLINEKKLNMMDPEHRKLLETEMVNFLFEGKEVHIEGYTPP---
FETP_SHEON      MLINEKKLNMMNVDDRKFLEAQMTSFLFEGKDVEIEGFVP----
FETP_SHEHH      MLINEKKLNMMNVDDRKFLEEQMVNFLFEGKDVEIEGYVP----
FETP_STRM5      MLINENRLSPRTPEHRAFLEGELVKFLFEKDAEKPAGFTP----
FETP_SHEPW      MLINENKLNMMNVDDRKFLEEQMINFLFEGKDVEIEGYVP----
FETP_PSEPK      MLINEKRLNMMNAEDRKFLQAEMDKFFAGEEYAQAEGYVPP---
FETP_PSEPG      MLINEKRLNMMNAEDRKFLQAEMDKFFAGEEYAQAEGYVPP---
FETP_PSEP1      MLINEKRLNMMNAEDRKFLQAEMDKFFAGEEYAQAEGYVPP---
FETP_PSEAE      MLINERRLNMMNAEDRKFLQQEMDKFLSGEDYAKADGYVPPSA-
FETP_PSEAB      MLINERRLNMMNAEDRKFLQQEMDKFLSGEDYAKADGYVPPSA-
FETP_PSEA8      MLINERRLNMMNAEDRKFLQQEMDKFLSGEDYAKADGYVPPSA-
FETP_PSEA7      MLINERRLNMMNAEDRKFLQQEMDKFLSGEDYAKADGYVPPSA-
FETP_HAEDU      MLVNEKKLNMMNPEHRQLLEAEMVNFLFEGKDVHIDGYVP----
FETP_ANASK      MILNEYRLAPADPRTTEILYQQAEQFFFGENAQLPPDYRPPPS-
FETP_ACIAD      TLINEKRLNVFEPEAKKFLEEQREKFFNNDASEKAEGWKP----
FETP_VIBCM      MLINEKKLNMMDPEHRKLLEQEMVNFLFEGKEVHIEGYTPP---
FETP_VIBCH      MLINEKKLNMMDPEHRKLLEQEMVNFLFEGKEVHIEGYTPP---
FETP_VIBC3      MLINEKKLNMMDPEHRKLLEQEMVNFLFEGKEVHIEGYTPP---
FETP_VIBSL      MLINEKKLNMMDPEHRKLLETEMVNFLF-EGKDVVIGYTPP---
FETP_PSEE4      MLINEKRLNMMNAEDRKFIQAEMDKFFAGEDYAQAEGYVPP---
FETP_ACIBS      TLINEKRLNVFEPEAKKFLEEQREKFFNNDSVEKAEGWKP----
FETP_VIBPA      MLINEKKLNMMDPEHRKLLETEMVNFLFEGKDVHIEGYTPP---
FETP_VIBHB      MLINEKKLNMMDPEHRKQLETEMVNFLFEGKDVHIEGYTPP---
FETP_STRMK      MLINENRLSPRTPEHRAFLEGELVKFLFEKDAQKPAGFTP----
FETP_XANCP      MLINENRLSPRDPKHRAFLEAELQKFLFERNADKPEGYVDP---
FETP_XANCB      MLINENRLSPRDPKHRAFLEAELQKFLFERNADKPEGYVDP---
FETP_XANC8      MLINENRLSPRDPKHRAFLEAELQKFLFERNADKPEGYVDP---
FETP_PSEFS      LLINEKRLNMMNAEDRKYLAGEMDKFFSGEEYAKADGYVPP---
FETP_MARMS      MLINEKQLNLMQSESRKYVMEQMDKFFNNEATDKLAGYVDP---
FETP_HAEPS      MLVNEKKLNMMNPEHRQLLETEMVNFLFEGKEVHIEGYVP----
FETP_CHRSD      RLINEKHLSLLDPDARAYLMEQMERFLDNRETDQAEGYVPP---
FETP_PSEMY      MLINERRLNMMNAEDRKFLQTEMDKFLSGEEYAQAEGYVPP---
FETP_AERS4      MLINEKKLNMMNLEHRQLLEKEMVSYLFEAGEVAIDGYTPP---
FETP_AERHH      MLINEKKLNMMNLEHRQLLEKEMVNYLFEAGEVAIDGYTPP---
FETP_PSEF5      LLINEKRLNMMNADDRKYLQGEMDKFFSGEEYAKADGYVPP---
FETP_HAEIE      MLVNEKKLNMMNAEHRKLLEQEMVNFLFEGKDVHIEGYVPP---
FETP_ACTSZ      MLVNEKKLNMMNAEHRKLLEQEMVNFLFEGKDVHIEGYVPP---
FETP_SHESH      MLINEKKLNMMNVDDRKFLEEQMMNFLFEGKEVEIEGYVP----
FETP_HAEIN      MLVNEKKLNMMNAEHRKLLEQEMVNFLFEGKDVHIEGYVPP---
FETP_HAEIG      MLVNEKKLNMMNAEHRKLLEQEMVNFLFEGKDVHIEGYVPP---
FETP_HAEI8      MLVNEKKLNMMNAEHRKLLEQEMVNFLFEGKDVHIEGYVPP---
FETP_COLP3      MLINEKKMNMMNVDDRAFLEAAMVAYLFEGKEPEIEGYVPP---
FETP_ALCBS      MLINEKHLNVMDPEAKRFLDEQRDRFLNNENYEKAEGYVPP---
FETP_PHOPR      MLINEKKLNMMNVDHRKLLETEMVNFLFEGQDVIIEGYTPP---
FETP_PSEU2      LLINERRLNMMNAEDRKFLQTEMDKFLSGEEYAQAEGYVPP---
FETP_PSESM      LLINERRLNMMNAEDRKFLQTEMDKFLSGEEYAQAEGYVPP---
FETP_PSE14      LLINERRLNMMNAEDRKFLQTEMDKFLSGEEYAQAEGYVPP---
FETP_PROMH      MLINEKKLNTMNPDDRKLLEQEMVRFLFEGHDVHIDGYTPP---
FETP_PASMU      MLVNEKKLNMMNADHRQLLEQEMVNFLFEGKDVHIEGYVPP---
FETP_ENTS8      MLINEKKLNMMNPEHRKLLEEEMVNFLFEGKEVHIEGYTPP---
FETP_SHEWM      MLINEKKLNMMNVEDRGFLETQMVNFLFEGKDVEIEGYVP----
FETP_PHOLL      MLINEKKLSTMNPEDRKLLEQEMTKFLFEGHDIQIDGYTPP---
FETP_SHEAM      MLINEKKLNMMNMDHRKXXXXXXXXXXXXGKDVQIEGYVPP---
FETP_ACTPJ      MLVNEKKLSMMNAEHRKLLETEMVNFLFEGKEVQIEGYVP----
FETP_ACTP7      MLVNEKKLSMMNAEHRKLLETEMVNFLFEGKEVQIEGYVP----
FETP_ACTP2      MLVNEKKLSMMNAEHRKLLETEMVNFLFEGKEVQIEGYVP----
FETP_FRAP2      ILINEYRLNLIEPKAKEFLKEEMQKFLFENKEDK----------
FETP_ENT38      MLINEKKLTMMNPDHRKLLEAEMVNFLFEGKEVHIEGYTPP---
FETP_BAUCH      MLINENKLNLISNTDRNFLEKEMIKFLF----------------
FETP_MANSM      MLVNEKKLNMMNADHRKLLEQEMVNFLFEGKDVHIEGYIP----
FETP_SHELP      MLINEKKLNMMNVDDRKFLEEQMVNFLFEGKEVEIEGYVP----
FETP_SERP5      MLINEKKLNMMNVDDRKLLEGEMIKFLFEGHDVHIEGYTPP---
FETP_ERWT9      MLINEKKLSMMNPDDRKLLEQEMIKFLFEGHEVHIEGYTPP---
FETP_KLEP7      MLINEKKLSMMNPEHRKLLEQEMVQFLFEGKDVHIEGYTPP---
FETP_KLEP3      MLINEKKLSMMSPEHRKLLEQEMVQFLFEGKDVHIEGYTPP---
FETP_ERWCT      MLINEKKLSMMNVDDRKLLEQEMIKFLFEGKDVHIEGYTPP---
FETP_YERPY      MLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPP---
FETP_YERPS      MLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPP---
FETP_YERPP      MLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPP---
FETP_YERPG      MLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPP---
FETP_YERPB      MLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPP---
FETP_YERP3      MLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPP---
FETP_PECCP      MLINEKKLSMMNVDDRKLLEQEMIKFLFEGKDVHIEGYTPP---
FETP_FRATT      ILINEYRLNLIEPKAKEFLKEEMHKFLF----------------
FETP_FRATN      ILINEYRLNLIEPKAKEFLKEEMHKFLF----------------
FETP_YERE8      MLINEKKLSMMNVEDRKLLEQEMVNFLFEGQDVHIEGYTPP---
FETP_FRATH      ILINEYRLNLIEPKAKEFLKEEMYKFLF----------------
FETP_FRATF      ILINEYRLNLIEPKAKEFLKEEMYKFLF----------------
FETP_SODGM      MLINEKKISMMNVADRKVLEQEMINFLFEGQDVHIQGYTPP---
FETP_SHISS      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_SHIFL      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_SHIF8      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_SHIDS      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_SHIBS      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_SHIB3      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ESCF3      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECOUT      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECOSM      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECOSE      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECOLU      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECOLI      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECOLC      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECOL5      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECOK1      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECODH      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECOBW      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECO8A      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECO81      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECO7I      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECO5E      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECO57      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECO55      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECO45      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECO27      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_ECO24      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGYTP----
FETP_PSYCK      MLINENHLSMLDPKAKQFLTEQRDKFLDNEDYERAQGWTP----
FETP_CITK8      MLINEKKLNMMNVEHRKLLEQEMINFLFEGKDVHIEGYTP----
FETP_HAMD5      MLINEKKLSMIHHEDRALLEREMIQFLFEGKDVHVSGYIPP---
FETP_ECOL6      MLINEKKLNMMNAEHRKLLEQEMVNFLFEGKEVHIEGFTP----
FETP_YERPN      MLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPP---
FETP_YERPE      MLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPP---
FETP_YERPA      MLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPP---
FETP_PSYA2      MLINENHLSMLDPKAKQFLTEQRDKFLDNEDYERAQGWTP----
FETP_FRATM      ILINEYRLNLIETKAKEFLKEEMHKFLF----------------
FETP_SALTY      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALTI      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALSV      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALPK      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALPC      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALPB      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALPA      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALNS      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALHS      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALG2      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALEP      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALDC      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALCH      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALAR      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_SALA4      MLINEKKLNMMNAEHRKLLEQEMVSFLFEGKDVHIEGYTP----
FETP_XYLFT      MLINENRLSPRNPSHRAXXXXXXXXXXXXRSAAKPEGYIEPDA-
FETP_XYLF2      MLINENRLSPRNPSHRAXXXXXXXXXXXXRSAAKPEGYIEPDA-
FETP_BLOFL      ILINENKLNMLCAKDRSIIEKKMKKF------------------
FETP_XYLFA      MLINENRLSPRNPSHRAXXXXXXXXXXXXRRVAKPEGYIEPDA-
FETP_PSYIN      MLINEKKLKLMNAEDRKIIEDAMIGYLFENKEVDIEGYTP----
FETP_BLOPB      ILINENKLNMMNIADRTILEKEMKIFLFG---------------
FETP_WIGBR      ILINEKQLNMLNKKDRKTIEIEMINFLF----------------
FETP_BUCAP      KLINEEKLNMFNQNDRKKIEKYMKLFLFNN--------------
FETP_BUCAI      ILINEENLNMFNLEHRKKIEKYMKLFLF----------------
FETP_BUCBP      IIINEKKMNMLNKNDQKKIENYMIKFLF----------------