[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF09080.1

[Show Plain Result]


## Summary of Sequence Search
    1::264
   33::257     1e-38  40%  261 aa  ACT3_STRCO RecName: Full=Putative ketoacyl reductase;       
   58::245     7e-36  43%  249 aa  HCDS_XANP2 RecName: Full=2-(S)-hydroxypropyl-CoM dehydrogenase;    
   61::242     3e-35  43%  246 aa  NODG_AZOBR RecName: Full=Nodulation protein G;
   47::254     6e-35  37%  258 aa  BDHA_RHIME RecName: Full=D-beta-hydroxybutyrate dehydrogenase;     
   38::253     2e-33  37%  257 aa  YXJF_BACSU RecName: Full=Uncharacterized oxidoreductase yxjF;      
   55::256     1e-32  38%  258 aa  BDHA_RALEH RecName: Full=D-beta-hydroxybutyrate dehydrogenase;     
   57::249     8e-32  36%  253 aa  BACC2_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
   57::249     2e-31  37%  253 aa  BACC_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
    5::246     3e-31  35%  248 aa  FABG_AQUAE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   33::257     2e-30  37%  261 aa  DHKR_STRCM RecName: Full=Monensin polyketide synthase putative
   46::268     2e-30  36%  272 aa  DHK1_STRVN RecName: Full=Granaticin polyketide synthase putative
   61::246     4e-30  41%  247 aa  FABG1_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   63::250     8e-30  39%  255 aa  FABG_MYCS2 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   52::245     1e-29  38%  246 aa  PHBB_CHRVI RecName: Full=Acetoacetyl-CoA reductase;       
   55::242     3e-29  38%  247 aa  FABG_MYCTU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   55::242     3e-29  38%  247 aa  FABG_MYCBO RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   63::250     5e-29  38%  255 aa  FABG_MYCAV RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   57::242     9e-29  38%  246 aa  PHBB_RALEH RecName: Full=Acetoacetyl-CoA reductase;       
   58::246     1e-28  37%  246 aa  FABG_STAAW RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   58::246     1e-28  37%  246 aa  FABG_STAAS RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   58::246     1e-28  37%  246 aa  FABG_STAAR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   58::246     1e-28  37%  246 aa  FABG_STAAN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   58::246     1e-28  37%  246 aa  FABG_STAAM RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   58::246     1e-28  37%  246 aa  FABG_STAAC RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   74::241     2e-28  41%  241 aa  PHBB_RHIME RecName: Full=Acetoacetyl-CoA reductase;       
   56::243     3e-28  37%  244 aa  FABG_VIBHA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  135::320     3e-28  36%  320 aa  FABG_CUPLA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   36::254     7e-28  34%  256 aa  BUDC_KLEPN RecName: Full=Acetoin(diacetyl) reductase;       
   40::266     1e-27  33%  267 aa  LVR_LEIAQ RecName: Full=Levodione reductase;       
   74::238     1e-27  41%  241 aa  PHBB_ZOORA RecName: Full=Acetoacetyl-CoA reductase;       
   50::243     1e-27  37%  244 aa  FABG_SHIFL RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   50::243     1e-27  37%  244 aa  FABG_ECOLI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::244     2e-27  34%  245 aa  NODG_RHIS3 RecName: Full=Nodulation protein G;
   58::246     3e-27  36%  246 aa  FABG_BACSU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    2::247     1e-26  31%  247 aa  FABG_PSEAE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   57::245     2e-26  38%  250 aa  HCDR_XANP2 RecName: Full=2-(R)-hydroxypropyl-CoM dehydrogenase;    
   56::243     2e-26  36%  244 aa  FABG_VIBCH RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   58::255     4e-26  38%  263 aa  UCPA_SALTY RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   58::255     4e-26  38%  263 aa  UCPA_SALTI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   57::250     4e-26  33%  254 aa  BACC_BACAM RecName: Full=Bacilysin biosynthesis oxidoreductase
   50::244     5e-26  34%  244 aa  FABG_STAES RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   50::244     5e-26  34%  244 aa  FABG_STAEQ RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   58::255     1e-25  38%  263 aa  UCPA_ECOLI RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   56::237     1e-25  36%  242 aa  PHAB_PARDE RecName: Full=Acetoacetyl-CoA reductase;       
   77::240     1e-25  37%  241 aa  FABG_RICPR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    4::244     2e-25  39%  245 aa  NODG_RHIME RecName: Full=Nodulation protein G;AltName:
   58::255     2e-25  38%  263 aa  UCPA_ECO57 RecName: Full=Oxidoreductase ucpA;         EC=1.-.-.-;
   77::240     2e-25  37%  241 aa  FABG_RICTY RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   77::240     3e-25  35%  241 aa  FABG_RICBR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   82::247     5e-25  39%  248 aa  PHAB_ACISR RecName: Full=Acetoacetyl-CoA reductase;       
   31::246     6e-25  34%  253 aa  YOHF_ECOLI RecName: Full=Uncharacterized oxidoreductase yohF;      
   41::255     8e-25  35%  260 aa  DHRS4_RABIT RecName: Full=Dehydrogenase/reductase SDR family member
   59::243     1e-24  34%  244 aa  FABG_BUCAP RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   57::238     1e-24  35%  242 aa  FABG_HAEIN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    8::251     4e-24  29%  256 aa  GNO_GLUOX RecName: Full=Gluconate 5-dehydrogenase;       
   58::250     7e-24  36%  254 aa  KDUD_BACSU RecName: Full=2-dehydro-3-deoxy-D-gluconate
  143::325     7e-24  36%  328 aa  FABG2_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   60::246     8e-24  35%  250 aa  LINC_PSEPA RecName: Full=2,5-dichloro-2,5-cyclohexadiene-1,4-diol
  130::312     8e-24  36%  315 aa  FABG3_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  135::317     8e-24  36%  320 aa  FABG1_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   60::246     2e-23  40%  548 aa  Y4VI_RHISN RecName: Full=Uncharacterized short-chain type
   16::264     2e-23  33%  303 aa  PECR_HUMAN RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
   60::242     2e-23  38%  255 aa  HSD_STREX RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
   44::267     3e-23  36%  303 aa  PECR_RAT RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;    
   58::239     3e-23  38%  260 aa  HSD_MYCTU RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
   58::239     3e-23  38%  260 aa  HSD_MYCBO RecName: Full=3-alpha-(or 20-beta)-hydroxysteroid
   50::243     4e-23  34%  244 aa  FABG_SALTY RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   50::243     4e-23  34%  244 aa  FABG_SALTI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   72::276     6e-23  36%  277 aa  LIMC_RHOER RecName: Full=(-)-trans-carveol dehydrogenase;       
   44::267     7e-23  36%  303 aa  PECR_MOUSE RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
   33::245     9e-23  29%  249 aa  BAIA1_EUBSP RecName: Full=Bile acid 7-dehydroxylase 1/3;       
   41::244     1e-22  36%  247 aa  Y1385_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb1385;   
   41::244     1e-22  36%  247 aa  Y1350_MYCTU RecName: Full=Uncharacterized oxidoreductase
   59::256     1e-22  31%  256 aa  DHSO_RHOSH RecName: Full=Sorbitol dehydrogenase;       
   33::245     2e-22  31%  249 aa  BAIA2_EUBSP RecName: Full=Bile acid 7-dehydroxylase 2;       
   43::252     3e-22  33%  273 aa  YXBG_BACSU RecName: Full=Uncharacterized oxidoreductase yxbG;      
  108::276     3e-22  40%  278 aa  FIXR_BRAJA RecName: Full=Protein fixR;
   72::251     3e-22  35%  254 aa  FABG4_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   56::253     4e-22  31%  254 aa  IDNO_ECOLI RecName: Full=Gluconate 5-dehydrogenase;       
   56::253     4e-22  31%  254 aa  IDNO_ECOL6 RecName: Full=Gluconate 5-dehydrogenase;       
   20::246     4e-22  33%  246 aa  FABG_THEMA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  134::316     5e-22  35%  319 aa  FABG_ARATH RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   51::254     5e-22  30%  258 aa  BUTA_STAAW RecName: Full=Acetoin(diacetyl) reductase;       
   51::254     5e-22  30%  258 aa  BUTA_STAAS RecName: Full=Acetoin(diacetyl) reductase;       
   51::254     5e-22  30%  258 aa  BUTA_STAAR RecName: Full=Acetoin(diacetyl) reductase;       
   51::254     5e-22  30%  258 aa  BUTA_STAAN RecName: Full=Acetoin(diacetyl) reductase;       
   51::254     5e-22  30%  258 aa  BUTA_STAAM RecName: Full=Acetoin(diacetyl) reductase;       
   51::254     5e-22  30%  258 aa  BUTA_STAAC RecName: Full=Acetoin(diacetyl) reductase;       
   16::264     6e-22  33%  303 aa  PECR_PONAB RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
   56::246     8e-22  31%  248 aa  FABG_CHLMU RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  120::261     8e-22  40%  261 aa  DHB8_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
   61::259     8e-22  34%  259 aa  DHB8_CANFA RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
   16::264     1e-21  37%  302 aa  PECR_CAVPO RecName: Full=Peroxisomal trans-2-enoyl-CoA reductase;  
   46::251     1e-21  31%  255 aa  HDHA_ECOLI RecName: Full=7-alpha-hydroxysteroid dehydrogenase;     
   46::251     1e-21  31%  255 aa  HDHA_ECO57 RecName: Full=7-alpha-hydroxysteroid dehydrogenase;     
   56::246     1e-21  30%  248 aa  FABG_CHLTR RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   33::247     2e-21  34%  247 aa  YGFF_ECOLI RecName: Full=Uncharacterized oxidoreductase ygfF;      
  132::314     2e-21  34%  317 aa  FABG5_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   72::258     2e-21  38%  259 aa  CMTB_PSEPU RecName: Full=2,3-dihydroxy-2,3-dihydro-p-cumate
   72::258     2e-21  38%  259 aa  CMTB_PSEP1 RecName: Full=2,3-dihydroxy-2,3-dihydro-p-cumate
   77::240     2e-21  34%  241 aa  FABG_RICFE RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   10::257     5e-21  29%  260 aa  DHRS4_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   57::244     9e-21  31%  245 aa  FABG_BUCBP RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   49::243     9e-21  32%  244 aa  FABG_BUCAI RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   56::249     9e-21  30%  261 aa  DHG_BACSU RecName: Full=Glucose 1-dehydrogenase;       
   62::249     9e-21  30%  261 aa  DHG2_BACME RecName: Full=Glucose 1-dehydrogenase 2;       
   77::240     1e-20  34%  241 aa  FABG_RICCN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
    5::260     1e-20  31%  264 aa  YVAG_BACSU RecName: Full=Uncharacterized oxidoreductase yvaG;      
   53::239     1e-20  36%  242 aa  YMFI_BACSU RecName: Full=Uncharacterized oxidoreductase ymfI;      
   74::249     1e-20  35%  281 aa  Y2146_BRAJA RecName: Full=Probable short-chain type
  102::245     1e-20  35%  257 aa  MOAE_KLEAE RecName: Full=Protein moaE;
  111::268     1e-20  35%  339 aa  DHRS7_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   74::249     2e-20  35%  278 aa  Y4LA_RHISN RecName: Full=Uncharacterized short-chain type
   61::249     2e-20  32%  253 aa  KDUD_ECOLI RecName: Full=2-dehydro-3-deoxy-D-gluconate
   76::247     3e-20  33%  251 aa  Y325_THEMA RecName: Full=Uncharacterized oxidoreductase TM_0325;   
    5::240     3e-20  32%  244 aa  DCXR_BOVIN RecName: Full=L-xylulose reductase;         Short=XR;   
   33::219     3e-20  35%  231 aa  Y2403_STAAW RecName: Full=Uncharacterized oxidoreductase MW2403;   
   33::219     3e-20  35%  231 aa  Y2370_STAAS RecName: Full=Uncharacterized oxidoreductase SAS2370;  
    1::245     3e-20  28%  248 aa  FABG_CHLPN RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   33::218     6e-20  35%  231 aa  Y2778_STAA8 RecName: Full=Uncharacterized oxidoreductase
   33::218     6e-20  35%  231 aa  Y2488_STAAC RecName: Full=Uncharacterized oxidoreductase SACOL2488;
   33::218     6e-20  35%  231 aa  Y2422_STAA3 RecName: Full=Uncharacterized oxidoreductase
   33::258     7e-20  32%  263 aa  YVRD_BACSU RecName: Full=Uncharacterized oxidoreductase yvrD;      
   26::241     7e-20  33%  258 aa  YLX6_SCHPO RecName: Full=Uncharacterized oxidoreductase C922.06;   
   31::240     7e-20  31%  244 aa  CBR2_PIG RecName: Full=Carbonyl reductase [NADPH] 2;       
  104::243     1e-19  39%  244 aa  NOG4_RHIME RecName: Full=Nodulation protein G;AltName:
   49::236     1e-19  36%  240 aa  FABG2_SYNY3 RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   29::232     1e-19  36%  237 aa  CBR4_DANRE RecName: Full=Carbonyl reductase family member 4;       
   33::218     2e-19  35%  231 aa  Y2478_STAAM RecName: Full=Uncharacterized oxidoreductase SAV2478;  
   33::218     2e-19  35%  231 aa  Y2266_STAAN RecName: Full=Uncharacterized oxidoreductase SA2266;   
   60::258     2e-19  32%  259 aa  SRLD_ECOLI RecName: Full=Sorbitol-6-phosphate 2-dehydrogenase;     
    2::245     3e-19  33%  255 aa  YTKK_BACSU RecName: Full=Putative oxidoreductase ytkK;       
   58::247     4e-19  31%  256 aa  Y019_THEMA RecName: Full=Uncharacterized oxidoreductase TM_0019;   
   32::218     5e-19  34%  230 aa  Y2049_STAEQ RecName: Full=Uncharacterized oxidoreductase SERP2049; 
   32::218     5e-19  34%  230 aa  Y2036_STAES RecName: Full=Uncharacterized oxidoreductase SE_2036;  
   53::231     5e-19  36%  236 aa  CBR4_XENTR RecName: Full=Carbonyl reductase family member 4;       
   62::250     6e-19  32%  262 aa  DHGB_BACME RecName: Full=Glucose 1-dehydrogenase B;       
   67::264     6e-19  29%  300 aa  DHB11_MACFA RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
   36::187     6e-19  36%  241 aa  BUDC_KLETE RecName: Full=Acetoin(diacetyl) reductase;       
   14::266     8e-19  29%  268 aa  TRNH_DATST RecName: Full=Tropinone reductase homolog;       
   10::255     8e-19  29%  260 aa  DHRS4_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   33::218     1e-18  34%  231 aa  Y2567_STAAR RecName: Full=Uncharacterized oxidoreductase SAR2567;  
   24::246     1e-18  32%  250 aa  CPNA_COMTE RecName: Full=Cyclopentanol dehydrogenase;       
   24::246     1e-18  32%  250 aa  CPNA_COMS9 RecName: Full=Cyclopentanol dehydrogenase;       
  111::271     1e-18  34%  338 aa  DHRS7_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   84::241     1e-18  34%  298 aa  DHB11_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 11;        
   78::255     1e-18  33%  257 aa  BUTA_STAES RecName: Full=Acetoin(diacetyl) reductase;       
   78::255     1e-18  33%  257 aa  BUTA_STAEQ RecName: Full=Acetoin(diacetyl) reductase;       
   64::257     2e-18  30%  261 aa  YGCW_ECOLI RecName: Full=Uncharacterized oxidoreductase ygcW;      
    1::256     2e-18  31%  269 aa  XYLL_PSEPU RecName:
   67::241     2e-18  32%  300 aa  DHB11_PONAB RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
   79::214     4e-18  40%  259 aa  YQJQ_BACSU RecName: Full=Uncharacterized oxidoreductase yqjQ;      
   79::192     4e-18  39%  238 aa  YOXD_BACSU RecName: Full=Uncharacterized oxidoreductase yoxD;      
   54::232     4e-18  35%  237 aa  CBR4_BOVIN RecName: Full=Carbonyl reductase family member 4;       
   61::198     5e-18  33%  280 aa  YUSZ_BACSU RecName: Full=Uncharacterized oxidoreductase yusZ;      
    6::253     5e-18  28%  256 aa  RHLG_PSEAE RecName: Full=Rhamnolipids biosynthesis
   63::187     5e-18  37%  287 aa  HETN_ANASP RecName: Full=Ketoacyl reductase hetN;       
   67::241     5e-18  32%  300 aa  DHB11_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
   33::242     5e-18  31%  246 aa  DER_CHICK RecName: Full=D-erythrulose reductase;       
   50::198     7e-18  38%  201 aa  FABG6_BRANA RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   66::242     7e-18  31%  309 aa  DRS7B_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
   84::241     7e-18  34%  298 aa  DHB11_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 11;      
   98::266     1e-17  31%  273 aa  TRN1_DATST RecName: Full=Tropinone reductase 1;       
   61::192     1e-17  36%  265 aa  PGDH_CAVPO RecName: Full=15-hydroxyprostaglandin dehydrogenase
   10::255     1e-17  29%  260 aa  DHRS4_RAT RecName: Full=Dehydrogenase/reductase SDR family member
   36::249     1e-17  28%  261 aa  DHG3_BACME RecName: Full=Glucose 1-dehydrogenase 3;       
   30::247     2e-17  32%  254 aa  FADH_BACSU RecName: Full=Probable 2,4-dienoyl-CoA reductase;       
   36::249     2e-17  28%  261 aa  DHGA_BACME RecName: Full=Glucose 1-dehydrogenase A;       
   36::249     2e-17  28%  261 aa  DHG4_BACME RecName: Full=Glucose 1-dehydrogenase 4;       
  361::520     3e-17  38%  894 aa  FOX2_NEUCR RecName: Full=Peroxisomal
  394::545     3e-17  34%  906 aa  FOX2_CANTR RecName: Full=Peroxisomal
   81::253     3e-17  31%  260 aa  TRN2_DATST RecName: Full=Tropinone reductase 2;       
   61::191     3e-17  37%  266 aa  PGDH_MACFA RecName: Full=15-hydroxyprostaglandin dehydrogenase
   61::191     3e-17  37%  266 aa  PGDH_HUMAN RecName: Full=15-hydroxyprostaglandin dehydrogenase
   79::249     3e-17  30%  325 aa  DRS7B_PONAB RecName: Full=Dehydrogenase/reductase SDR family member
   83::247     3e-17  35%  251 aa  DCXR_CAEEL RecName: Full=Probable L-xylulose reductase;       
   73::246     5e-17  31%  248 aa  Y182_METEA RecName: Full=Uncharacterized oxidoreductase
   83::196     5e-17  37%  234 aa  Y0419_STAS1 RecName: Full=Uncharacterized oxidoreductase SSP0419;  
   61::192     5e-17  35%  266 aa  PGDH_BOVIN RecName: Full=15-hydroxyprostaglandin dehydrogenase
   29::221     5e-17  29%  332 aa  KDSR_HUMAN RecName: Full=3-ketodihydrosphingosine reductase;       
   74::300     6e-17  33%  300 aa  GRDH_ORYSJ RecName: Full=Glucose and ribitol dehydrogenase homolog;
  112::261     6e-17  31%  325 aa  DRS7B_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   86::258     8e-17  31%  260 aa  TRN2_HYONI RecName: Full=Tropinone reductase 2;       
   75::271     8e-17  31%  271 aa  SDR1_PICAB RecName: Full=Short-chain type dehydrogenase/reductase; 
  110::247     8e-17  31%  323 aa  DRS7B_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   31::240     8e-17  29%  244 aa  CBR2_MOUSE RecName: Full=Carbonyl reductase [NADPH] 2;       
   61::191     1e-16  37%  269 aa  PGDH_MOUSE RecName: Full=15-hydroxyprostaglandin dehydrogenase
   79::249     1e-16  29%  325 aa  DRS7B_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   35::287     1e-16  28%  289 aa  GRDH2_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog
   37::291     2e-16  28%  291 aa  GRDH_DAUCA RecName: Full=Glucose and ribitol dehydrogenase;        
   56::249     2e-16  30%  258 aa  DHG2_BACSU RecName: Full=Glucose 1-dehydrogenase 2;       
   84::228     2e-16  32%  300 aa  DHB13_HUMAN RecName: Full=17-beta hydroxysteroid dehydrogenase 13; 
   55::303     2e-16  33%  335 aa  DECR_HUMAN RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial; 
   82::277     2e-16  33%  281 aa  ARDH_CANAL RecName: Full=D-arabinitol 2-dehydrogenase
   47::219     2e-16  33%  249 aa  SDH_RHIRD RecName: Full=Serine 3-dehydrogenase;       
   29::221     2e-16  28%  331 aa  KDSR_BOVIN RecName: Full=3-ketodihydrosphingosine reductase;       
   63::233     2e-16  30%  309 aa  DRS7B_XENTR RecName: Full=Dehydrogenase/reductase SDR family member
   61::249     3e-16  27%  253 aa  KDUD_DICD3 RecName: Full=2-dehydro-3-deoxy-D-gluconate
   29::254     3e-16  27%  332 aa  KDSR_MOUSE RecName: Full=3-ketodihydrosphingosine reductase;       
   32::259     3e-16  30%  261 aa  DHBA_BACSU RecName: Full=2,3-dihydro-2,3-dihydroxybenzoate
  482::682     4e-16  34%  689 aa  YUXG_BACSU RecName: Full=Uncharacterized oxidoreductase yuxG;      
    5::244     4e-16  30%  248 aa  YKVO_BACSU RecName: Full=Uncharacterized oxidoreductase ykvO;      
   83::278     4e-16  32%  282 aa  ARDH_CANTR RecName: Full=D-arabinitol 2-dehydrogenase
   63::233     5e-16  29%  323 aa  DRS7B_XENLA RecName: Full=Dehydrogenase/reductase SDR family member
  119::260     5e-16  35%  260 aa  DHB8_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
   59::213     5e-16  34%  344 aa  DHB1_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
  118::259     7e-16  35%  259 aa  DHB8_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 8;       
   58::247     9e-16  31%  251 aa  YJDA_BACSU RecName: Full=Uncharacterized oxidoreductase yjdA;      
   89::285     9e-16  29%  285 aa  YHXC_BACSU RecName: Full=Uncharacterized oxidoreductase yhxC;      
    8::228     9e-16  28%  249 aa  RIDH_KLEAE RecName: Full=Ribitol 2-dehydrogenase;       
  118::286     1e-15  34%  288 aa  GRDH1_ARATH RecName: Full=Glucose and ribitol dehydrogenase homolog
   30::231     1e-15  31%  236 aa  CBR4_XENLA RecName: Full=Carbonyl reductase family member 4;       
   53::267     1e-15  25%  292 aa  SPS19_YEAST RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase
   61::245     1e-15  25%  250 aa  LINX_PSEPA RecName: Full=2,5-dichloro-2,5-cyclohexadiene-1,4-diol
   45::259     1e-15  34%  261 aa  BEND_ACIAD RecName:
   74::274     1e-15  34%  278 aa  ARDH_PICST RecName: Full=D-arabinitol 2-dehydrogenase
   59::213     2e-15  34%  344 aa  DHB1_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 1;       
   75::242     2e-15  28%  245 aa  BDH2_HUMAN RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
   47::219     2e-15  32%  249 aa  SDH_AGRT5 RecName: Full=Serine 3-dehydrogenase;       
   53::245     3e-15  27%  250 aa  FABL_BACSU RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   44::240     3e-15  31%  244 aa  DCXR_RAT RecName: Full=L-xylulose reductase;         Short=XR;     
    1::240     3e-15  30%  244 aa  DCXR_MESAU RecName: Full=L-xylulose reductase;         Short=XR;   
   75::242     3e-15  29%  245 aa  BDH2_MOUSE RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
   75::242     3e-15  28%  245 aa  BDH2_BOVIN RecName: Full=3-hydroxybutyrate dehydrogenase type 2;   
   86::271     4e-15  34%  278 aa  UXUB_BACSU RecName: Full=Uncharacterized oxidoreductase uxuB;      
  113::224     4e-15  39%  316 aa  S16C6_BOVIN RecName: Full=Short chain dehydrogenase/reductase
   92::195     6e-15  38%  900 aa  FOX2_YEAST RecName: Full=Peroxisomal
   12::245     6e-15  28%  260 aa  DHRS4_PIG RecName: Full=Dehydrogenase/reductase SDR family member
  137::252     7e-15  40%  341 aa  RDH10_RAT RecName: Full=Retinol dehydrogenase 10;       
  137::252     7e-15  40%  341 aa  RDH10_MOUSE RecName: Full=Retinol dehydrogenase 10;       
  137::252     7e-15  40%  341 aa  RDH10_HUMAN RecName: Full=Retinol dehydrogenase 10;       
  137::252     7e-15  40%  341 aa  RDH10_BOVIN RecName: Full=Retinol dehydrogenase 10;       
  134::249     7e-15  33%  325 aa  DRS7B_RAT RecName: Full=Dehydrogenase/reductase SDR family member
   91::259     9e-15  29%  266 aa  TRNH1_ARATH RecName: Full=Tropinone reductase homolog At1g07440;   
   77::185     2e-14  40%  251 aa  Y484_MYCTU RecName: Full=Uncharacterized oxidoreductase
   65::261     2e-14  31%  264 aa  STCU_EMENI RecName: Full=Versicolorin reductase;       
   55::303     2e-14  26%  335 aa  DECR_MOUSE RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial; 
  135::250     2e-14  39%  339 aa  RD10A_DANRE RecName: Full=Retinol dehydrogenase 10-A;       
  119::255     2e-14  31%  317 aa  DHRS7_ANOGA RecName: Full=Dehydrogenase/reductase SDR family
  118::259     2e-14  33%  259 aa  DHB8_PIG RecName: Full=Estradiol 17-beta-dehydrogenase 8;       
   67::228     2e-14  31%  300 aa  DHB13_RAT RecName: Full=17-beta hydroxysteroid dehydrogenase 13;   
   31::248     3e-14  32%  248 aa  Y4EL_RHISN RecName: Full=Uncharacterized short-chain type
  137::252     3e-14  39%  341 aa  RDH10_XENTR RecName: Full=Retinol dehydrogenase 10;       
  137::252     3e-14  39%  341 aa  RD10B_XENLA RecName: Full=Retinol dehydrogenase 10-B;       
  135::260     3e-14  30%  326 aa  DHRS7_DROME RecName: Full=Dehydrogenase/reductase SDR family
   55::303     3e-14  25%  335 aa  DECR_RAT RecName: Full=2,4-dienoyl-CoA reductase, mitochondrial;   
   54::232     3e-14  31%  237 aa  CBR4_HUMAN RecName: Full=Carbonyl reductase family member 4;       
  137::252     4e-14  38%  341 aa  RD10A_XENLA RecName: Full=Retinol dehydrogenase 10-A;       
   76::240     4e-14  34%  242 aa  FABG_ACTAC RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   61::202     4e-14  30%  261 aa  DHG_BACME RecName: Full=Glucose 1-dehydrogenase;       
   67::238     5e-14  33%  267 aa  YM71_YEAST RecName: Full=Uncharacterized oxidoreductase YMR226C;   
   57::264     5e-14  32%  267 aa  SORD_KLEPN RecName: Full=Sorbitol-6-phosphate 2-dehydrogenase;     
   61::202     5e-14  30%  261 aa  DHG1_BACME RecName: Full=Glucose 1-dehydrogenase 1;       
  132::243     8e-14  41%  336 aa  RD10B_DANRE RecName: Full=Retinol dehydrogenase 10-B;       
   42::255     8e-14  32%  256 aa  MTDH_UROFA RecName: Full=Probable NADP-dependent mannitol
   86::229     1e-13  36%  736 aa  DHB4_HUMAN RecName: Full=Peroxisomal multifunctional enzyme type 2;
   61::234     1e-13  30%  246 aa  Y1627_STAS1 RecName: Full=Uncharacterized oxidoreductase SSP1627;  
   45::259     1e-13  28%  262 aa  VER1_ASPPA RecName: Full=Versicolorin reductase;       
   96::223     1e-13  30%  311 aa  DRS7C_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
   83::270     1e-13  28%  292 aa  DECR2_HUMAN RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
   52::231     1e-13  33%  236 aa  CBR4_MOUSE RecName: Full=Carbonyl reductase family member 4;       
   71::261     2e-13  26%  272 aa  THR1_GLOLA RecName: Full=Trihydroxynaphthalene reductase;       
   86::229     2e-13  35%  735 aa  DHB4_RAT RecName: Full=Peroxisomal multifunctional enzyme type 2;  
   86::229     2e-13  35%  735 aa  DHB4_MOUSE RecName: Full=Peroxisomal multifunctional enzyme type 2;
   75::219     2e-13  36%  248 aa  YDFG_ECOL6 RecName: Full=NADP-dependent L-serine/L-allo-threonine
   75::219     2e-13  36%  248 aa  YDFG_ECO57 RecName: Full=NADP-dependent L-serine/L-allo-threonine
   54::249     2e-13  30%  253 aa  Y4MP_RHISN RecName: Full=Uncharacterized short-chain type
  112::228     2e-13  34%  304 aa  DHB13_MOUSE RecName: Full=17-beta hydroxysteroid dehydrogenase 13; 
   83::270     2e-13  27%  292 aa  DECR2_PONAB RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
   75::219     3e-13  36%  248 aa  YDFG_ECOLI RecName: Full=NADP-dependent L-serine/L-allo-threonine
   84::251     3e-13  33%  255 aa  SOU1_SCHPO RecName: Full=Sorbose reductase sou1;       
  117::228     3e-13  34%  309 aa  RDHE2_MOUSE RecName: Full=Epidermal retinal dehydrogenase 2;       
  262::422     3e-13  32%  430 aa  MAS1_AGRT9 RecName: Full=Agropine synthesis reductase;       
   27::219     4e-13  32%  248 aa  YDFG_SHIFL RecName: Full=NADP-dependent L-serine/L-allo-threonine
   60::229     4e-13  27%  253 aa  Y945_MYCTU RecName: Full=Uncharacterized oxidoreductase
   34::185     7e-13  31%  292 aa  YQ53_SCHPO RecName: Full=Uncharacterized oxidoreductase C162.03;   
   29::185     7e-13  35%  275 aa  TODD_PSEP1 RecName: Full=Cis-toluene dihydrodiol dehydrogenase;    
  110::224     7e-13  39%  316 aa  S16C6_MOUSE RecName: Full=Short chain dehydrogenase/reductase
   29::185     7e-13  35%  275 aa  BNZE_PSEPU RecName: Full=Cis-1,2-dihydrobenzene-1,2-diol
    2::132     9e-13  33%  134 aa  DHB8_CALJA RecName: Full=Estradiol 17-beta-dehydrogenase 8;        
   63::231     9e-13  34%  236 aa  CBR4_RAT RecName: Full=Carbonyl reductase family member 4;       
   98::231     1e-12  34%  334 aa  KDSR_DICDI RecName: Full=3-ketodihydrosphingosine reductase;       
    5::240     1e-12  27%  244 aa  DCXR_HUMAN RecName: Full=L-xylulose reductase;         Short=XR;   
  100::288     2e-12  28%  289 aa  YHDF_BACSU RecName: Full=Uncharacterized oxidoreductase yhdF;      
   83::273     2e-12  28%  292 aa  DECR2_MOUSE RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
   32::245     3e-12  26%  291 aa  DHI1_SAISC RecName: Full=Corticosteroid 11-beta-dehydrogenase
   29::191     3e-12  35%  276 aa  BPHB_PSES1 RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
   51::272     3e-12  27%  309 aa  YWC4_CAEEL RecName: Full=Uncharacterized oxidoreductase W01C9.4;   
   75::219     3e-12  35%  248 aa  YDFG_SALTY RecName: Full=NADP-dependent L-serine/L-allo-threonine
   75::219     3e-12  35%  248 aa  YDFG_SALTI RecName: Full=NADP-dependent L-serine/L-allo-threonine
   81::200     3e-12  31%  311 aa  RDH8_HUMAN RecName: Full=Retinol dehydrogenase 8;       
   59::245     3e-12  34%  249 aa  DHK2_STRVN RecName: Full=Granaticin polyketide synthase putative
  134::248     3e-12  34%  320 aa  DHB12_XENTR RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   90::277     3e-12  28%  300 aa  DECR2_DANRE RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
    1::240     3e-12  27%  244 aa  DCXR_MOUSE RecName: Full=L-xylulose reductase;         Short=XR;   
   97::224     4e-12  28%  312 aa  DRS7C_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   92::228     6e-12  31%  309 aa  RDHE2_HUMAN RecName: Full=Epidermal retinal dehydrogenase 2;       
   84::192     6e-12  32%  441 aa  MFEA_DICDI RecName: Full=Peroxisomal multifunctional enzyme A;     
   96::235     6e-12  28%  311 aa  DRS7C_XENTR RecName: Full=Dehydrogenase/reductase SDR family member
   96::223     6e-12  29%  311 aa  DRS7C_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   78::283     7e-12  25%  283 aa  T4HR_MAGGR RecName: Full=Tetrahydroxynaphthalene reductase;        
  348::552     7e-12  28%  592 aa  EPHD_MYCTU RecName: Full=Probable oxidoreductase ephD;       
  348::552     7e-12  28%  592 aa  EPHD_MYCBO RecName: Full=Probable oxidoreductase ephD;       
   76::246     7e-12  31%  248 aa  ENTA_ECOLI RecName: Full=2,3-dihydro-2,3-dihydroxybenzoate
   55::231     1e-11  37%  255 aa  HCD2_DROME RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   83::273     1e-11  27%  292 aa  DECR2_RAT RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;     
    1::240     1e-11  27%  244 aa  DCXR_CAVPO RecName: Full=L-xylulose reductase;         Short=XR;   
  157::295     1e-11  32%  299 aa  YHXD_BACSU RecName: Full=Uncharacterized oxidoreductase yhxD;      
   54::192     1e-11  28%  253 aa  Y5909_MYXXD RecName: Full=Uncharacterized oxidoreductase MXAN_5909;
  137::235     1e-11  38%  339 aa  BDH_CHICK RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
  115::284     2e-11  31%  286 aa  YAY8_SCHPO RecName: Full=Uncharacterized oxidoreductase C4H3.08;   
   58::219     2e-11  30%  231 aa  Y0585_STAHJ RecName: Full=Uncharacterized oxidoreductase SH0585;   
   44::213     2e-11  39%  317 aa  RDH16_HUMAN RecName: Full=Retinol dehydrogenase 16;       
   63::206     2e-11  37%  261 aa  HCD2_HUMAN RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   90::281     2e-11  28%  286 aa  GS39_BACSU RecName: Full=General stress protein 39;       
   34::240     2e-11  34%  248 aa  Y4EK_RHISN RecName: Full=Uncharacterized short-chain type
   77::213     2e-11  39%  317 aa  RDH2_RAT RecName: Full=Retinol dehydrogenase 2;       
   70::239     2e-11  28%  260 aa  DHR11_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   70::244     2e-11  27%  260 aa  DHR11_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   61::191     3e-11  31%  266 aa  PGDH_RAT RecName: Full=15-hydroxyprostaglandin dehydrogenase
   75::236     3e-11  30%  312 aa  DHB12_ANAPL RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   63::189     3e-11  39%  258 aa  ADH2_CERRO RecName: Full=Alcohol dehydrogenase 2;       
   63::189     3e-11  39%  258 aa  ADH2_CERCO RecName: Full=Alcohol dehydrogenase 2;       
  108::291     4e-11  24%  294 aa  YGHA_ECOLI RecName: Full=Uncharacterized oxidoreductase yghA;      
  108::291     4e-11  24%  294 aa  YGHA_ECO57 RecName: Full=Uncharacterized oxidoreductase yghA;      
   83::277     4e-11  27%  281 aa  SOU1_CANAL RecName: Full=Sorbose reductase SOU1;       
   77::213     4e-11  43%  317 aa  RDH7_RAT RecName: Full=Retinol dehydrogenase 7;       
   77::213     4e-11  43%  317 aa  RDH3_RAT RecName: Full=Retinol dehydrogenase 3;       
   44::211     4e-11  40%  317 aa  H17B6_HUMAN RecName: Full=Hydroxysteroid 17-beta dehydrogenase 6;  
   32::245     4e-11  27%  292 aa  DHI1_HUMAN RecName: Full=Corticosteroid 11-beta-dehydrogenase
   29::255     4e-11  28%  280 aa  BPHB_RHOGO RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
  253::422     5e-11  29%  430 aa  MAS12_AGRRH RecName: Full=Agropine synthesis reductase;       
   54::246     5e-11  27%  318 aa  DH12B_XENLA RecName: Full=Estradiol 17-beta-dehydrogenase 12-B;    
   93::224     6e-11  34%  252 aa  Y1430_HAEIN RecName: Full=Probable NADP-dependent dehydrogenase
  140::253     6e-11  35%  339 aa  MKAR_AJECN RecName: Full=3-ketoacyl-CoA reductase;       
   65::234     6e-11  30%  255 aa  DHR11_CHICK RecName: Full=Dehydrogenase/reductase SDR family member
   54::246     6e-11  27%  318 aa  DH12A_XENLA RecName: Full=Estradiol 17-beta-dehydrogenase 12-A;    
   77::211     8e-11  36%  317 aa  H17B6_BOVIN RecName: Full=Hydroxysteroid 17-beta dehydrogenase 6;  
   59::191     8e-11  32%  328 aa  DHB1_PANTR RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
   59::191     8e-11  32%  328 aa  DHB1_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 1;        
   93::239     8e-11  32%  343 aa  BDH_RAT RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
  141::239     8e-11  38%  343 aa  BDH_HUMAN RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
   63::189     8e-11  38%  258 aa  ADH_BACOL RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   41::253     1e-10  26%  258 aa  DHRS2_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   77::241     1e-10  29%  312 aa  DHB12_MACFA RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
  127::241     1e-10  32%  312 aa  DHB12_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
  141::239     1e-10  37%  343 aa  BDH_MOUSE RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
  141::239     1e-10  38%  344 aa  BDH_BOVIN RecName: Full=D-beta-hydroxybutyrate dehydrogenase,
   96::199     1e-10  34%  252 aa  YCIK_ECOLI RecName: Full=Uncharacterized oxidoreductase yciK;      
   90::260     1e-10  27%  262 aa  VIBA_VIBCH RecName: Full=Vibriobactin-specific
  102::283     1e-10  36%  289 aa  PTR1_LEITA RecName: Full=Pteridine reductase 1;       
   58::248     1e-10  28%  346 aa  MKAR_PICST RecName: Full=3-ketoacyl-CoA reductase;       
  111::252     1e-10  30%  316 aa  DHRS7_DICDI RecName: Full=Dehydrogenase/reductase SDR family
   59::248     1e-10  28%  270 aa  DHB14_HUMAN RecName: Full=17-beta-hydroxysteroid dehydrogenase 14; 
   76::191     1e-10  42%  281 aa  BPHB_COMTE RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
   91::194     2e-10  34%  269 aa  YBBO_ECOLI RecName: Full=Uncharacterized oxidoreductase ybbO;      
   91::194     2e-10  34%  269 aa  YBBO_ECOL6 RecName: Full=Uncharacterized oxidoreductase ybbO;      
   33::246     2e-10  30%  277 aa  BPHB_PSEPU RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
   63::189     2e-10  37%  257 aa  ADH1_CERCA RecName: Full=Alcohol dehydrogenase 1;       
   67::256     2e-10  30%  331 aa  HSDL1_CHICK RecName: Full=Hydroxysteroid dehydrogenase-like protein
   66::226     2e-10  29%  302 aa  DHRS3_BOVIN RecName: Full=Short-chain dehydrogenase/reductase 3;   
   76::273     2e-10  29%  285 aa  ABA2_ARATH RecName: Full=Xanthoxin dehydrogenase;       
   66::226     3e-10  29%  302 aa  DHRS3_MOUSE RecName: Full=Short-chain dehydrogenase/reductase 3;   
   66::226     3e-10  29%  302 aa  DHRS3_HUMAN RecName: Full=Short-chain dehydrogenase/reductase 3;   
   77::241     3e-10  30%  312 aa  DHB12_BOVIN RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   56::247     3e-10  27%  319 aa  DH12A_DANRE RecName: Full=Estradiol 17-beta-dehydrogenase 12-A;    
   52::273     4e-10  24%  313 aa  YXEK_CAEEL RecName: Full=Uncharacterized oxidoreductase F53C11.3;  
  112::257     4e-10  31%  271 aa  DHMA_FLAS1 RecName: Full=N-acylmannosamine 1-dehydrogenase;        
  133::270     4e-10  32%  381 aa  DHB2_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 2;        
   61::246     5e-10  33%  255 aa  Y3106_PSEAE RecName: Full=Uncharacterized oxidoreductase PA3106;   
   63::206     5e-10  36%  261 aa  HCD2_RAT RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;     
   22::272     7e-10  31%  309 aa  YVX3_CAEEL RecName: Full=Uncharacterized oxidoreductase T05C12.3;  
   22::150     7e-10  26%  236 aa  YI78_SCHPO RecName: Full=Uncharacterized oxidoreductase
   63::189     7e-10  37%  258 aa  ADH2_CERCA RecName: Full=Alcohol dehydrogenase 2;       
   54::256     9e-10  20%  259 aa  YWFH_BACSU RecName: Full=Bacilysin biosynthesis oxidoreductase
   65::194     9e-10  30%  259 aa  YI13_SCHPO RecName: Full=Uncharacterized oxidoreductase C521.03;   
   32::226     9e-10  26%  248 aa  Y452_LISIN RecName: Full=Uncharacterized oxidoreductase Lin0452;   
   76::226     9e-10  28%  248 aa  Y432_LISMO RecName: Full=Uncharacterized oxidoreductase Lmo0432;   
  133::219     9e-10  38%  236 aa  FABG_SCHPO RecName: Full=3-oxoacyl-[acyl-carrier-protein]
   33::206     9e-10  32%  313 aa  DHRS1_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
   32::186     1e-09  23%  271 aa  VDLC_HELPJ RecName: Full=Probable short-chain type
   63::210     1e-09  33%  313 aa  DR9C7_MOUSE RecName: Full=Short chain dehydrogenase/reductase
   65::234     1e-09  27%  255 aa  DHR11_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
  132::270     1e-09  33%  386 aa  DHI2_MOUSE RecName: Full=Corticosteroid 11-beta-dehydrogenase
   63::206     2e-09  35%  261 aa  HCD2_MOUSE RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   32::245     2e-09  26%  292 aa  DHI1_RABIT RecName: Full=Corticosteroid 11-beta-dehydrogenase
   99::262     2e-09  29%  266 aa  DCXR_TRIRE RecName: Full=L-xylulose reductase;         Short=XR;   
  105::197     2e-09  44%  278 aa  ADHR_DROPS RecName: Full=Alcohol dehydrogenase-related 31 kDa
  105::197     2e-09  44%  278 aa  ADHR_DROPE RecName: Full=Alcohol dehydrogenase-related 31 kDa
   60::261     2e-09  25%  262 aa  MTDH_AGABI RecName: Full=NADP-dependent mannitol dehydrogenase;    
   56::246     2e-09  28%  341 aa  MKAR_PICGU RecName: Full=3-ketoacyl-CoA reductase;       
   41::245     2e-09  27%  260 aa  DHRS4_PONAB RecName: Full=Dehydrogenase/reductase SDR family member
   41::245     2e-09  27%  260 aa  DHRS4_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   63::189     2e-09  37%  257 aa  ADH1_CERCO RecName: Full=Alcohol dehydrogenase 1;       
  136::237     3e-09  32%  332 aa  MKAR_NEUCR RecName: Full=3-ketoacyl-CoA reductase;       
  117::255     3e-09  33%  330 aa  HSDL1_HUMAN RecName: Full=Hydroxysteroid dehydrogenase-like protein
  133::271     3e-09  30%  381 aa  DHB2_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 2;       
   29::191     3e-09  31%  277 aa  BPHB_BURXL RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
  105::197     3e-09  44%  272 aa  ADHR_DROTE RecName: Full=Alcohol dehydrogenase-related 31 kDa
  105::197     3e-09  44%  272 aa  ADHR_DROMA RecName: Full=Alcohol dehydrogenase-related 31 kDa
  105::197     3e-09  44%  202 aa  ADHR_DROER RecName: Full=Alcohol dehydrogenase-related 31 kDa
  100::211     3e-09  34%  267 aa  MTDH_CLAHE RecName: Full=Probable NADP-dependent mannitol
  117::255     3e-09  33%  330 aa  HSDL1_BOVIN RecName: Full=Hydroxysteroid dehydrogenase-like protein
   55::196     3e-09  33%  261 aa  HCD2_BOVIN RecName: Full=3-hydroxyacyl-CoA dehydrogenase type-2;   
   55::213     3e-09  33%  319 aa  DHRS9_BOVIN RecName: Full=Dehydrogenase/reductase SDR family member
  105::194     3e-09  45%  279 aa  ADHR_DROSU RecName: Full=Alcohol dehydrogenase-related 31 kDa
  105::194     3e-09  45%  279 aa  ADHR_DROGU RecName: Full=Alcohol dehydrogenase-related 31 kDa
   99::262     5e-09  29%  266 aa  MTDH_ALTAL RecName: Full=Probable NADP-dependent mannitol
   90::245     5e-09  31%  340 aa  MKAR_PODAN RecName: Full=3-ketoacyl-CoA reductase;       
   40::249     5e-09  27%  267 aa  HDHA_CLOSO RecName: Full=NADP-dependent 7-alpha-hydroxysteroid
   96::219     5e-09  25%  324 aa  DS7CA_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
  105::197     5e-09  44%  272 aa  ADHR_DROME RecName: Full=Alcohol dehydrogenase-related 31 kDa
  105::194     5e-09  44%  279 aa  ADHR_DROMD RecName: Full=Alcohol dehydrogenase-related 31 kDa
  105::197     5e-09  43%  269 aa  ADHR_DROLE RecName: Full=Alcohol dehydrogenase-related 31 kDa
   77::212     6e-09  36%  316 aa  RDH7_MOUSE RecName: Full=Retinol dehydrogenase 7;       
   83::241     6e-09  29%  341 aa  MKAR_SCHPO RecName: Full=3-ketoacyl-CoA reductase;       
  140::249     6e-09  36%  350 aa  MKAR_LODEL RecName: Full=3-ketoacyl-CoA reductase;       
  145::255     6e-09  32%  330 aa  HSDL1_PONAB RecName: Full=Hydroxysteroid dehydrogenase-like protein
  127::241     6e-09  28%  312 aa  DHB12_RAT RecName: Full=Estradiol 17-beta-dehydrogenase 12;        
  105::197     6e-09  44%  273 aa  ADHR_DROIM RecName: Full=Alcohol dehydrogenase-related 31 kDa
  105::194     6e-09  45%  281 aa  ADHR_DROAM RecName: Full=Alcohol dehydrogenase-related 31 kDa
   55::233     8e-09  30%  237 aa  YJGI_ECOLI RecName: Full=Uncharacterized oxidoreductase yjgI;      
  136::278     8e-09  25%  285 aa  Y048_HAEIN RecName: Full=Uncharacterized oxidoreductase HI0048;    
   83::235     8e-09  29%  280 aa  SOU2_CANAL RecName: Full=Sorbose reductase homolog SOU2;       
  108::212     8e-09  37%  318 aa  RDH1_HUMAN RecName: Full=11-cis retinol dehydrogenase;       
   69::208     8e-09  27%  274 aa  MOMAS_ORYSJ RecName: Full=Momilactone A synthase;       
   48::237     8e-09  27%  311 aa  DH12B_DANRE RecName: Full=Estradiol 17-beta-dehydrogenase 12-B;    
   43::184     1e-08  24%  284 aa  VDLC_HELPY RecName: Full=Probable short-chain type
  100::326     1e-08  30%  336 aa  TS2_MAIZE RecName: Full=Sex determination protein tasselseed-2;
  113::231     1e-08  34%  323 aa  S16C6_HUMAN RecName: Full=Short chain dehydrogenase/reductase
  146::247     1e-08  34%  342 aa  MKAR_CHAGB RecName: Full=3-ketoacyl-CoA reductase;       
   32::245     1e-08  25%  292 aa  DHI1_MESAU RecName: Full=Corticosteroid 11-beta-dehydrogenase
   78::208     2e-08  33%  261 aa  YF3H_SCHPO RecName: Full=Uncharacterized oxidoreductase C22A12.17c;
   58::248     2e-08  28%  346 aa  MKAR_DEBHA RecName: Full=3-ketoacyl-CoA reductase;       
  259::422     2e-08  30%  430 aa  MAS11_AGRRH RecName: Full=Agropine synthesis reductase;       
   77::213     2e-08  32%  319 aa  DHRS9_MOUSE RecName: Full=Dehydrogenase/reductase SDR family member
  164::270     2e-08  34%  400 aa  DHI2_RAT RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme
  164::270     2e-08  35%  406 aa  DHI2_RABIT RecName: Full=Corticosteroid 11-beta-dehydrogenase
  127::241     2e-08  28%  312 aa  DHB12_MOUSE RecName: Full=Estradiol 17-beta-dehydrogenase 12;      
   11::125     2e-08  30%  166 aa  CSGA_MYXXA RecName: Full=C-factor;AltName: Full=C signal;
   83::191     2e-08  38%  258 aa  25KD_SARPE RecName: Full=Development-specific 25 kDa protein;
  179::282     2e-08  40%  288 aa  PTR1_LEIMA RecName: Full=Pteridine reductase 1;       
  136::237     2e-08  31%  331 aa  MKAR_MAGGR RecName: Full=3-ketoacyl-CoA reductase;       
   58::249     2e-08  26%  349 aa  MKAR_CANAL RecName: Full=3-ketoacyl-CoA reductase;       
   38::192     2e-08  32%  280 aa  HCAB_PHOLL RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  104::234     2e-08  24%  318 aa  DS7CB_DANRE RecName: Full=Dehydrogenase/reductase SDR family member
   57::229     2e-08  28%  230 aa  DR4L2_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
  154::255     3e-08  30%  353 aa  MKAR_ASPTN RecName: Full=3-ketoacyl-CoA reductase;       
   32::245     3e-08  27%  292 aa  DHI1_SHEEP RecName: Full=Corticosteroid 11-beta-dehydrogenase
   32::245     3e-08  24%  292 aa  DHI1_MOUSE RecName: Full=Corticosteroid 11-beta-dehydrogenase
   62::220     3e-08  27%  270 aa  DHB14_BOVIN RecName: Full=17-beta-hydroxysteroid dehydrogenase 14; 
   77::247     3e-08  33%  275 aa  BPHB_PSEPS RecName: Full=Cis-2,3-dihydrobiphenyl-2,3-diol
   48::230     4e-08  26%  296 aa  YAEB_SCHPO RecName: Full=Uncharacterized oxidoreductase C23D3.11;  
  142::251     4e-08  35%  347 aa  MKAR_VANPO RecName: Full=3-ketoacyl-CoA reductase;       
   73::210     4e-08  35%  313 aa  DR9C7_BOVIN RecName: Full=Short chain dehydrogenase/reductase
   51::253     5e-08  26%  259 aa  NAHB_PSEPU RecName: Full=1,2-dihydroxy-1,2-dihydronaphthalene
   64::225     5e-08  26%  418 aa  HSDL2_HUMAN RecName: Full=Hydroxysteroid dehydrogenase-like protein
   51::253     7e-08  26%  259 aa  NAHB_PSEU8 RecName: Full=1,2-dihydroxy-1,2-dihydronaphthalene
  143::250     7e-08  30%  346 aa  MKAR_KLULA RecName: Full=3-ketoacyl-CoA reductase;       
  147::248     7e-08  29%  346 aa  MKAR_ASPOR RecName: Full=3-ketoacyl-CoA reductase;       
  109::213     7e-08  34%  319 aa  DHRS9_RAT RecName: Full=Dehydrogenase/reductase SDR family member
    1::129     9e-08  29%  129 aa  YUSR_BACSU RecName: Full=Short-chain dehydrogenase/reductase
   56::208     9e-08  25%  261 aa  YQC8_SCHPO RecName: Full=Uncharacterized oxidoreductase C1739.08c; 
  105::192     9e-08  33%  312 aa  RDH8_BOVIN RecName: Full=Retinol dehydrogenase 8;       
  146::247     9e-08  28%  345 aa  MKAR_ASPCL RecName: Full=3-ketoacyl-CoA reductase;       
   64::225     9e-08  26%  418 aa  HSDL2_PONAB RecName: Full=Hydroxysteroid dehydrogenase-like protein
   79::210     1e-07  36%  313 aa  DR9C7_HUMAN RecName: Full=Short chain dehydrogenase/reductase
    1::240     1e-07  32%  254 aa  3BHD_COMTE RecName: Full=3-beta-hydroxysteroid dehydrogenase;      
   47::245     1e-07  31%  341 aa  Y1570_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb1570;   
   47::245     1e-07  31%  341 aa  Y1543_MYCTU RecName: Full=Uncharacterized oxidoreductase
   28::259     1e-07  24%  288 aa  DHI1_RAT RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme
   46::253     2e-07  30%  298 aa  OXIR_STRAT RecName: Full=Probable oxidoreductase;       
  147::248     2e-07  29%  346 aa  MKAR_EMENI RecName: Full=3-ketoacyl-CoA reductase;       
   13::204     2e-07  21%  295 aa  ACR1_ACIBI RecName: Full=Fatty acyl-CoA reductase;       
   21::212     2e-07  21%  303 aa  ACR1_ACIAD RecName: Full=Fatty acyl-CoA reductase;       
  146::247     2e-07  28%  345 aa  MKAR_NEOFI RecName: Full=3-ketoacyl-CoA reductase;       
  146::247     2e-07  28%  345 aa  MKAR_ASPFU RecName: Full=3-ketoacyl-CoA reductase;       
  146::247     2e-07  28%  345 aa  MKAR_ASPFC RecName: Full=3-ketoacyl-CoA reductase;       
   74::237     2e-07  29%  305 aa  LIGD_PSEPA RecName: Full=C alpha-dehydrogenase;         EC=1.-.-.-;
   71::212     3e-07  30%  318 aa  RDH1_BOVIN RecName: Full=11-cis retinol dehydrogenase;       
   77::194     3e-07  34%  297 aa  AYR1_YEAST RecName: Full=NADPH-dependent 1-acyldihydroxyacetone
  145::255     4e-07  30%  330 aa  HSDL1_RAT RecName: Full=Hydroxysteroid dehydrogenase-like protein
   93::250     4e-07  29%  330 aa  HSDL1_MOUSE RecName: Full=Hydroxysteroid dehydrogenase-like protein
  132::269     4e-07  31%  387 aa  DHB2_HUMAN RecName: Full=Estradiol 17-beta-dehydrogenase 2;        
   98::239     6e-07  32%  316 aa  RDH12_HUMAN RecName: Full=Retinol dehydrogenase 12;       
  137::238     6e-07  31%  334 aa  MKAR_SCLS1 RecName: Full=3-ketoacyl-CoA reductase;       
  134::235     6e-07  31%  331 aa  MKAR_BOTFB RecName: Full=3-ketoacyl-CoA reductase;       
   59::197     7e-07  26%  263 aa  YIV6_YEAST RecName: Full=Uncharacterized oxidoreductase YIR036C;   
   90::229     7e-07  26%  308 aa  YD114_YEAST RecName: Full=Uncharacterized oxidoreductase YDL114W;  
  127::287     7e-07  33%  349 aa  STDH3_CAEEL RecName: Full=Putative steroid dehydrogenase 3;        
  118::239     7e-07  33%  334 aa  RDH13_MOUSE RecName: Full=Retinol dehydrogenase 13;       
   98::239     7e-07  31%  316 aa  RDH12_BOVIN RecName: Full=Retinol dehydrogenase 12;       
  160::250     7e-07  34%  262 aa  FABI_HAEIN RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   84::230     7e-07  30%  249 aa  BZRD_BACCE RecName: Full=Benzil reductase;         EC=1.1.1.n7;
   85::189     7e-07  36%  254 aa  ADH_SCAAL RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     7e-07  36%  254 aa  ADH_DROCR RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   55::204     9e-07  28%  254 aa  YIV5_YEAST RecName: Full=Uncharacterized oxidoreductase YIR035C;   
  109::192     9e-07  37%  270 aa  HCAB_ECO5E RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     9e-07  37%  270 aa  HCAB_ECO57 RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   85::189     9e-07  35%  254 aa  ADH_DROSL RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   81::206     1e-06  28%  313 aa  DHRS1_HUMAN RecName: Full=Dehydrogenase/reductase SDR family member
   85::189     1e-06  34%  254 aa  ADH_DROMM RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     1e-06  36%  254 aa  ADH_DROHE RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  100::241     2e-06  31%  318 aa  RDH11_HUMAN RecName: Full=Retinol dehydrogenase 11;       
   85::189     2e-06  38%  254 aa  ADH2_DROBU RecName: Full=Alcohol dehydrogenase 2;       
   78::271     2e-06  31%  297 aa  OXIR_STRLI RecName: Full=Probable oxidoreductase;       
   77::211     2e-06  35%  317 aa  H17B6_RAT RecName: Full=Hydroxysteroid 17-beta dehydrogenase 6;    
   87::191     2e-06  35%  256 aa  ADH_ZAPTU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     2e-06  35%  254 aa  ADH2_DROMU RecName: Full=Alcohol dehydrogenase 2;       
   73::232     3e-06  32%  316 aa  LE767_CAEEL RecName: Full=Putative steroid dehydrogenase let-767;  
  109::192     3e-06  36%  270 aa  HCAB_ECO7I RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
   77::186     3e-06  31%  243 aa  BZRD_BACSU RecName: Full=Benzil reductase;         EC=1.1.1.n7;
   85::189     3e-06  34%  254 aa  ADH_DROMY RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  101::189     3e-06  35%  254 aa  ADH_DROLE RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     3e-06  35%  254 aa  ADH_DROLA RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     3e-06  35%  254 aa  ADH_DROBO RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     3e-06  34%  254 aa  ADH2_DROAR RecName: Full=Alcohol dehydrogenase 2;       
   85::189     3e-06  34%  254 aa  ADH1_DRONA RecName: Full=Alcohol dehydrogenase 1;       
   85::189     3e-06  35%  254 aa  ADH1_DROMN RecName: Full=Alcohol dehydrogenase 1;       
  144::245     4e-06  28%  341 aa  MKAR_PYRTR RecName: Full=3-ketoacyl-CoA reductase;       
   74::247     4e-06  27%  310 aa  DHB3_HUMAN RecName: Full=Testosterone 17-beta-dehydrogenase 3;     
   85::189     4e-06  34%  254 aa  ADH_DROVI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     4e-06  34%  254 aa  ADH_DROFL RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     4e-06  34%  254 aa  ADH2_DROMN RecName: Full=Alcohol dehydrogenase 2;       
   85::189     4e-06  38%  254 aa  ADH1_DROMT RecName: Full=Alcohol dehydrogenase 1;       
  133::250     5e-06  27%  314 aa  STDH4_CAEEL RecName: Full=Putative steroid dehydrogenase 4;        
  144::245     5e-06  28%  341 aa  MKAR_PHANO RecName: Full=3-ketoacyl-CoA reductase;       
  129::227     5e-06  29%  324 aa  MKAR_MALGO RecName: Full=3-ketoacyl-CoA reductase;       
  146::253     5e-06  31%  351 aa  MKAR_ASHGO RecName: Full=3-ketoacyl-CoA reductase;       
  109::192     5e-06  36%  270 aa  HCAB_SHISS RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  36%  270 aa  HCAB_SHIBS RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  36%  270 aa  HCAB_ECOSM RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  36%  270 aa  HCAB_ECOSE RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  36%  270 aa  HCAB_ECOLU RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  36%  270 aa  HCAB_ECOLI RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  36%  270 aa  HCAB_ECOLC RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  36%  270 aa  HCAB_ECOHS RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  36%  270 aa  HCAB_ECODH RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  36%  270 aa  HCAB_ECOBW RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  35%  270 aa  HCAB_ECO8A RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  36%  270 aa  HCAB_ECO55 RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     5e-06  36%  270 aa  HCAB_ECO24 RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  101::189     5e-06  35%  254 aa  ADH_DROWI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  101::189     5e-06  35%  254 aa  ADH_DROPU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  101::189     5e-06  35%  254 aa  ADH_DROIN RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  101::189     5e-06  35%  254 aa  ADH_DROEQ RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     5e-06  36%  254 aa  ADH2_DROMO RecName: Full=Alcohol dehydrogenase 2;       
   85::189     5e-06  34%  254 aa  ADH1_DROMU RecName: Full=Alcohol dehydrogenase 1;       
  168::282     6e-06  39%  331 aa  RDH13_HUMAN RecName: Full=Retinol dehydrogenase 13;       
  157::264     6e-06  27%  361 aa  MKAR_CRYNE RecName: Full=3-ketoacyl-CoA reductase;       
   85::189     6e-06  35%  254 aa  ADH_DROGR RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  101::189     6e-06  35%  254 aa  ADH2_DROWH RecName: Full=Alcohol dehydrogenase 2;       
   85::189     6e-06  37%  254 aa  ADH2_DROHY RecName: Full=Alcohol dehydrogenase 2;       
   85::189     6e-06  37%  254 aa  ADH1_DROHY RecName: Full=Alcohol dehydrogenase 1;       
   74::225     8e-06  28%  415 aa  HSDL2_DANRE RecName: Full=Hydroxysteroid dehydrogenase-like protein
  177::248     8e-06  33%  319 aa  HSDL1_DANRE RecName: Full=Hydroxysteroid dehydrogenase-like protein
   77::213     8e-06  34%  317 aa  H17B6_MOUSE RecName: Full=Hydroxysteroid 17-beta dehydrogenase 6;  
   85::189     8e-06  34%  254 aa  ADH_DROPL RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     8e-06  35%  254 aa  ADH_DRONI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     8e-06  34%  254 aa  ADH_DRODI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   66::225     1e-05  23%  417 aa  HSDL2_XENLA RecName: Full=Hydroxysteroid dehydrogenase-like protein
  147::233     1e-05  28%  305 aa  DHB3_MOUSE RecName: Full=Testosterone 17-beta-dehydrogenase 3;     
  101::189     1e-05  36%  254 aa  ADH_DROPS RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  101::189     1e-05  36%  254 aa  ADH_DROPB RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  101::189     1e-05  36%  254 aa  ADH_DROMD RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  101::189     1e-05  36%  254 aa  ADH_DROGU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  101::189     1e-05  36%  254 aa  ADH_DROAM RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     1e-05  34%  254 aa  ADH_DROAF RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   85::189     1e-05  35%  254 aa  ADH1_DROMO RecName: Full=Alcohol dehydrogenase 1;       
   85::218     1e-05  29%  356 aa  YXNA_BACSU RecName: Full=Uncharacterized oxidoreductase yxnA;      
  109::192     1e-05  35%  270 aa  HCAB_SHIFL RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  109::192     1e-05  35%  270 aa  HCAB_SHIF8 RecName: Full=3-phenylpropionate-dihydrodiol/cinnamic
  121::243     1e-05  28%  306 aa  DHB3_RAT RecName: Full=Testosterone 17-beta-dehydrogenase 3;       
  101::189     1e-05  36%  254 aa  ADH_DROPE RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  127::237     2e-05  30%  315 aa  STDH2_CAEEL RecName: Full=Putative steroid dehydrogenase 2;        
   69::233     2e-05  30%  261 aa  SPRE_XENTR RecName: Full=Sepiapterin reductase;         Short=SPR; 
  164::272     2e-05  32%  405 aa  DHI2_HUMAN RecName: Full=Corticosteroid 11-beta-dehydrogenase
  103::191     2e-05  36%  256 aa  ADH_DROYA RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  103::191     2e-05  36%  256 aa  ADH_DROTS RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  103::191     2e-05  36%  256 aa  ADH_DROTE RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  103::191     2e-05  36%  256 aa  ADH_DROSI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  103::191     2e-05  36%  256 aa  ADH_DROSE RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  103::191     2e-05  36%  256 aa  ADH_DROOR RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  103::191     2e-05  36%  256 aa  ADH_DROME RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  103::191     2e-05  36%  256 aa  ADH_DROMA RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  103::191     2e-05  36%  256 aa  ADH_DROER RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  103::191     2e-05  36%  256 aa  ADH_DROAN RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  107::201     2e-05  30%  256 aa  YKH1_YEAST RecName: Full=Uncharacterized oxidoreductase YKL071W;
  133::274     2e-05  36%  314 aa  MNR1_CAPAN RecName: Full=(+)-neomenthol dehydrogenase;       
   85::189     2e-05  34%  254 aa  ADH_DROPI RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  127::237     3e-05  31%  314 aa  STDH1_CAEEL RecName: Full=Putative steroid dehydrogenase 1;        
  155::248     3e-05  28%  346 aa  MKAR_ASPNC RecName: Full=3-ketoacyl-CoA reductase;       
   66::237     3e-05  25%  417 aa  HSDL2_XENTR RecName: Full=Hydroxysteroid dehydrogenase-like protein
   45::252     3e-05  27%  258 aa  FABI_BACSU RecName: Full=Enoyl-[acyl-carrier-protein] reductase
  101::189     3e-05  35%  254 aa  ADH_DROSU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  155::251     4e-05  28%  349 aa  MKAR_COCIM RecName: Full=3-ketoacyl-CoA reductase;       
   85::189     4e-05  33%  254 aa  ADH_DROAD RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   45::106     5e-05  41%  106 aa  YDFG_DICNO RecName: Full=Probable NADP-dependent dehydrogenase in
   59::200     5e-05  26%  253 aa  YCP9_SCHPO RecName: Full=Uncharacterized oxidoreductase C663.09c;  
  165::253     5e-05  36%  265 aa  FABI_PSEAE RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   34::220     7e-05  20%  335 aa  TSC10_CRYNE RecName: Full=3-ketodihydrosphingosine reductase TSC10;
  121::241     7e-05  34%  316 aa  RDH12_MOUSE RecName: Full=Retinol dehydrogenase 12;       
  120::238     7e-05  33%  316 aa  RDH11_MOUSE RecName: Full=Retinol dehydrogenase 11;       
  156::267     7e-05  30%  389 aa  MKAR_YARLI RecName: Full=3-ketoacyl-CoA reductase;       
  140::256     7e-05  33%  352 aa  MKAR_CANGA RecName: Full=3-ketoacyl-CoA reductase;       
  116::255     7e-05  27%  270 aa  FABI_AQUAE RecName: Full=Enoyl-[acyl-carrier-protein] reductase
    8::189     7e-05  33%  298 aa  DECR2_ARATH RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase;   
   85::189     7e-05  31%  254 aa  ADH_DROIM RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   87::207     9e-05  27%  254 aa  YJNK_SCHPO RecName: Full=Uncharacterized oxidoreductase C24B10.20; 
   59::199     1e-04  25%  286 aa  YBPE_SCHPO RecName: Full=Uncharacterized oxidoreductase C16H5.14c; 
  170::243     1e-04  30%  339 aa  MKAR_COPC7 RecName: Full=3-ketoacyl-CoA reductase;       
   85::186     1e-04  32%  254 aa  ADH_DROHA RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   96::231     2e-04  32%  261 aa  SPRE_HUMAN RecName: Full=Sepiapterin reductase;         Short=SPR; 
  162::250     2e-04  30%  262 aa  FABI_SHIFL RecName: Full=Enoyl-[acyl-carrier-protein] reductase
  162::250     2e-04  30%  262 aa  FABI_SALTY RecName: Full=Enoyl-[acyl-carrier-protein] reductase
  123::251     2e-04  30%  261 aa  FABI_NEIMB RecName: Full=Enoyl-[acyl-carrier-protein] reductase
  162::250     2e-04  30%  262 aa  FABI_ECOLI RecName: Full=Enoyl-[acyl-carrier-protein] reductase
  162::250     2e-04  30%  262 aa  FABI_ECO57 RecName: Full=Enoyl-[acyl-carrier-protein] reductase
  127::232     2e-04  31%  316 aa  LE767_CAEBR RecName: Full=Putative steroid dehydrogenase let-767;  
  192::271     2e-04  31%  378 aa  DHS5_CAEEL RecName: Full=Uncharacterized oxidoreductase dhs-5;     
   59::200     3e-04  24%  253 aa  YCP8_SCHPO RecName: Full=Uncharacterized oxidoreductase C663.08c;  
   59::200     3e-04  24%  253 aa  YCP6_SCHPO RecName: Full=Uncharacterized oxidoreductase C663.06c;  
  169::239     6e-04  27%  338 aa  MKAR_LACBS RecName: Full=3-ketoacyl-CoA reductase;       
   46::253     6e-04  22%  272 aa  FABI1_RHIME RecName: Full=Enoyl-[acyl-carrier-protein] reductase
   64::208     7e-04  30%  263 aa  SPRE_XENLA RecName: Full=Sepiapterin reductase;         Short=SPR; 
  425::475     7e-04  39%  513 aa  LEU1_RALEJ RecName: Full=2-isopropylmalate synthase;       
  270::367     7e-04  34%  385 aa  FABI_BRANA RecName: Full=Enoyl-[acyl-carrier-protein] reductase
  137::251     0.001  30%  347 aa  MKAR_YEAST RecName: Full=3-ketoacyl-CoA reductase;       
    1::264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGNALQGRHALVTXXXXXXXXXXXXXXXXXXXSVTLLGREQAALDATVHALQSCVIEGAALGAVSADITD
ACT3_STRCO      ---------------------------------VFVCARGEEGLRTTLKELREAGVEADGR---TCDVRS
HCDS_XANP2      ------------------------------------------------------------------DVTD
NODG_AZOBR      ------------------------------------------------------------------DVSD
BDHA_RHIME      -------------------------------------------------------VAGLSSGTVPADMTK
YXJF_BACSU      --------------------------------------------EACEKAASKLAEEGFDAAAIPYDVTK
BDHA_RALEH      ------------------------------------------------------------VGYHGADMSK
BACC2_BACSU     ---------------------------------------------------------------VHTDITD
BACC_BACSU      ---------------------------------------------------------------VQTDITD
FABG_AQUAE      ----LQGKVSLVTGSTRGIGRAIAEKLASAGSTVIITGTSGERAKAVAEEIANKY--GVKAHGVEMNLLS
DHKR_STRCM      ---------------------------------VFLGARTESDVIATVKALRNDGLE--AEGQV-LDVRD
DHK1_STRVN      -----------------------------------LCARDEERLAQTVKELRG---EGFDVDGTVCDVAD
FABG1_SYNY3     ---------------------------------------------------------------VQANVAN
FABG_MYCS2      ------------------------------------------------------------LFGVQCDVTD
PHBB_CHRVI      ---------------------------------------------------------GFDIAVFTADVSS
FABG_MYCTU      ------------------------------------------------------------LFGVECDVTD
FABG_MYCBO      ------------------------------------------------------------LFGVECDVTD
FABG_MYCAV      ------------------------------------------------------------LFGVECDVTD
PHBB_RALEH      --------------------------------------------------------------ASEGNVAD
FABG_STAAW      --------------------------------------------------------------AIQANVAD
FABG_STAAS      --------------------------------------------------------------AIQANVAD
FABG_STAAR      --------------------------------------------------------------AIQANVAD
FABG_STAAN      --------------------------------------------------------------AIQANVAD
FABG_STAAM      --------------------------------------------------------------AIQANVAD
FABG_STAAC      --------------------------------------------------------------AIQANVAD
PHBB_RHIME      ----------------------------------------------------------------------
FABG_VIBHA      ---------------------------------------------------------------LALNVTD
FABG_CUPLA      ------------------------------------------------------------------DVSK
BUDC_KLEPN      --------------------------------------------DATAKAVASEINQGGRAMAVKVDVSD
LVR_LEIAQ       ---------------------------------LSLVDVSSEGLEASKAAVLETAPDAEVLTTV-ADVSD
PHBB_ZOORA      ----------------------------------------------------------------------
FABG_SHIFL      ---------------------------------------------------------GANGKGLMLNVTD
FABG_ECOLI      ---------------------------------------------------------GANGKGLMLNVTD
NODG_RHIS3      ----LTGRKALVTGASGGIGEAIARVLHAQGAIVGLHGTRVEKLETLAAEL------GDRVKLFPANLSN
FABG_BACSU      --------------------------------------------------------------AVKADVSN
FABG_PSEAE      ---SLQGKVALVTGASRGIGQAIALELGRLGAVVIGTATSASGAEKIAETLKANGVEGAGL---VLDVSS
HCDR_XANP2      ---------------------------------------------------------------VRADVAD
FABG_VIBCH      ---------------------------------------------------------------MALNVTN
UCPA_SALTY      --------------------------------------------------------------AVKADVRD
UCPA_SALTI      --------------------------------------------------------------AVKADVRD
BACC_BACAM      ---------------------------------------------------------------VQTDITN
FABG_STAES      --------------------------------------------------------KGVESFAIQANVAK
FABG_STAEQ      --------------------------------------------------------KGVESFAIQANVAK
UCPA_ECOLI      --------------------------------------------------------------AVVADVRD
PHAB_PARDE      -------------------------------------------------------------------VAD
FABG_RICPR      ----------------------------------------------------------------------
NODG_RHIME      ----LTGRKALVTXXXXXXXXXXXRVLHAQGAIVGLHGTQIEKLETLATEL------GDRVKLFPANLAN
UCPA_ECO57      --------------------------------------------------------------AVVADVRD
FABG_RICTY      ----------------------------------------------------------------------
FABG_RICBR      ----------------------------------------------------------------------
PHAB_ACISR      ----------------------------------------------------------------------
YOHF_ECOLI      ---------------------------------ITWHSDEEGAKDTA----REVVSHGVRAEIVQLDLGN
DHRS4_RABIT     ---------------------------------VVISSRKQQNVDRAVAALQA---EGLSVTGTVCHVGK
FABG_BUCAP      ------------------------------------------------------------------DLKD
FABG_HAEIN      ------------------------------------------------------------------NVTD
GNO_GLUOX       ---SLSGARALVTGASRGIGLTLAKGLARYGAEVVLNGRNAESLDSAQSGFEA---EGLKASTAVFDVTD
KDUD_BACSU      --------------------------------------------------------EGRIFTSFTLDMSK
FABG2_BRANA     ------------------------------------------------------------------DVSK
LINC_PSEPA      ------------------------------------------------------------------DIAQ
FABG3_BRANA     ------------------------------------------------------------------DVSK
FABG1_BRANA     ------------------------------------------------------------------DVSK
Y4VI_RHISN      ---------------------------------------------------------------LEVDVSR
PECR_HUMAN      ----LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLTKQARVIPIQCNIRN
HSD_STREX       ------------------------------------------------------------------DVTE
PECR_RAT        --------------------------------NVVIASRKLDRLTAAVDELRASQPPSSSVTAIQCNIRK
HSD_MYCTU       ---------------------------------------------------------------VHLDVTQ
HSD_MYCBO       ---------------------------------------------------------------VHLDVTQ
FABG_SALTY      ---------------------------------------------------------GANGKGLMLNVTD
FABG_SALTI      ---------------------------------------------------------GANGKGLMLNVTD
LIMC_RHOER      ---------------------------------------------------------------IHADVRD
PECR_MOUSE      --------------------------------NVVIASRKLDRLTAAVDELRASLSSSAEVSAIQCNIRK
BAIA1_EUBSP     ---------------------------------VSIFGETQEEVDTALAQLKELYPEEEVLG-FAPDLTS
Y1385_MYCBO     -------------------------------------------LEATEVAAKRLGGDDVAL-AVRCDVTQ
Y1350_MYCTU     -------------------------------------------LEATEVAAKRLGGDDVAL-AVRCDVTQ
DHSO_RHOSH      ------------------------------------------------------------------DVTD
BAIA2_EUBSP     ---------------------------------VSIFGETQEEVDTALAQLKELYPEEEVLG-FAPDLTS
YXBG_BACSU      -------------------------------------------MEETVDAIRK---NGGQAESFHLDVSD
FIXR_BRAJA      ----------------------------------------------------------------------
FABG4_BRANA     ------------------------------------------------------------------DVSK
IDNO_ECOLI      --------------------------------------------------------EGIQAVAAPFNVTH
IDNO_ECOL6      --------------------------------------------------------EGIQAVAAPFNVTH
FABG_THEMA      --------------------------------ATTLLFAQEGATDISKENLDSLVKEAEGLGKVDPNVTD
FABG_ARATH      ------------------------------------------------------------------DVSK
BUTA_STAAW      --------------------------------------------------------DGTKAIAIKADVSN
BUTA_STAAS      --------------------------------------------------------DGTKAIAIKADVSN
BUTA_STAAR      --------------------------------------------------------DGTKAIAIKADVSN
BUTA_STAAN      --------------------------------------------------------DGTKAIAIKADVSN
BUTA_STAAM      --------------------------------------------------------DGTKAIAIKADVSN
BUTA_STAAC      --------------------------------------------------------DGTKAIAIKADVSN
PECR_PONAB      ----LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAAGELQANLTKQARVIPIQCNIRN
FABG_CHLMU      ---------------------------------------------------------GSKVSFALVDVSK
DHB8_HUMAN      ----------------------------------------------------------------------
DHB8_CANFA      ------------------------------------------------------VAPGGAHTAFQADVSE
PECR_CAVPO      ----LQNRAAIVXXXXXXXXXXXXXELLHLGCNVVIASRKFDRLRAAAEELKATLPPSAEVTPIQCNIRK
HDHA_ECOLI      --------------------------------------------DAANHVVDEIQQLGGQAFACRCDITS
HDHA_ECO57      --------------------------------------------DAANHVVDEIQQLGGQAFACRCDITS
FABG_CHLTR      ---------------------------------------------------------GRQVSFALVDVSK
YGFF_ECOLI      ----------------------------------------QQNLHAAQEVMNLITQAGGKAFVLQADISD
FABG5_BRANA     ------------------------------------------------------------------DVSK
CMTB_PSEPU      -------------------------------------------------------------------LSE
CMTB_PSEP1      -------------------------------------------------------------------LSE
FABG_RICFE      ----------------------------------------------------------------------
DHRS4_BOVIN     --NPLDNKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDRAVATLKG---EGLSVTGTVCHVGK
FABG_BUCBP      ---------------------------------------------------------------IKLDITN
FABG_BUCAI      -------------------------------------------------------LEGNGFGFV-LNLKN
DHG_BACSU       ---------------------------------------------------------GGEAVVVQGDVTK
DHG2_BACME      ---------------------------------------------------------------VRGDVTK
FABG_RICCN      ----------------------------------------------------------------------
YVAG_BACSU      ----LQGKTALVTGSTSGIGKAIASSLAEEGAAVIINGRREEKVNQTIDELKTQHAE-AVLYPAAFDLGT
YMFI_BACSU      ---------------------------------------------------------------VNAEILQ
Y2146_BRAJA     ----------------------------------------------------------------------
MOAE_KLEAE      ----------------------------------------------------------------------
DHRS7_HUMAN     ------------------------------------------------------------------DLTD
Y4LA_RHISN      ----------------------------------------------------------------------
KDUD_ECOLI      --------------------------------------------------------------SLTADLRK
Y325_THEMA      ----------------------------------------------------------------------
DCXR_BOVIN      ----LAGRRALVTGAGKGIGRSIVKALHAAGARVVAVSRTQADLDSLVR-------ECPGVETVCVDLAD
Y2403_STAAW     ---------------------------------VVLAGRNKEKLQNVANQLSQDSVK-----VVPTDVTN
Y2370_STAAS     ---------------------------------VVLAGRNKEKLQNVANQLSQDSVK-----VVPTDVTN
FABG_CHLPN      MDITLVGKKVIVTGGSRGIGLGIVKLFLENGADVEIWGLNEERGQAVIESLTGL---GGEVSFARVDVSH
Y2778_STAA8     ---------------------------------VVLAGRNKEKLQNVANQLSQDSVK-----VVPTDVTN
Y2488_STAAC     ---------------------------------VVLAGRNKEKLQNVANQLSQDSVK-----VVPTDVTN
Y2422_STAA3     ---------------------------------VVLAGRNKEKLQNVANQLSQDSVK-----VVPTDVTN
YVRD_BACSU      --------------------------------AVIVNGRKQETVDRTIEELSGYTVHGAA-----ADLSK
YLX6_SCHPO      ----------------------------------TELGDRVAGIDI----VDPSKVQDAAL-ALQADVSK
CBR2_PIG        -------------------------------------GARVVAVTRTNGDLVSLSQECPGIEPVCVDLGD
NOG4_RHIME      ----------------------------------------------------------------------
FABG2_SYNY3     -----------------------------------------------------------ALGVV-ANVTD
CBR4_DANRE      ---------------------------------IVLLSRNKEAAQSTAQSLP-----GENHLGLSCDVSK
Y2478_STAAM     ---------------------------------VVLAGRNKDKLQNVANQLAQDSVK-----VVPTDVTN
Y2266_STAAN     ---------------------------------VVLAGRNKDKLQNVANQLAQDSVK-----VVPTDVTN
SRLD_ECOLI      -----------------------------------------------------------------ADATS
YTKK_BACSU      -------RHALITAGSKGLGRKVTETLLAKGYSVTVNYRQEEAVSRLKEACPDCLDR---LQFVKGDVTK
Y019_THEMA      ---------------------------------------------------------------VKTDVAD
Y2049_STAEQ     --------------------------------SIVLVGRNEQRLNEIAQQLNT------PAKVVSADVTV
Y2036_STAES     --------------------------------SIVLVGRNEQRLNEIAQQLNT------PAKVVSADVTV
CBR4_XENTR      ----------------------------------------------------------------SCDVSK
DHGB_BACME      --------------------------------------------------------------AVKGDVTV
DHB11_MACFA     --------------------------------------------DINKHGLEETAAKCKGLGAVYTFVVD
BUDC_KLETE      --------------------------------------------DATATAVAAEINQGGRAVAIKVDVSR
TRNH_DATST      ---SLRGMTALVTGGTRGIGYAIVEELANFGAEVYTCSRSQNDLD---ECLEKWRRKGFKVSGPVCDVSS
DHRS4_MOUSE     --NPLSNKVALVTASTDGIGFAIARRLAEDGAHVVVSSRKQQNVDRAVATLQG---EGLSVTGIVCHVGK
Y2567_STAAR     ---------------------------------VVLAGRNKDKLQNVANQLAQDSVK-----VVPTDVTK
CPNA_COMTE      ----------------------------------TLLAREGATVELGHQAVAEIRRQGGKAHFLHLDVTN
CPNA_COMS9      ----------------------------------TLLAREGATVELGHQAVAEIRRQGGKAHFLHLDVTN
DHRS7_MOUSE     ------------------------------------------------------------------DLTD
DHB11_RAT       ---------------------------------------------------------GAQVHPFVVDCSQ
BUTA_STAES      ----------------------------------------------------------------------
BUTA_STAEQ      ----------------------------------------------------------------------
YGCW_ECOLI      --------------------------------------------------------QGVEVDFMQVGITA
XYLL_PSEPU      MNKRFQGKVAVITGAAQGIGRRVAERMAAEGGRLLLVDRSEL-----IHELADELVGVAEVLTLTADLEQ
DHB11_PONAB     --------------------------------------------DINKHGLEETAAKCKGLGAVHTFVVD
YQJQ_BACSU      ----------------------------------------------------------------------
YOXD_BACSU      ----------------------------------------------------------------------
CBR4_BOVIN      ----------------------------------------------------------------SCDVAK
YUSZ_BACSU      ------------------------------------------------------------------DVTD
RHLG_PSEAE      ---SLAGRIALVTGGSRGIGQMIAQGLLEAGARVFICARDAEACADTATRLSAY----GDCQAIPADLSS
HETN_ANASP      ------------------------------------------------------------------DVRN
DHB11_HUMAN     --------------------------------------------DINKHGLEETAAKCKGLGAVHTFVVD
DER_CHICK       -------------------------------------GARVTALSRTAADLESLVRECPGIEPLCLDLAD
FABG6_BRANA     ----------------------------------------------------------------------
DRS7B_DANRE     -----------------------------------LCGRDQRRLQEVVEELGNXXXXXXXXXTVTFDLSN
DHB11_MOUSE     ---------------------------------------------------------GAQAHPFVVDCSQ
TRN1_DATST      ----------------------------------------------------------------------
PGDH_CAVPO      ---------------------------------------------------------------IQCDVAD
DHRS4_RAT       --NPLANKVALVTASTDGIGLAIARRLAEDGAHVVISSRKQQNVDRAVATLQG---EGLSVTGVVCHVGK
DHG3_BACME      ---------------------------------INYYNNEEEALDAKKEVEEA----GGQAIIVQGDVTK
FADH_BACSU      ---------------------------------VMVTGRNHEALEETKKEIQT--FEGQ-VACFQMDVRS
DHGA_BACME      ---------------------------------INYYNNEEEALDAKKEVEEA----GGQAIIVQGDVTK
DHG4_BACME      ---------------------------------INYYNNEEEALDAKKEVEEA----GGQAIIVQGDVTK
FOX2_NEUCR      ---------------------------------------------------------GKAVGAFSAEDGD
FOX2_CANTR      ----------------------------------------------------------------------
TRN2_DATST      ----------------------------------------------------------------------
PGDH_MACFA      ---------------------------------------------------------------IQCDVAD
PGDH_HUMAN      ---------------------------------------------------------------IQCDVAD
DRS7B_PONAB     ---------------------------------LVLCGRNGGALEELIRELHATKVQTHKPYLVTFDLTD
DCXR_CAEEL      ----------------------------------------------------------------------
Y182_METEA      ----------------------------------------------------------------------
Y0419_STAS1     ----------------------------------------------------------------------
PGDH_BOVIN      ---------------------------------------------------------------IQCDVAD
KDSR_HUMAN      ---ALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVAREDKLLQAKKEIEMHSINDKQVVLCISVDVSD
GRDH_ORYSJ      -------------------------------------GQEEKDAEETLRALRDIRARTGAKDAIPADLKV
DRS7B_BOVIN     ---------------------------------------------------------------VTFDLAD
TRN2_HYONI      ----------------------------------------------------------------------
SDR1_PICAB      --------------------------------------------------------DGVRAIVCKADVAE
DRS7B_MOUSE     ---------------------------------------------------------------VTFDLAD
CBR2_MOUSE      -------------------------------------GAKVVAVTRTNSDLVSLAKECPGIEPVCVDLGD
PGDH_MOUSE      ---------------------------------------------------------------VQCDVAD
DRS7B_HUMAN     ---------------------------------LVLCGRNGGALEELIRELHATKVQTHKPYLVTFDLTD
GRDH2_ARATH     --NKLHGKVALVTGGDSGIGKAVCHCYALEGASVAFTGREDKDAEETLRLLHEVKTREAKEPIIATDLGF
GRDH_DAUCA      --NKLQGKVALVTGGDSGIGRSVCYHFALEGATVAFTGHEDKDANETLELLRKAKSSDAKDPAIAADLGF
DHG2_BACSU      ---------------------------------------------------------GGKAVSVEADVSK
DHB13_HUMAN     ---------------------------------------------------------GVTAHAYVVDCSN
DECR_HUMAN      --NSFQGKVAFIXXXXXXXXXXXXXXXXXXXAQCVIASRKMDVLKATAEQISSQT--GNKVHAIQCDVRD
ARDH_CANAL      ------------------------------------------------------------VSAWSCNIGD
SDH_RHIRD       ---------------------------------------------------------GSAFHGVAFDITD
KDSR_BOVIN      ---ALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVAREDKLLQAKKEIEKHSINDKQVVLCISVDVSD
DRS7B_XENTR     ---------------------------------LVLCGRSEEGLKNLVQELSQMRIKSAQLHKVIFDLSD
KDUD_DICD3      --------------------------------------------------------------SLTADMSD
KDSR_MOUSE      ---ALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVAREDKLLQAKKDIEKHSINDKQVVLCISVDVSD
DHBA_BACSU      -------------------------------------GAHIAAVDYNPEKLEKVVAEGRHAEAFPADVRD
YUXG_BACSU      --------------------------------------------------------------AVKMDVTK
YKVO_BACSU      -----EGKIALVTGGTSGIGLATAQKFVNEGAYVYITGRRQNELDKAVNQI------GKNVTGVQGDISK
ARDH_CANTR      ------------------------------------------------------------VSAWSCNIGD
DRS7B_XENLA     ---------------------------------LVLCGRDEERLKDLVQELNNMRLKSTQLHKVIFDLSD
DHB8_MOUSE      ----------------------------------------------------------------------
DHB1_MOUSE      -----------------------------------------------------------SLEILELDVRD
DHB8_RAT        ----------------------------------------------------------------------
YJDA_BACSU      ---------------------------------------------------------GVRCEAMKIDLSD
YHXC_BACSU      --------------------------------------------------------EGVKCLLIAGDVGD
RIDH_KLEAE      MNTSLSGKVAAITGAASGIGLECARTLLGAGAKVVLIDREGEKLNKLVAEL------GENAFALQVDLMQ
GRDH1_ARATH     ----------------------------------------------------------------------
CBR4_XENLA      -----------------------------------------AVISRNLEVAQAAVTEIGAHLALSCDVSK
SPS19_YEAST     -----------------------------------IVGRDQERTEQAAKGIQLAKDKDAVLAIANVDVRN
LINX_PSEPA      ---------------------------------------------------------------IRLDVTD
BEND_ACIAD      --------------------------------------------------IQAVLAEIKALGALAIAVTD
ARDH_PICST      ----------------------------------------------------------SAIGQVSANIGD
DHB1_RAT        -----------------------------------------------------------SLEILELDVRD
BDH2_HUMAN      ----------------------------------------------------------------------
SDH_AGRT5       ---------------------------------------------------------GQAFHGIAFDITD
FABL_BACSU      ---------------------------------------------------------GVKVLVVKANVGQ
DCXR_RAT        --------------------------------------------------LDSLVRECPGVEPVCVDLAD
DCXR_MESAU      MDLGLAGRRALVTGAGKGIGRSTVLALQAAGAHVVAVSRTQADLD-------SLVSECPGVETVCVDL--
BDH2_MOUSE      ----------------------------------------------------------------------
BDH2_BOVIN      ----------------------------------------------------------------------
UXUB_BACSU      ----------------------------------------------------------------------
S16C6_BOVIN     ----------------------------------------------------------------------
FOX2_YEAST      ----------------------------------------------------------------------
DHRS4_PIG       ----LENKVALVTASTDGIGLAIARRLAQDGAHVVVSSRKQENVDRTVATLQG---EGLSVTGTVCHVGK
RDH10_RAT       ----------------------------------------------------------------------
RDH10_MOUSE     ----------------------------------------------------------------------
RDH10_HUMAN     ----------------------------------------------------------------------
RDH10_BOVIN     ----------------------------------------------------------------------
DRS7B_RAT       ----------------------------------------------------------------------
TRNH1_ARATH     ----------------------------------------------------------------------
Y484_MYCTU      ----------------------------------------------------------------------
STCU_EMENI      --------------------------------------------------------------SIQADVGD
DECR_MOUSE      --DAFQGKVAFITGGGTGLGKAMTTFLSTLGAQCVIASRNIDVLKATAEEISSKT--GNKVHAIRCDVRD
RD10A_DANRE     ----------------------------------------------------------------------
DHRS7_ANOGA     ----------------------------------------------------------------------
DHB8_PIG        ----------------------------------------------------------------------
DHB13_RAT       --------------------------------------------DISKHGVEETAAKCRKLGAVVVDCSN
Y4EL_RHISN      ---------------------------------IVVIDINQERLDAAKGELAG---KGTEIFTVVRDIAR
RDH10_XENTR     ----------------------------------------------------------------------
RD10B_XENLA     ----------------------------------------------------------------------
DHRS7_DROME     ----------------------------------------------------------------------
DECR_RAT        --NAFQGKVAFITGGGTGLGKAMTTFLSSLGAQCVIASRNIDVLKATAEEITSKT--GNKVYAIRCDVRD
CBR4_HUMAN      ----------------------------------------------------------------SCDVAK
RD10A_XENLA     ----------------------------------------------------------------------
FABG_ACTAC      ----------------------------------------------------------------------
DHG_BACME       --------------------------------------------------------------AVKGDVTV
YM71_YEAST      ----------------------------------------------------------AKVHVAQLDITQ
SORD_KLEPN      ----------------------------------------------------------------STDISS
DHG1_BACME      --------------------------------------------------------------AVKGDVTV
RD10B_DANRE     ----------------------------------------------------------------------
MTDH_UROFA      -----------------------------------------SAKDAEDRASEISKKYGVKCKAYQCDVGQ
DHB4_HUMAN      ----------------------------------------------------------------------
Y1627_STAS1     ------------------------------------------------------------------DVTK
VER1_ASPPA      --------------------------------------------EAAEKVVEQIKANGTDAIAIQADVGD
DRS7C_BOVIN     ---------------------------------------------------------------VLLDLSD
DECR2_HUMAN     ---------------------------------------------------------------LSMDVRA
CBR4_MOUSE      --------------------------------------------------------------AFRCDVAK
THR1_GLOLA      --------------------------------------------------VQAIKKSGSDAASIKANVSD
DHB4_RAT        ----------------------------------------------------------------------
DHB4_MOUSE      ----------------------------------------------------------------------
YDFG_ECOL6      ----------------------------------------------------------------------
YDFG_ECO57      ----------------------------------------------------------------------
Y4MP_RHISN      ------------------------------------------------------VEHGAHIG-LRCDVAD
DHB13_MOUSE     ----------------------------------------------------------------------
DECR2_PONAB     ---------------------------------------------------------------LSMDVRA
YDFG_ECOLI      ----------------------------------------------------------------------
SOU1_SCHPO      ----------------------------------------------------------------------
RDHE2_MOUSE     ----------------------------------------------------------------------
MAS1_AGRT9      ----------------------------------------------------------------------
YDFG_SHIFL      ---------------------------------VIATGRRQERLQELTDEL------GDNLYIAQLDVRN
Y945_MYCTU      ------------------------------------------------------------IAVAELDVND
YQ53_SCHPO      ---------------------------------------------ACSRAPDTITIEHSXXXXXXXDVTD
TODD_PSEP1      -------------------------------------GARVAVLDKSAAGLEALKLHGDAIVGVEGDVRS
S16C6_MOUSE     ----------------------------------------------------------------------
BNZE_PSEPU      -------------------------------------GARVAVLDKSAAGLEALKLHGDAIVGVEGDVRS
DHB8_CALJA      ----------------------------------------------------------------------
CBR4_RAT        ----------------------------------------------------------------------
KDSR_DICDI      ----------------------------------------------------------------SCDITN
DCXR_HUMAN      ----LAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVR-------ECPGIEPVCVDLGD
YHDF_BACSU      ---------------------------------------------------------------IPGDVGD
DECR2_MOUSE     ---------------------------------------------------------------LSMDVRV
DHI1_SAISC      ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
BPHB_PSES1      -------------------------------------GARVAVLDKSAARLQELAAHGAKVLGIEGDVRV
YWC4_CAEEL      --------------------------------TVVIAARRMEKLEQTARDITK--ITGGTCEPFQMDIKD
YDFG_SALTY      ----------------------------------------------------------------------
YDFG_SALTI      ----------------------------------------------------------------------
RDH8_HUMAN      ----------------------------------------------------------------------
DHK2_STRVN      ---------------------------------------------------------------VRADVSE
DHB12_XENTR     ----------------------------------------------------------------------
DECR2_DANRE     ---------------------------------------------------------------IAMDVRQ
DCXR_MOUSE      MDLGLAGRRALVTGAGKGIGRSTVL-------ALKAAGAQVVAVSRTREDLDDLVRECPGVEPVCVDLAD
DRS7C_HUMAN     ---------------------------------------------------------------VLLDLSD
RDHE2_HUMAN     ---------------------------------------------------------------VHAYTCD
MFEA_DICDI      ----------------------------------------------------------------------
DRS7C_XENTR     ---------------------------------------------------------------VLLDISD
DRS7C_MOUSE     ---------------------------------------------------------------VLLDLSD
T4HR_MAGGR      ---------------------------------------------------------GSDAACVKANVGV
EPHD_MYCTU      -------------------------------------GAEIVISDIDEATVKDTAAEIAARGGIALDVSD
EPHD_MYCBO      -------------------------------------GAEIVISDIDEATVKDTAAEIAARGGIALDVSD
ENTA_ECOLI      ----------------------------------------------------------------------
HCD2_DROME      ---------------------------------------------------------------VPVDVTS
DECR2_RAT       ---------------------------------------------------------------LSMDVRV
DCXR_CAVPO      MDLGLAGRRALVTGAGKGIGRSTVL-------ALKAAGAQVVAVSRTREDLDDLVRECPGVEPVCVDLAD
YHXD_BACSU      ----------------------------------------------------------------------
Y5909_MYXXD     ---------------------------------------------------------GVTVEPVELDVTK
BDH_CHICK       ----------------------------------------------------------------------
YAY8_SCHPO      ----------------------------------------------------------------------
Y0585_STAHJ     ---------------------------------------------------------------VPTDVTN
RDH16_HUMAN     -----------------------------------LLARQ---LDARLRVLAACLTEKGALETVTLDVTK
HCD2_HUMAN      -----------------------------------------------------------------ADVTS
GS39_BACSU      --------------------------------------------------------EGVKCLLIAGDVGE
Y4EK_RHISN      ---------------------------------VLALGRDRAALDE-LHST-------AGIVPVVFDLSD
RDH2_RAT        ------------------------------------------------------------LETVILDVTK
DHR11_MOUSE     ------------------------------------------------------------------DLSN
DHR11_HUMAN     ------------------------------------------------------------------DLSN
PGDH_RAT        ---------------------------------------------------------------IQCDVAD
DHB12_ANAPL     ---------------------------------VALISRSKEKLDQVAGEITEQY--GVETKVIVADFGE
ADH2_CERRO      ------------------------------------------------------------------DITS
ADH2_CERCO      ------------------------------------------------------------------DITS
YGHA_ECOLI      ------------------------------------------------------------------DLSD
YGHA_ECO57      ------------------------------------------------------------------DLSD
SOU1_CANAL      ---------------------------------------------------------GVKAKAYKCNVTD
RDH7_RAT        ------------------------------------------------------------LETVILDVTK
RDH3_RAT        ------------------------------------------------------------LETVILDVTK
H17B6_HUMAN     -----------------------------------LLARQ---LDARLRVLAACLTEKGALETVTLDVTK
DHI1_HUMAN      ----LQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVHCLE---LGAASAHYIAGTMED
BPHB_RHOGO      -------------------------------------GARVAVLDRSVAGLEELAAHGDAVVAVEGDVRY
MAS12_AGRRH     ------------------------------------------------------------------DAED
DH12B_XENLA     ------GKWAVVTGATDGIGKAYAEELARRGMNIVLISRSPEKLEAAIHIKQKFKVETKIIAADFGKPTE
Y1430_HAEIN     ----------------------------------------------------------------------
MKAR_AJECN      ----------------------------------------------------------------------
DHR11_CHICK     ------------------------------------------------------------------DLSN
DH12A_XENLA     ------GKWAVVTGATDGIGKAYAEELARRGMSIVLISRSPEKLDAAKHIKETFKVETKIIAADFGKPTE
H17B6_BOVIN     ------------------------------------------------------------LQTVILDVTK
DHB1_PANTR      -----------------------------------------------------------SLETLQLDVRD
DHB1_HUMAN      -----------------------------------------------------------SLETLQLDVRD
BDH_RAT         --------------------------------------------DAGVRELDS--LKSDRLRTIQLNVCN
BDH_HUMAN       ----------------------------------------------------------------------
ADH_BACOL       ------------------------------------------------------------------DITN
DHRS2_HUMAN     ---------------------------------VVISSRKQQNVDRAMAKLQG---EGLSVAGIVCHVGK
DHB12_MACFA     ---------------------------------VVLISRSQDKLDQVSSEIKEKFKVETRTIAVDFTLED
DHB12_HUMAN     ----------------------------------------------------------------------
BDH_MOUSE       ----------------------------------------------------------------------
BDH_BOVIN       ----------------------------------------------------------------------
YCIK_ECOLI      ----------------------------------------------------------------------
VIBA_VIBCH      ----------------------------------------------------------------------
PTR1_LEITA      ----------------------------------------------------------------------
MKAR_PICST      ---AKKGKWAVITGASDGIGKEYAFQLASKGFNVVLVSRTQAKLETLASEIEAKYKVETKVVAFDAS-TD
DHRS7_DICDI     ---------------------------------------------------------------IKGDLTL
DHB14_HUMAN     ---------------------------------------------------------------ILCDVTQ
BPHB_COMTE      ----------------------------------------------------------------------
YBBO_ECOLI      ----------------------------------------------------------------------
YBBO_ECOL6      ----------------------------------------------------------------------
BPHB_PSEPU      -----------------------------------------AVLDKSAERLAQLETDGDNVLGVTGDVRS
ADH1_CERCA      ------------------------------------------------------------------DITN
HSDL1_CHICK     ------GRWAVVTGSTDGIGKAYAEELAKRGVNIILISRSKEKLEAVSRSISETY-------KVETDFIV
DHRS3_BOVIN     ---------------------------------IVLWGRTEKCLKETTEEIRQM---GTECHYFICDVGN
ABA2_ARATH      ---------------------------------------------------------------IHGDVRV
DHRS3_MOUSE     ---------------------------------IVLWGRTEKCLKETTEEIRQM---GTECHYFICDVGN
DHRS3_HUMAN     ---------------------------------IVLWGRTEKCLKETTEEIRQM---GTECHYFICDVGN
DHB12_BOVIN     ---------------------------------IVLISRSQDKLDQVSSEISEVETKTIAVDFTSEDIYD
DH12A_DANRE     ------GKWAVVTGATDGIGKSYAEELARRGFSMMLISRSQEKLDDVAKSLESTYVETKTIAVDFSQIDV
YXEK_CAEEL      --------------------------------SVAIAARRLDVLEKTADEIRSST--GGVCEPFQMDVKD
DHMA_FLAS1      ----------------------------------------------------------------------
DHB2_MOUSE      ------------------------------------------------------------LSVLQMDVTK
Y3106_PSEAE     ---------------------------------------------------------------VAMDVAQ
HCD2_RAT        -----------------------------------------------------------------ANVTS
YVX3_CAEEL      ---ALKGKVALVXXXXXXXXXXXXXXFAHLGASVAIAARRMEKLEQTAEEIMKTT--GGICEPFRMDIKD
YI78_SCHPO      ------------------------------------------------------------------DVNN
ADH2_CERCA      ------------------------------------------------------------------DITS
YWFH_BACSU      ----------------------------------------------------------ASVIVLAGDMSD
YI13_SCHPO      ------------------------------------------------------------------DVSD
Y452_LISIN      ---------------------------------LVLAARRVEKLEKIVQTIKAS--SGEAIFA-KTDVTK
Y432_LISMO      ----------------------------------------------------------------------
FABG_SCHPO      ----------------------------------------------------------------------
DHRS1_MOUSE     --------------------------------TVYITGRHLDTLRATAQEAQSL---GGRCVPVVCDSSQ
VDLC_HELPJ      ------------------------------------------------HATLCVALNHALCECVDIDVSD
DR9C7_MOUSE     ----------------------------------------QKLLQDTSHQLQTFLL----------DVTK
DHR11_BOVIN     ------------------------------------------------------------------DLSN
DHI2_MOUSE      ------------------------------------------------------------LKLLQMDLTK
HCD2_MOUSE      -----------------------------------------------------------------ANVTS
DHI1_RABIT      ----LQGKKVIVTGASKGIGKEIAFHLAKMGAHVVVTARSKETLQEVVHCLK---LGAASAHYIAGTMED
DCXR_TRIRE      ----------------------------------------------------------------------
ADHR_DROPS      ----------------------------------------------------------------------
ADHR_DROPE      ----------------------------------------------------------------------
MTDH_AGABI      ---------------------------------------------------------GVKTKAYQCDVSN
MKAR_PICGU      ---AKKGKWAVITGASDGIGKEYATQLAAKGLNVVLVSRTESKLVALAEEIESKYKVSTKVLAFDVSL-D
DHRS4_PONAB     ---------------------------------VVVSSRKQQNVDQAVATLQG---EGLSVTGTVCHVGK
DHRS4_HUMAN     ---------------------------------VVVSSRKQQNVDQAVATLQG---EGLSVTGTVCHVGK
ADH1_CERCO      ------------------------------------------------------------------DITS
MKAR_NEUCR      ----------------------------------------------------------------------
HSDL1_HUMAN     ---------------------------------------------------------------VETDIIV
DHB2_RAT        ------------------------------------------------------------LSVLQMDVTK
BPHB_BURXL      -------------------------------------GAKVAVLDKSAERLAELETDGDNVLGIVGDVRS
ADHR_DROTE      ----------------------------------------------------------------------
ADHR_DROMA      ----------------------------------------------------------------------
ADHR_DROER      ----------------------------------------------------------------------
MTDH_CLAHE      ----------------------------------------------------------------------
HSDL1_BOVIN     ---------------------------------------------------------------VETDIIV
HCD2_BOVIN      ---------------------------------------------------------GKSCAFAPADVTS
DHRS9_BOVIN     ------------------------------------------------HVIAACLTESGSLHTVLLDVTD
ADHR_DROSU      ----------------------------------------------------------------------
ADHR_DROGU      ----------------------------------------------------------------------
MTDH_ALTAL      ----------------------------------------------------------------------
MKAR_PODAN      --------------------------------NLVLVSRTQSKLDALAKELRLSGLETKVLAMDFSQDND
HDHA_CLOSO      -------------------------------------------LEATQEICDKYKEEGLILKPVFFDAYN
DS7CA_DANRE     ---------------------------------------------------------------VLLDFSD
ADHR_DROME      ----------------------------------------------------------------------
ADHR_DROMD      ----------------------------------------------------------------------
ADHR_DROLE      ----------------------------------------------------------------------
RDH7_MOUSE      ------------------------------------------------------------LETVILDVTK
MKAR_SCHPO      --------------------------------NVVLISRTQEKLDALAKELETVAKVKTRTIAIDYTKTT
MKAR_LODEL      ----------------------------------------------------------------------
HSDL1_PONAB     ----------------------------------------------------------------------
DHB12_RAT       ----------------------------------------------------------------------
ADHR_DROIM      ----------------------------------------------------------------------
ADHR_DROAM      ----------------------------------------------------------------------
YJGI_ECOLI      --------------------------------------------------------------AVFTDSAD
Y048_HAEIN      ----------------------------------------------------------------------
SOU2_CANAL      ---------------------------------------------------------GVKSKAYKCNVTD
RDH1_HUMAN      ----------------------------------------------------------------------
MOMAS_ORYSJ     ---------------------------------------------------------------VHCDVTN
DH12B_DANRE     ------GKWAVVTGATDGIGKAYAEELARRGFAIVLISRTQEKLDEVSKAIESKYVETKTISADFGSVDI
VDLC_HELPY      ------------------------------------------------HATLCVALNHALCESVDIDVSD
TS2_MAIZE       ---------------------------------------------------------GPQVSFVRCDVSV
S16C6_HUMAN     ----------------------------------------------------------------------
MKAR_CHAGB      ----------------------------------------------------------------------
DHI1_MESAU      ----LQGKKVIVTGASKGIGREMAYHLSEMGAHVVLTARSEEGLQKVA---SRCLELGAASAHIAGTMED
YF3H_SCHPO      ------------------------------------------------------------------DVTI
MKAR_DEBHA      ---AKQGKWAVVTGASDGIGKEYAYQLASRGLNVVLISRTLSKLELIATEIETKYKVSTEVIAFDAS-TD
MAS11_AGRRH     --------------------------------------------------------------------TM
DHRS9_MOUSE     ------------------------------------------------------------LHTVLLDVTD
DHI2_RAT        ----------------------------------------------------------------------
DHI2_RABIT      ----------------------------------------------------------------------
DHB12_MOUSE     ----------------------------------------------------------------------
CSGA_MYXXA      ----------------------------------------------------------------------
25KD_SARPE      ----------------------------------------------------------------------
PTR1_LEIMA      ----------------------------------------------------------------------
MKAR_MAGGR      ----------------------------------------------------------------------
MKAR_CANAL      ---AASGKWAVVTGASDGIGKEYAFQLAKKGFSIVLVSRTQSKLELIATEIESKYKVNTKIVAFDASTDD
HCAB_PHOLL      ------------------------------------LSAEKATALAHCFGNDICVIHG--------DVVS
DS7CB_DANRE     ---------------------------------------------------------------VELDFSD
DR4L2_HUMAN     ---------------------------------VVVSSRKQQNVDQAVATLQG---EGLSVTGTVCHVGK
MKAR_ASPTN      ----------------------------------------------------------------------
DHI1_SHEEP      ----LRGKRVIVTGASKGIGREMAYHLARMGAHVVVTARSEESLKKVV---SRCLELGAASAHVAGTMEN
DHI1_MOUSE      ----LQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVV---SRCLELGAASAHIAGTMED
DHB14_BOVIN     ------------------------------------------------------------------DVTR
BPHB_PSEPS      ----------------------------------------------------------------------
YAEB_SCHPO      ----------------------------------------------------------AGLQTLKLDVTD
MKAR_VANPO      ----------------------------------------------------------------------
DR9C7_BOVIN     ------------------------------------------------------------LQTILLDVTK
NAHB_PSEPU      -----------------------------------------------------------ALEIVVGDVRD
HSDL2_HUMAN     -------------------------------------------------------VGGKALPCI-VDVRD
NAHB_PSEU8      -----------------------------------------------------------ALEIVVGDVRD
MKAR_KLULA      ----------------------------------------------------------------------
MKAR_ASPOR      ----------------------------------------------------------------------
DHRS9_RAT       ----------------------------------------------------------------------
YUSR_BACSU      ----------------------------------------------------------------------
YQC8_SCHPO      --------------------------------------------DPTEKAKKLAEETGVQVHTLKIDISR
RDH8_BOVIN      ----------------------------------------------------------------------
MKAR_ASPCL      ----------------------------------------------------------------------
HSDL2_PONAB     -------------------------------------------------------VGGKALPCI-VDVRD
DR9C7_HUMAN     ------------------------------------------------------------------DVTK
3BHD_COMTE      MTNRLQGKVALVTGGASXXXXXXXXXXXXXXAKVAFSDINEAAGQQLAAEL------GERSMFVRHDVSE
Y1570_MYCBO     LNDAVKGKVVLITXXXXXXXXXXXXXXXXXXXTVVLVARTLENLENVANDIRAIRGNGGTAHVYPCDLSD
Y1543_MYCTU     LNDAVKGKVVLITXXXXXXXXXXXXXXXXXXXTVVLVARTLENLENVANDIRAIRGNGGTAHVYPCDLSD
DHI1_RAT        ----LQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVV---SRCLELGAASAHIAGTMED
OXIR_STRAT      --------------------------------------------------VQELAAAGGA-GRVTAEALD
MKAR_EMENI      ----------------------------------------------------------------------
ACR1_ACIBI      ----VKGKVALITGASSGIGLTIAKRIAAAGAHVLLVARTQETLEEVKAAIEQ---QGGQASIFPCDLTD
ACR1_ACIAD      ----VKGKVALITGASSGIGLTIAKRIAAAGAHVLLVARTQETLEEVKAAIEQ---QGGQASIFPCDLTD
MKAR_NEOFI      ----------------------------------------------------------------------
MKAR_ASPFU      ----------------------------------------------------------------------
MKAR_ASPFC      ----------------------------------------------------------------------
LIGD_PSEPA      ----------------------------------------------------------------------
RDH1_BOVIN      -------------------------------------------------------VASSRLHTTLLDVTD
AYR1_YEAST      ----------------------------------------------------------------------
HSDL1_RAT       ----------------------------------------------------------------------
HSDL1_MOUSE     --------------------------------NVILISQEEEKLQAAAHIADTYRVETLVL---VADFSR
DHB2_HUMAN      ------------------------------------------------------------LSVLQMDITK
RDH12_HUMAN     ------------------------------------------------------------------DLSD
MKAR_SCLS1      ----------------------------------------------------------------------
MKAR_BOTFB      ----------------------------------------------------------------------
YIV6_YEAST      ------------------------------------------------------------------DITD
YD114_YEAST     ------------------------------------------------------------------DITS
STDH3_CAEEL     ----------------------------------------------------------------------
RDH13_MOUSE     ----------------------------------------------------------------------
RDH12_BOVIN     ------------------------------------------------------------------DLSD
FABI_HAEIN      ----------------------------------------------------------------------
BZRD_BACCE      ----------------------------------------------------------------------
ADH_SCAAL       ----------------------------------------------------------------------
ADH_DROCR       ----------------------------------------------------------------------
YIV5_YEAST      ---------------------------------------------------------------VVGDITE
HCAB_ECO5E      ----------------------------------------------------------------------
HCAB_ECO57      ----------------------------------------------------------------------
ADH_DROSL       ----------------------------------------------------------------------
DHRS1_HUMAN     ----------------------------------------------------------------------
ADH_DROMM       ----------------------------------------------------------------------
ADH_DROHE       ----------------------------------------------------------------------
RDH11_HUMAN     ------------------------------------------------------------------DLSD
ADH2_DROBU      ----------------------------------------------------------------------
OXIR_STRLI      ----------------------------------------------------------------------
H17B6_RAT       ------------------------------------------------------------LETVILDVTN
ADH_ZAPTU       ----------------------------------------------------------------------
ADH2_DROMU      ----------------------------------------------------------------------
LE767_CAEEL     --------------------------------NVLLVSRTQSKLDETLEKYSSIEVRTAAF-----DFTN
HCAB_ECO7I      ----------------------------------------------------------------------
BZRD_BACSU      ----------------------------------------------------------------------
ADH_DROMY       ----------------------------------------------------------------------
ADH_DROLE       ----------------------------------------------------------------------
ADH_DROLA       ----------------------------------------------------------------------
ADH_DROBO       ----------------------------------------------------------------------
ADH2_DROAR      ----------------------------------------------------------------------
ADH1_DRONA      ----------------------------------------------------------------------
ADH1_DROMN      ----------------------------------------------------------------------
MKAR_PYRTR      ----------------------------------------------------------------------
DHB3_HUMAN      --------------------------------NVVLISRTLEKLEAIATEIERTT--GRSVKIIQADFTK
ADH_DROVI       ----------------------------------------------------------------------
ADH_DROFL       ----------------------------------------------------------------------
ADH2_DROMN      ----------------------------------------------------------------------
ADH1_DROMT      ----------------------------------------------------------------------
STDH4_CAEEL     ----------------------------------------------------------------------
MKAR_PHANO      ----------------------------------------------------------------------
MKAR_MALGO      ----------------------------------------------------------------------
MKAR_ASHGO      ----------------------------------------------------------------------
HCAB_SHISS      ----------------------------------------------------------------------
HCAB_SHIBS      ----------------------------------------------------------------------
HCAB_ECOSM      ----------------------------------------------------------------------
HCAB_ECOSE      ----------------------------------------------------------------------
HCAB_ECOLU      ----------------------------------------------------------------------
HCAB_ECOLI      ----------------------------------------------------------------------
HCAB_ECOLC      ----------------------------------------------------------------------
HCAB_ECOHS      ----------------------------------------------------------------------
HCAB_ECODH      ----------------------------------------------------------------------
HCAB_ECOBW      ----------------------------------------------------------------------
HCAB_ECO8A      ----------------------------------------------------------------------
HCAB_ECO55      ----------------------------------------------------------------------
HCAB_ECO24      ----------------------------------------------------------------------
ADH_DROWI       ----------------------------------------------------------------------
ADH_DROPU       ----------------------------------------------------------------------
ADH_DROIN       ----------------------------------------------------------------------
ADH_DROEQ       ----------------------------------------------------------------------
ADH2_DROMO      ----------------------------------------------------------------------
ADH1_DROMU      ----------------------------------------------------------------------
RDH13_HUMAN     ----------------------------------------------------------------------
MKAR_CRYNE      ----------------------------------------------------------------------
ADH_DROGR       ----------------------------------------------------------------------
ADH2_DROWH      ----------------------------------------------------------------------
ADH2_DROHY      ----------------------------------------------------------------------
ADH1_DROHY      ----------------------------------------------------------------------
HSDL2_DANRE     ------------------------------------------------------------------DVRD
HSDL1_DANRE     ----------------------------------------------------------------------
H17B6_MOUSE     ------------------------------------------------------------LETVILDVTK
ADH_DROPL       ----------------------------------------------------------------------
ADH_DRONI       ----------------------------------------------------------------------
ADH_DRODI       ----------------------------------------------------------------------
HSDL2_XENLA     ---------------------------------------------------------GKALPCI-VDVRD
DHB3_MOUSE      ----------------------------------------------------------------------
ADH_DROPS       ----------------------------------------------------------------------
ADH_DROPB       ----------------------------------------------------------------------
ADH_DROMD       ----------------------------------------------------------------------
ADH_DROGU       ----------------------------------------------------------------------
ADH_DROAM       ----------------------------------------------------------------------
ADH_DROAF       ----------------------------------------------------------------------
ADH1_DROMO      ----------------------------------------------------------------------
YXNA_BACSU      ---------------------------------------------------------------VKADVGK
HCAB_SHIFL      ----------------------------------------------------------------------
HCAB_SHIF8      ----------------------------------------------------------------------
DHB3_RAT        ----------------------------------------------------------------------
ADH_DROPE       ----------------------------------------------------------------------
STDH2_CAEEL     ----------------------------------------------------------------------
SPRE_XENTR      ----------------------------------------------------------------AADLGT
DHI2_HUMAN      ----------------------------------------------------------------------
ADH_DROYA       ----------------------------------------------------------------------
ADH_DROTS       ----------------------------------------------------------------------
ADH_DROTE       ----------------------------------------------------------------------
ADH_DROSI       ----------------------------------------------------------------------
ADH_DROSE       ----------------------------------------------------------------------
ADH_DROOR       ----------------------------------------------------------------------
ADH_DROME       ----------------------------------------------------------------------
ADH_DROMA       ----------------------------------------------------------------------
ADH_DROER       ----------------------------------------------------------------------
ADH_DROAN       ----------------------------------------------------------------------
YKH1_YEAST      ----------------------------------------------------------------------
MNR1_CAPAN      ----------------------------------------------------------------------
ADH_DROPI       ----------------------------------------------------------------------
STDH1_CAEEL     ----------------------------------------------------------------------
MKAR_ASPNC      ----------------------------------------------------------------------
HSDL2_XENTR     ---------------------------------------------------------GKALPCI-VDVRD
FABI_BACSU      -------------------------------------------LEKSVHELAGTLDRNDSI-ILPCDVTN
ADH_DROSU       ----------------------------------------------------------------------
MKAR_COCIM      ----------------------------------------------------------------------
ADH_DROAD       ----------------------------------------------------------------------
YDFG_DICNO      ---------------------------------------------------------GDAFFPLPFDIAD
YCP9_SCHPO      ---------------------------------------------------------------VELDVTS
FABI_PSEAE      ----------------------------------------------------------------------
TSC10_CRYNE     -----RGKHCYITGGSSGLGKALAERLVKQGAHVTIVGRDSKKAEGVVEELKAIAAPGQIIQCIAADLTS
RDH12_MOUSE     ----------------------------------------------------------------------
RDH11_MOUSE     ----------------------------------------------------------------------
MKAR_YARLI      ----------------------------------------------------------------------
MKAR_CANGA      ----------------------------------------------------------------------
FABI_AQUAE      ----------------------------------------------------------------------
DECR2_ARATH     --DVVRGQVALITXXXXXXXXXXXXXXXKHGASIAIMGRRKQVLDDAVSALRSLGIQAIGL---EGDVRK
ADH_DROIM       ----------------------------------------------------------------------
YJNK_SCHPO      ----------------------------------------------------------------------
YBPE_SCHPO      -------------------------------------GFSVASLDSTEPA--SFLQYNSKFSALKCNITK
MKAR_COPC7      ----------------------------------------------------------------------
ADH_DROHA       ----------------------------------------------------------------------
SPRE_HUMAN      ----------------------------------------------------------------------
FABI_SHIFL      ----------------------------------------------------------------------
FABI_SALTY      ----------------------------------------------------------------------
FABI_NEIMB      ----------------------------------------------------------------------
FABI_ECOLI      ----------------------------------------------------------------------
FABI_ECO57      ----------------------------------------------------------------------
LE767_CAEBR     ----------------------------------------------------------------------
DHS5_CAEEL      ----------------------------------------------------------------------
YCP8_SCHPO      ---------------------------------------------------------------IKLDVSS
YCP6_SCHPO      ---------------------------------------------------------------IKLDISS
MKAR_LACBS      ----------------------------------------------------------------------
FABI1_RHIME     --------------------------------------------DALKKRVEPLAQELGAFMAGHCDVTD
SPRE_XENLA      ---------------------------------------------------------GVRVRWAAADLST
LEU1_RALEJ      -------------------------------------GEGNGPVDATLHAIESQVNSGAEMVLYSVN---
FABI_BRANA      ----------------------------------------------------------------------
MKAR_YEAST      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ADWVSGAFAGATEARGPITLLVNNAGQAYSAPFGKTDLALWQRMLEVNLTGTFICTQAALPAMLEAGWGR
ACT3_STRCO      VPEIEALVAAVVERYGPVDVLVNNAGRPGGGATAELADELWLDVVETNLTGVFRVTKQVLKAMLERGTGR
HCDS_XANP2      EAAITAAMAGAQRALGPLTGLVNNAGIAGFGSVHATEVETWSRIMAVNVTGTFLASKAALFGMLERGRGA
NODG_AZOBR      FESCKAMVAKIEADLGPVDILVNNAGITRDKFFAKMDKAQWDAVIATNLSSLFNVTQQVSPKMAERGWGR
BDHA_RHIME      PSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGWGR
YXJF_BACSU      EAQVADTVNVIQKQYGRLDILVNNAGIQHVAPIEEFPTDTFEQLIKVMLTAPFIAMKHVFPIMKKQQFGR
BDHA_RALEH      AAEIEDMMRYAQSDFGGADILVNNAGIQHVAAIEDFPPERWDAIIAINLTSAFHTTRLALPGMKQKDWGR
BACC2_BACSU     EPACQNAIRSAVDKFGGLDVLINNAGIEIVAPIHEMELSNWNKVLNVNLTGMFLMSKHALKYMLKSGKGN
BACC_BACSU      EAACQHAVESAVHTFGGLDVLINNAGIEIVAPIHEMELSDWNKVLQVNLTGMFLMSKHALKHMLAAGKGN
FABG_AQUAE      EESINKAFEEIYNLVDGIDILVNNAGITRDKLFLRMSLLDWEEVLKVNLTGTFLVTQNSLRKMIKQRWGR
DHKR_STRCM      GASVTAFVQAAVDRYGRIDVLVNNAGRSGGGVTADLTDELWDDVIDTNLNSVFRMTRAVLXXXXXXXXXX
DHK1_STRVN      PAQIRAYVAAAVQRYGTVDILVNNAGRSGGGATAEIADELWLDVITTNLTSVFLMTKEVLNAMLAKKRGR
FABG1_SYNY3     ADEVDQLIKTTLDKFSRIDVLVNNAGITRDTLLLRMKLEDWQAVIDLNLTGVFLCTKAVSKLMLKQKSGR
FABG_MYCS2      SAAVDRAFKEVEEHQGPVEVLVANAGISKDAFLMRMTEERFEEVINTNLTGAFRCAQRASRTMQRKRFGR
PHBB_CHRVI      FDDSARMVREITEQVGPIDILVNCAGITRDKTFKKMEQAHWEAVINVNLNSVFNVTRQVWDGMLERGFGR
FABG_MYCTU      SDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGR
FABG_MYCBO      SDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGR
FABG_MYCAV      NDAVDRAFTEVEEHQGPVEVLVSNAGISKDAFLIRMTEERFTEVINANLTGAFRVTQRAARSMQKKRFGR
PHBB_RALEH      WDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFRKMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGWGR
FABG_STAAW      ADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGA
FABG_STAAS      ADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGA
FABG_STAAR      ADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGA
FABG_STAAN      ADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGA
FABG_STAAM      ADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGA
FABG_STAAC      ADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGA
PHBB_RHIME      ---------------GPVDILVNNAGITRDAMFHKMTPEQWGEVIGTNLTGVFNMTHPLWSGMRDRGFGR
FABG_VIBHA      VESIEATLKTINDECGAIDILVNNAGITRDNLLMRMKDDEWNDIINTNLTPIYRMSKAVLRGMMKKRAGR
FABG_CUPLA      EEDVEAMIKTAVDAWGTVDILVNNAGITRDGLLMRMKKSQWQEVIDLNLTGVFLCTQXXXXXXXXXXXGR
BUDC_KLEPN      RDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGK
LVR_LEIAQ       EAQVEAYVTATTERFGRIDGFFNNAGEGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGM
PHBB_ZOORA      ---------------GPIDVLVNNAGITKDAMFHKMTPDQWNAVINTNLTGLFNMTHPVWSGMRDRSFGR
FABG_SHIFL      PASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGR
FABG_ECOLI      PASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGR
NODG_RHIS3      RDEVKALGQKAEADLEGVDILVNNAGITKDGLFVRMSDADWDTVLEVNLTAVFRLTRELTHPMMRRRHGR
FABG_BACSU      PEDVQNMIKETLSVFSTIDILVNNAGITRDNLIMRMKEDEWDDVININLKGVFNCTKAVTRQMMKQRSGR
FABG_PSEAE      DESVAATLEHIQQHLGQPLIVVNNAGITRDNLLVRMKDDEWFDVVNTNLNSLYRLSKAVLRGMTKARWGR
HCDR_XANP2      EGDVNAAIAATMEQFGAIDVLVNNAGITGNSEAGTTPVEQFDKVMAVNVRGIFLGCRAVLPHMLLQGAGV
FABG_VIBCH      PESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGR
UCPA_SALTY      FASVQAAVARAKETEGRIDILVNNAGVCRLGNF--LDMSEEDRHIDINIKGVWNVTKAVLPEMIKRKDGR
UCPA_SALTI      FASVQAAVARAKETEGRIDILVNNAGVCRLGNF--LDMSEEDRHIDINIKGVWNVTKAVLPEMIKRKDGR
BACC_BACAM      EPACQNAILSAVDKFGGLDVLINNAGIEIVAPIHEMELSDWNKVLNVNLTGMFLMSKHALKYMLKSGKGN
FABG_STAES      GDEVKEMIKEVVSQFGSVDVLVNNAGITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQMLRQRSGA
FABG_STAEQ      GDEVKEMIKEVVSQFGSVDVLVNNAGITKDNLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQMLRQRSGA
UCPA_ECOLI      PASVAAAIKRAKEKEGRIDILVNNAGVCRLGSF--LDMSDDDRHIDINIKGVWNVTKAVLPEMIARKDGR
PHAB_PARDE      YDACAAGIKQVEEELGPIAVLVNNAGITRDAMFHKMTPQQWKEVIDTNLTGLFNMTHPVWSGMRDRKYGR
FABG_RICPR      -----------------LDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGR
NODG_RHIME      RDEVKALGQRAEADLEGVDILVNNAGITKDGLFLHMADPDWDIVLEVNLTAMFRLTREITQQMIRRRNGR
UCPA_ECO57      PASVAAAIKRAKEKEGRIDILVNNAGVCRLGSF--LDMSDDDRHIDINIKGVWNVTKAVLPEMIARKDGR
FABG_RICTY      -----------------LDILVCNAGITSDTLAIRMKDQDFDKVIDINLKANFILNREAIKKMIQKRYGR
FABG_RICBR      -----------------LDILVCNAGITKDTLAIRMKNEDFDQVIDINLKANFILNREAIKKMMTNRYGR
PHAB_ACISR      ---------------GRVDVLVNNAGITRDATFKKMSYEQWSQVIDTNLKTLFTVTQPVFNKMLEQKSGR
YOHF_ECOLI      LPEGALALEKLIQRLGRIDVLVNNAGAMTKAPFLDMAFDEWRKIFTVDVDGAFLCSQIAARQMVKQGGGR
DHRS4_RABIT     AEDRERLVATALNLHGGIDILVSNA--AVNPFFGKLDVTVWDKILDINVKAMALMTKAVVPEMEKRGGGS
FABG_BUCAP      TDSILEKMKEICQKKYSIDILINNAGITSDNLLVYMSNKEWENVIKINLTSVFYMSKSVIRSMIKKRYGR
FABG_HAEIN      KESIETLLEQIKNDFGDIDILVNNAGITRDNLLMRMKDEEWFDIMQTNLTSVYHLSKAMLRSMMKKRFGR
GNO_GLUOX       QDAVIDGVAAIERDMGPIDILINNAGIQRRAPLEEFSRKDWDDLMSTNVNAVFFVGQAVARHMIPRGRGK
KDUD_BACSU      PEAIKDSAAELFENR-QIDILVNNAGIIHREKAEDFPEENWQHVLNVNLNSLFILTQLAGRHMLKRGHGK
FABG2_BRANA     EADVDAMMKTAVDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXX
LINC_PSEPA      EEDVKALVAQTLAAFGGLDGSFNNAAIPQAGPLAEVSLERFRQSMDINVTGTFLCMKYQILAMIERGTGS
FABG3_BRANA     EADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXX
FABG1_BRANA     EADVEAMMKTAIDAWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXX
Y4VI_RHISN      EDDVVALRALLEKRFSRIEVLVNNAGIGPTAATADTALEDFQRALAINLVGAY--SVACETAKLMKPGAA
PECR_HUMAN      EEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGS
HSD_STREX       EDW-QRVVAYAREEFGSVDGLVNNAGISTGMFLETESVERFRKVVDINLTGVFIGMKTVIPAMKDAGGGS
PECR_RAT        EEEVNNLVKSTLAKYGKINFLVNNAGGQFMAPAEDITAKGWQAVIETNLTGTFYMCKAVYNSWMKDHGGS
HSD_MYCTU       PAQWTAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGS
HSD_MYCBO       PAQWTAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGS
FABG_SALTY      PASIESVLENIRAEFGEVDILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAMMKKRCGR
FABG_SALTI      PASIESVLENIRAEFGEVDILVNNAGITRDNLLMRMKDDEWNDIIETNLSSVFRLSKAVMRAMMKKRCGR
LIMC_RHOER      LESLTAEVDRAVSTLGRLDIVSANAGIA-SVPFLSHDIPTWRQMIDINLTGVWHTAKVAVPHILERG-GS
PECR_MOUSE      EEEVSNLVKSTLAKYGKINFLVNNGGGQFMAPVEDITAKGWHAVIETNLTGTFYMCKEVYNSWMREHGGS
BAIA1_EUBSP     RDAVMAAVGTVAQKYGRLDVMINNAGITMNSVFSRVSEEDFKNIMDINVNGVFNGAWSAYQCMKDAKQGV
Y1385_MYCBO     ADDVDILIRTAVERFGGLDVMVNNAGITRDATMRTMTEEQFDQVIAVHLKGTWNGTRLAAAIMRERKRGA
Y1350_MYCTU     ADDVDILIRTAVERFGGLDVMVNNAGITRDATMRTMTEEQFDQVIAVHLKGTWNGTRLAAAIMRERKRGA
DHSO_RHOSH      QASIDRCVAELLDRWGSIDILVNNAALFDLAPIVEITRESYDRLFAINVSGTLFMMQAVARAMIAGGGGK
BAIA2_EUBSP     RDAVMAAVGQVAQKYGRLDVMINNAGITSNNVFSRVSEEEFKHIMDINVTGVFNGAWCAYQCMKDAKKGV
YXBG_BACSU      ENSVKAFADQIKDACGTIDILFNNAGDQEGGKVHEYPVDLFDRIIAVDLRGTFLCSKYLIPLMLENG-GS
FIXR_BRAJA      -------------AGAPLHALVNNAGVSPKTPTGDTSTDTWMRVFHLNLVAPILLAQGLFDE-LRAASGS
FABG4_BRANA     EADVDAMMKTAVDKWGTIDVVVNNAGDTLLIRMKKSQ---WDEVMDLNLTGVFLCSQAATXXXXXXXXXX
IDNO_ECOLI      KHEIDAAVEHIEKDIGPIDVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVERKAGK
IDNO_ECOL6      KHEIDAAVEHIEKDIGPIDVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTAVFLVSQAVTRHMVERKAGK
FABG_THEMA      RDQIXXXXXXXXQKYGRIDVLVNNAGITRDALLVRMKEEDWDAVINVNLKGVFNVTQMVVPYMIKQRXXX
FABG_ARATH      ATDVDAMMKTALDKWGTIDVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQAAVXXXXXXXXXX
BUTA_STAAW      RDDVFNAVRQTAAQFGDFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGK
BUTA_STAAS      RDDVFNAVRQTAAQFGDFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGK
BUTA_STAAR      RDDVFNAVRQTAAQFGDFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGK
BUTA_STAAN      RDDVFNAVRQTAAQFGDFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGK
BUTA_STAAM      RDDVFNAVRQTAAQFGDFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGK
BUTA_STAAC      RDDVFNAVRQTAAQFGDFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGK
PECR_PONAB      EEEVNNLVKSTLDIFGKINFLVNNGGGQFLSLAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGS
FABG_CHLMU      NDMVSAQVQKFLAEYGTIDVVVNNAGITRDSLLMRMSEEEWSSVIDTNLGSIYNVCSAVIRPMIKARSGA
DHB8_HUMAN      ----------------------------------------WDKVIAVNLKGTFLVTQAAAQALVSNGCGS
DHB8_CANFA      AGAVRRLLEQVQACFSPPSVVVSCAGLTRDEFLLRMSEDDWDRVIAVNLKGIFLVTQAAAQALVSSGCGS
PECR_CAVPO      EEEVNNLMKSTLALYGKIDFLVNNGGQFWSSPEHISSKG-WHAVIETNLTGTFYMCKAAYNSWMKEHGGA
HDHA_ECOLI      EQELSALADFAISKLGKVDILVNNAGGGGPKPFDMP-MADFRRAYELNVFSFFHLSQLVAPEMEKNGGGV
HDHA_ECO57      EQELSALADFAISKLGKVDILVNNAGGGGPKPFDMP-MADFRRAYELNVFSFFHLSQLVAPEMEKNGGGV
FABG_CHLTR      NDMVSAQVQNFLAEYNTIDVIVNNAGITRDALLMRMSEEEWSSVINTNLGSIYNVCSAVIRPMIKARSGA
YGFF_ECOLI      ENQVVAMFTAIDQHDEPLAALVNNAGILFTCTVENLTAERINRVLSTNVTGYFLCCREAVKRMLKNGGGA
FABG5_BRANA     EADVDSMMKTAVDKWGTIDVVVNNAGITRDTLLIRMKKSQWDEVIDLNLTGVFLCTQAATXXXXXXXXXX
CMTB_PSEPU      EQGAQGLHRAAVERFGSVQILVNCAGGGVIRPFLEHTPETLKATIDRNLWTALWCSRVFLPDMLARQYGR
CMTB_PSEP1      EQGAQGLHRAAVERFGSVQILVNCAGGGVIRPFLEHTPETLKATIDRNLWTALWCSRVFLPDMLARQYGR
FABG_RICFE      -----------------LDILVCNAGITSDTLAIRMKDEDFDKVIDINLKANFILNREAIKKMMQNRYGR
DHRS4_BOVIN     AEDRERLVATAVKLHGGVDILISNA--AVSPFFGSVPEEVWDKILDVNVKATALLTKAVVPEMAKRXXXX
FABG_BUCBP      PNEITKTMDFVYKNFGRVDILINNAGIIRDKLLINMKTQDWNSVLNVNLNSIFYMSKSVIRNMIKNKQGK
FABG_BUCAI      IDSITEKIQEIYKKKHSIDILINNAGIKEDNLLVNMKSTEWDDVIKTNLSSVFHLVKSVIRSMIKKRQGR
DHG_BACSU       EEDVKNIVQTAIKEFGTLDIMINNAGLENPVPSHEMPLKDWDKVIGTNLTGAFLGSREAIKYFVENDIGN
DHG2_BACME      EEDVVNLVETAVKEFGSLDVMINNAGVENPVPSHELSLENWNQVIDTNLTGAFLGSREAIKYFVENDIGN
FABG_RICCN      -----------------LDILVCNAGITSDTLAIRMKDEDFDKVIDINLKANFILNREAIKKMIQNRYGR
YVAG_BACSU      EEGCNELFQAYPE----VDILVNNLGIFEPAEYFDIPDDEWFRFFEVNIMSGVRLTRRYLHNMIEKKEGR
YMFI_BACSU      ADLSAGADKLTSSIVQPIDAIVLNSGRSHFGLITDVDNATVQEMVQLHVASPYMLTRNLLPGMIRNKSGA
Y2146_BRAJA     -------FETAERHFGGVDLLVNNASAMHLTPRDRAELAVWDQTMATNLRGTLLCCRQAIPRMIARGGGA
MOAE_KLEAE      --------------------------------------------LDGNLTSAFASVRACLPSLI-ARRGN
DHRS7_HUMAN     TGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGK
Y4LA_RHISN      -------FETAERHFGGVDLLVNNASAMHLTPRDRADLAVWDQTMATNLRGTLLCCRQAIPRMIARGGGA
KDUD_ECOLI      IDGIPALLDRAVAEFGHIDILVNNAGREDALEFSEKD---WDDVMNLNIKSVFFMSQAAAKHFIAQGGGK
Y325_THEMA      ------------ETFGRLDILVNNAGIVPYGNIEETSEEDFDKTMAVNVKGPFLLSKYAVEQMKKQGGGV
DCXR_BOVIN      WEATEQALGGV----GPVDLLVNNAAVAFLQPFLEVTKEAYDMSFSVNLRAVIQVSQIVARGLIARGAGV
Y2403_STAAW     KEEVDELIKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTVQAALPTMLEQSSGH
Y2370_STAAS     KEEVDELIKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTVQAALPTMLEQSSGH
FABG_CHLPN      NGGVKDCVQKFLDKHNKIDILVNNAGITRDNLLMRMSEDDWQSVISTNLTSLYYTCSSVIRHMIKARSGS
Y2778_STAA8     KEEVDELIKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGH
Y2488_STAAC     KEEVDELIKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGH
Y2422_STAA3     KEEVDELIKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGH
YVRD_BACSU      TD-EAAAFIEKVNEIGDIDILVNNLGFFEVKDFADVTDEEWNQYFEVNVMSAVRTSRHFLPKMLAKNSGR
YLX6_SCHPO      ADQIETAIEKVIQTLGPIDVLINNAGLADDTPFEQLSHESWDHDVSLVLRGNYLTQRYVIPHMAKQGGGS
CBR2_PIG        WEATERALGGV----GPVDLLVNNAAVALMQPFLDTTKEVFDRSFNVNLRSVFQVSQIVARSMIERGVGS
NOG4_RHIME      ----------------------------------------WDIVLEVNLTAMFRLTREITQQMIRRRNGR
FABG2_SYNY3     LESMTAAAAEITDKLGPVYGVVANAGITKDNFFPKLTPADWDAVLNVNLKGVAYSIKPFIEGMYERKXXX
CBR4_DANRE      EEEVQKAFETINKTCGTVGFLVNAAGINRDALLLRSKSEDMLSVLHTNLLGSMLTCKAAVRNMLSHG-GA
Y2478_STAAM     KEEVDELMKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGH
Y2266_STAAN     KEEVDELMKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAQAALPTMLEQSSGH
SRLD_ECOLI      EQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLCAREFSRLMXXXXXXX
YTKK_BACSU      KEDLLRIAEAALNRFGRIDFLINNAGPYI---FERKKLAEWYGMLEGNLSAVFHLFKAVIPIMRKQQFGR
Y019_THEMA      ENSVKNMVRKTVEIYGGVDVLVNNAAVMSVKSIFERPLEEWERVIRVNLTGPYICSRYCAEEMIKRGGGV
Y2049_STAEQ     KSNIDDMLKAVIDHFGHIDIVVNSAGQSLSSKITDYNVEQWDTMIDVNIKGTLHVLQATLPYLLKQSSGH
Y2036_STAES     KSNIDDMLKAVIDHFGHIDIVVNSAGQSLSSKITDYNVEQWDTMIDVNIKGTLHVLQATLPYLLKQSSGH
CBR4_XENTR      ENEIQDTFKEITNNLGNVDYLVNSAGIRRDALLLRTRSEDIRSLLSVNLVGTIQTCKLALRSMIQQQGGA
DHGB_BACME      ESDVINLVQSAIKEFGKLDVMINNAGMENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDKGT
DHB11_MACFA     CSNREDIYSSAKKVKGDVSILVNNAGVVYTSDLFATQDAQIEKTFEVNILAHFWTTKAFLPAMMKNNHGH
BUDC_KLETE      RDQVFAAVEQARKALGGFNVIVNNAGIAPSTPIESITEEIVDRVYNINVKGVIWGMQAAVEAFKKEGHGK
TRNH_DATST      ISQRQTLMESVTSSNGKLNILINNAGTTIPKEATNFTAEDYSIIMGTNFEASYNLCQLAHPLLKASGNAS
DHRS4_MOUSE     AEDREKLITTALKRHRGIDILVSNA--AVNPFFGNLDVTVWDKVLSINVTATAMMIKAVVPEMEKRXXXX
Y2567_STAAR     KEEVDELIKMAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTAKAALPTMLEQSSGH
CPNA_COMTE      ENHWTGAVDTILAESDRLDALVNNAGILTLKPVQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHKGC
CPNA_COMS9      ENHWTGAVDTILAESDRLDALVNNAGILTLKPVQDTSNEEWDRIFEINVRSVFLGTRAVIEPMRKAHKGC
DHRS7_MOUSE     TSSHEAATKAVLQEFGKIDILVNNGGRSQRSLVLETNLDVFKELINLNYIGTVSLTKCVLPHMIERKQGK
DHB11_RAT       REEIYSAVRKVKEEVGDVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMMKNNHGH
BUTA_STAES      ---------------GQLDVMVNNAGVDAVTPILEIGEEELSKLFNINVFGTLFGIQAAANQFIQKSKGK
BUTA_STAEQ      ---------------GQLDVMVNNAGVDAVTPILEIGEEELSKLFNINVFGTLFGIQAAANQFIQKSKGK
YGCW_ECOLI      EGAPQKIIAACCERFGTVDILVNNAGICKLLDFGRAD---WDPMIDVNLTAAFELSYEAAKIMIPQKSGK
XYLL_PSEPU      FAECQRVMAAALERFGRLDILINNVGGTWAKPFEHYQEREIEAEVRRSLFPTLWCCHAALAPMIEQGSGA
DHB11_PONAB     CSNREDIYSAAKKVKGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMMKNNHGH
YQJQ_BACSU      ---------------GSIDVLINNAGFGIFETVLDSTLDDMKAMFDVNVFGLIACTKAVLPQMLEQKKGH
YOXD_BACSU      ------------EQLGDIDILINNAGISKFGGFLDLSADEWENIIQVNLMGVYHVTRAVLPEMIERKAGD
CBR4_BOVIN      EHDVQNTFEEIEKNLGRVNFLVNAAGINRDNLLVRTNTEDMLSQLHTNLLGSMLTCRAALKTMIKQQRGS
YUSZ_BACSU      EQSIV-SFGKAVSAYAPIDLLVNNAGTAYGGFIEDVPMEHFRQQFETNVFGVIHVTKTVLPYIRKHGGAK
RHLG_PSEAE      EAGARRLAQALGELSARLDILVNNAGTSWGAALESYPVSGWEKVMQLNVTSVFSCIQQLLPLLRRSASAR
HETN_ANASP      TSQLSALVQQAQDIVGPIDVLINNAGIEINGTFANYSLAEIQSIFNTNXXXXXXXXXXXXPSMMERGSGR
DHB11_HUMAN     CSNREDIYSSAKKVKGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGH
DER_CHICK       WD----ATEAAVGAAGPFELLVNNAAVAMLQPFLQVTREAVERSFDVNFRAVLHVSQIVARQMIAQGLGA
FABG6_BRANA     ---------------GQIDVIANNAGIT---------------VIALNLTGVFLCSQAATXXXXXXXXXX
DRS7B_DANRE     TSVVCSAAAEILKRHGHVDVLINIAGVSYRGNILDTHVSVQREVMETNYFGPVALTQAILPSMVDRGSGH
DHB11_MOUSE     REEIYSAAKKVKEEVGDVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHFWTTKAFLPVMMKNNHGH
TRN1_DATST      ---------------GKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGN
PGDH_CAVPO      QEQLRDTFTKVVDYFGRLDILVNNAGV--------NNEKNWEKTLQINLVSVISGTYLGLDYMSKQHGGE
DHRS4_RAT       AEDREKLVNMALKLHQGIDILVSNA--AVNPFFGNLDVTVWNKVLSINVTASAMMIKAVVPAMEKRXXXX
DHG3_BACME      EEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIGN
FADH_BACSU      DSAASDMIKEAVKAFGRLDALINNAAGNFICPAEKLTPNGWKAVIEIVLNGTFFCSQAAARHWIQKQQGV
DHGA_BACME      EEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIGN
DHG4_BACME      EEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIGN
FOX2_NEUCR      A-----VVKAAIDAFGRVDIVVNNAGILRDKAFHNMDDSLWDPVMNVHARGTYKVTKAAWPYFLKQKYGR
FOX2_CANTR      ---------------GTIDILVNNAGILRDRSFAKMSKQEWDSVQQVHLIGTFNLSRLAWPYFVEKQFGR
TRN2_DATST      ----------ANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAHPFLKASERGN
PGDH_MACFA      QQQLRDTFRKVVDHFGRLDILVNNAGV--------NNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGE
PGDH_HUMAN      QQQLRDTFRKVVDHFGRLDILVNNAGV--------NNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGE
DRS7B_PONAB     SGAIVAAAAEILQCFGYVDILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGH
DCXR_CAEEL      ----------------PIHGLVNNAGIATNHAIGQITQQSIDRTFAVNVRGPILIAQLVARNFVDRQIGS
Y182_METEA      -----GLVEAAVQQFGRLDVLVNNSGVYEFAAIEEVTEEHYRRIFDVNVLGVLLATQAASKHLGEGG--S
Y0419_STAS1     ---------------GQIDILVNSAGLMLSSAITEGDVEAWEAMIDVNIKGTLYTINAVLPSMLNQSSGH
PGDH_BOVIN      QEQLRDTFRKVVDHFGKLDILVNNAGV--------NNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGE
KDSR_HUMAN      YNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGR
GRDH_ORYSJ      VDEVAGAYGGA------IDILVNNAAEQYERP-SITDITELERVFRTNIFSYFFMSKHAVKRMRDXXXXX
DRS7B_BOVIN     PGAIAGAASEILQCFGHVDVLINNAGISYRGAIVDTSPDVDKRVMETNYFGPVALTKALLPAMIRRRQGH
TRN2_HYONI      ---------------GKLNILVNNAGIVIYKEAKDYTMEDYSHIMSINFEAAYHLSVLAHPFLKASERGN
SDR1_PICAB      PSQVAQLFDTAEHAFGPLHIVVNNAGVTDSKTLAQTSDEEWDRIFQVNCKGAFLCSREAAKXXXXXXXXX
DRS7B_MOUSE     PGTIAAAAAEILQCFGYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKQGH
CBR2_MOUSE      WDATEKALGGI----GPVDLLVNNAALVIMQPFLEVTKEAFDRSFSVNLRSVFQVSQMVARDMINRGVGS
PGDH_MOUSE      QKQLRDTFRKVVDHFGRLDILVNNAGV--------NNEKNWEQTLQINLVSVISGTYLGLDYMSKQNGGE
DRS7B_HUMAN     SGAIVAAAAEILQCFGYVDILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGH
GRDH2_ARATH     EENCKRVVEEVVNSFGRIDVLVNCAAEQHEVSIEDIDEARLERVFRTNIFSQFFLVKYALKHMKEGS--S
GRDH_DAUCA      DDNCKKVVDQVVNAFGSIDVLVNNAAEQYKASTVEDDEERLERVFRTNIFAYFFMARHALKHMREGS--T
DHG2_BACSU      EEGIQALLDTALEHFGTLDVMVNNSGNGVEAMPHEMSLEDWQRVIDVNVTGTFLGAKAALNHMMKNNIGN
DHB13_HUMAN     REEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKTFEVNILGHFWITKALLPSMMERNHGH
DECR_HUMAN      PDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGA
ARDH_CANAL      AEAVDLTFKAINEHHGKISVLVNTAGYAENFPAEEYPAKNAENLMKVNGLGSFYVSQAARPLIQNNMTGS
SDH_RHIRD       EEATKKALAGLPDGFRDIDILVNNAGLALTAPAPQVPLKDWQTMVDTNITGLLNVTHHLLPTLIERK-GI
KDSR_BOVIN      YSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFEDLEVSTFERLMSINYLGSVYPSRAVIATMKERRMGR
DRS7B_XENTR     VEAVNSAANEILHLTGRVDILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALIPSMIKNRRGH
KDUD_DICD3      ISGHAALVEKAVAEFGKVDILVNNAGIIRREDAIEFSEKNWDDVMNLNIKSVFFMSQTVARQFIKQGHGK
KDSR_MOUSE      YNQVENVIKQAQEKLGPVDMLVNCAGTSMSGKFEELEVSSFEKLMSINYLGSVYPSRAVITTMKERRVGR
DHBA_BACSU      SAAIDEITARIEREMGPIDILVNVAGVLRPGLIHSLSDEEWEATFSVNSTGVFNASRSVSKYMMDRRSGS
YUXG_BACSU      EEDVQSAFERAALAYGGIDIVVNNAGLATSSPFDETSLKEWNLNMNVLGTGYFLVAREAFKQMKHQNGGS
YKVO_BACSU      LEDLDKLYDIIKQEKGKLDILFANAGIGNFLPLGEITEEQVDRTFDINVKGTIFTVQKAL-SLFPDKVGS
ARDH_CANTR      AEAVELTFKAINEHHGKVSVLINTAGYAENFPAEEYPAKNAENIMKVNGLGSFYVSQAARPLIQNNMTGS
DRS7B_XENLA     VEAVNTAAKEILHLAGRVDILINNAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALLPSMIKNRRGH
DHB8_MOUSE      ----------------------------------------WDRVIAVNLKGTFLVTQAAAQALXXXXXXX
DHB1_MOUSE      SKSVAAAQACVTEGR--VDVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRMLQAFLPDMKRRHSGR
DHB8_RAT        ----------------------------------------WDRVIAVNLKGTFLVTQAAAQALXXXXXXX
YJDA_BACSU      AHAAFTIHEKISDKLGYPSILINNAAHSASDNYVSLDAKSLDEHYAVNMRSNFLLCVEFARRFKKSNLGR
YHXC_BACSU      EAFCNDVVGQASQVFPSIDILVNNAAEQHVQPIEKITSHQLIRTFQTNIFSMFYLTKAVLPHLKKGS--S
RIDH_KLEAE      ADQVDNLLQGILQLTGRLDIFHANAGAYIGGPVAEGDPDVWDRVLHLNINAAFRCVRSVLPHLIAQKSGD
GRDH1_ARATH     -------------AFGRIDVLINNAAEQYSSTIEEIDEPRLERVFRTNIFSYFFLTRHALKHMKEGS--S
CBR4_XENLA      ENEIQCTFKEIKNNLGNIDYLVNSAGISRDALLLRTRSEDIMSLLSINLVGTIQTCKVALKGMXXXXXXX
SPS19_YEAST     FEQVENAVKKTVEKFGKIDFVIAGAAGNFVCDFANLSPNAFKSVVDIDLLGSFNTAKACLKE-LKKSKGS
LINX_PSEPA      XXXXXXXXXXXVDGFGGLTTLSNTAGIIHPGGFEEESIEGWNKMVAVNQTAIFLGIKAAIPELVKXXXXX
BEND_ACIAD      LETYAGAVSHAIAEYGRIDVLINNVGGAWMKPXXXXXXXXXXXXVHRSLFPALWCCRAVLPEMLKHQQGT
ARDH_PICST      AEAVDATFSSINEHHGKIALLINTAGYCENFPAETYPATNAESIMKVNGLGSFYVSQSARPLIQNNLRGS
DHB1_RAT        SESVAAARACVTEGR--VDVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRMLQAFLPDMKRRHSGR
BDH2_HUMAN      -----------------LDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGN
SDH_AGRT5       EDATEKALAALPDGFRDIDILVNNAGLALTAPAPQVALKDWQTMVDTNITGLLNITHHLLPTLIKQK-GI
FABL_BACSU      PAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGH
DCXR_RAT        WEATEQALSNV----GPVDLLVNNAAVATLQPFLEVTKEACDTSFNVNFRAVVQVSQIVARGMIARGVGA
DCXR_MESAU      ADWE--ATEQALSSVGPVDXXXXXXXXXXXQPFLEVTKEAFDMSFNVNLRAVIQVSQIVARGMIARGAGA
BDH2_MOUSE      -----------------IDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKMLAQKSGN
BDH2_BOVIN      -----------------LDVLFNVAGFVHHGTILDCEETDWDFSMNLNVRSMYLMIKAFLPKMMAQKSGN
UXUB_BACSU      ---------------GAVDLLINGAGGNH--PDAITDVETYEEVFSTNFTGAFLASQVFGKELLKADSPA
S16C6_BOVIN     ---------------GNVTILINNAGVVTGREFLKTPDHMVERSFLVNVMSHFWTYKAFLPAMLEANHGH
FOX2_YEAST      ---------------GRVDVLINNAGILRDVSFAKMTEREFASVVDVHLTGGYKLSRAAWPYMRSQKFGR
DHRS4_PIG       AEDRERLVAMAVNLHGGVDILVSNA--AVNPFFGNIIDAVWDKILHVNVKATVLMTKAVVPEMEKRXXXX
RDH10_RAT       ---------------GEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGH
RDH10_MOUSE     ---------------GEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGH
RDH10_HUMAN     ---------------GEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGH
RDH10_BOVIN     ---------------GEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGH
DRS7B_RAT       ---------------GYVDILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKRGH
TRNH1_ARATH     ---------------GKLDILINNLGAIRSKPTLDYTAEDFSFHISTNLESAYHLSQLAHPLLKASGCGN
Y484_MYCTU      -----------------VDVLVNNAGGAKGLQFADADLEHWRWMWDTNVLGTLRVTRALLPKLIDSGDGL
STCU_EMENI      PDAVTKLMDQAVEHFGYLDIVSSNAGIVSFGHVKDVTPDEFDRVFRVNTRGQFFVAREAYRHLREGG--R
DECR_MOUSE      PDMVHNTVLELIKVAGHPDVVINNAAGNFISPSERLTPNGWKTITDIVLNGTAYVTLEIGKQLIKAQKGA
RD10A_DANRE     ---------------GEVDLLINNAGVVSGHHLLECPDELIERTMVVNCHAHFWTTKAFLPKMLEMNHGH
DHRS7_ANOGA     -----GKVQSVLEIHGAIDILVNNGGISVRGDALSTAIDVDIRIMLVNYFGSVALTKACLPSMMARKEGR
DHB8_PIG        ----------------------------------------WDKVIAVNLKGIFLVTQAAAQALVXXXXXX
DHB13_RAT       RAEIYKSVDQVKKEVGDIEIVVNNAGAIYPADLLSTKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGH
Y4EL_RHISN      AEGAHASFDAAVKTAGRIRSSICAAIYPRAPLLEITD-DMWDAENAINIKGTYHMMVAAVKHMQEVS-GR
RDH10_XENTR     ---------------GDVYLLLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMEMNHGH
RD10B_XENLA     ---------------GDVYLLLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMEMNHGH
DHRS7_DROME     -----------------VDILINNGGISVRADVASTAVDVDLKVMVVNYFGSVALTKALLPSMVKRGSGH
DECR_RAT        PDMVHNTVLELIKVAGHPDVVINNAAGNFISPSERLSPNGWKTITDIVLNGTAYVTIEIGKQLIKAQKGA
CBR4_HUMAN      EHDVQNTFEEMEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQXXX
RD10A_XENLA     ---------------GDVYLLLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMELNHGH
FABG_ACTAC      ------------EAHGAYYGVVLNAGLTRDNAFPALTDEDWDRVLRTNLDGFYVLHPIMMPMIRRRKAGR
DHG_BACME       ESDVINLVQSAIKEFGKLDVMINNAGLENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGT
YM71_YEAST      AEKIKPFIENLPQEFKDIDILVNNAGKALGSDVGQIATEDIQDVFDTNVTALINITQAVLPIFQAKNSGD
SORD_KLEPN      ATEVQQTIDAIIQRWSRIDGLVNNAGVNFKAPAGRYELAAFEKMVNINQKGVFFMSQAVARQMVKQRAGV
DHG1_BACME      ESDVINLVQSSIKEFGKLDVMINNAGMENPVSSHEMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIGT
RD10B_DANRE     ---------------GDIDLLINNAGVVSGRHLLDCPDELIERTMMVNCHAHFWTTKAFLPKMLELNHGH
MTDH_UROFA      QHKVKEVFKKINEELGPVTGLIANAGVSVALQYNKDD---FNKIFDVNVFGVFNCAQAMAQIWTDTGFQR
DHB4_HUMAN      ----------ALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGR
Y1627_STAS1     PDEVNALIETAYNDFGRIDVLINNAGLMPQSFLEKNKQDEWNQMIDVNIKGVLYGIGAVLPYMRKQKSGH
VER1_ASPPA      PEATAKLMAETVRHFGYLDIVSSNAGIVSFGHLKDVTPEEFDRVFRVNTRGQFFVAREAYRHMREGG--R
DRS7C_BOVIN     ISCVQDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPIILTKALLPDMISRRTGQ
DECR2_HUMAN     PPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGV
CBR4_MOUSE      EQDVQSTFQEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMISQLHTNLLGSMLTCKAAMKTMIQQXXXX
THR1_GLOLA      VDQIVKMFGEAKQIWGRLDIVCSNSGVVSFGHVKDVTPEEFDRVFAINTRGQFFVAREAYKH-LEVG-GR
DHB4_RAT        ----------ALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHLRGSFQVTRAAWDHMKKQNYGR
DHB4_MOUSE      ----------ALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGR
YDFG_ECOL6      -----------------IDILVNNAGLALGMPAHKASIEDWETMIDTNNKGLVYMTRAVLPGMVERNHGH
YDFG_ECO57      -----------------IDILVNNAGLALGMPAHKASIEDWETMIDTNNKGLVYMTRAVLPGMVERNHGH
Y4MP_RHISN      RASCTSASDEVLSAFGVANILINNAG--ITQPVKTLDIADWQRIVAVNMTGVLNLSQVFIPNMRQNGGGS
DHB13_MOUSE     ---------------GDVEIVVNNAGAIYPADLLSAKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGH
DECR2_PONAB     PPAIVAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGV
YDFG_ECOLI      -----------------IDILVNNAGLALGMPAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERNHGH
SOU1_SCHPO      ------------ELGGRLDVMIANAGIAIPLSLEDKNEDIWTKVVGINLNGAYYTAQAAGHHFKKQGKGS
RDHE2_MOUSE     ---------------GDVSILINNAGIVTGRNFLDCPDDLMEKSFDVNFKAHLWMYKAFLPAMIANNHGH
MAS1_AGRT9      -DWVDTTIAKFNRIDG----LVNNAGCGDHVDLEKENVELLQKQWDINCVAPLIMTKLCMPYLIESGSGR
YDFG_SHIFL      RAAIEEMLASLPAEWSNIDILVNNAGLALGMPAHKASVEDWETMIDTNNKGLVYMTRAVLPGMVERNHGH
Y945_MYCTU      HERVPKVFAELSDEIGGIDRVIVNAGIGKGARLGSGKLWANKATIETNLVAALVQIETALDMFNQRGSGH
YQ53_SCHPO      VKSVETAFKDAKRRFGNVDIVINNAGYGLVGEFESYNIEEMHRQMNVNFWGVAYITKEALNLMRESGGGR
TODD_PSEP1      LDSHREAVARCVEAFGKLDCLVGNAGQLVDIPDDLISEA-FEEMFEVNVKGYILAAKAALPALYQSK-GS
S16C6_MOUSE     ------------EEVGDVTILINNAGVVTGKSFLNTPDHLVEKSFLVNAISHFWTCKAFLPAMVKANHGH
BNZE_PSEPU      LDSHREAVARCVEAFGKLDCLVGNAGQLVDIPDDLISEA-FEEMFEVNVKGYILAAKAALPALYQSK-GS
DHB8_CALJA      ----------------------------------------WDKVIAVNLKGTFLVTQAAGQALXXXXXXX
CBR4_RAT        ---VHSTFEEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMLSQLHTNLLGTMLTCRAAMRTMIQQXXXX
KDSR_DICDI      KIKVKETIAQIVSKNGKIDCLINCAGFAIPGYFIEQDEEIFEKTMQLDYFGSLYATKEVVPLMIENGGGH
DCXR_HUMAN      WEATERALGSV----GPVDXXXXXXXXXXXQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVGA
YHDF_BACSU      ENHCEQAVQQTVDHFGKLDILVNNAAEQHPQDILNISTEQLEKTFRTNIFSMFHMTKKALPHLQEGC--A
DECR2_MOUSE     PPEVMTAVDQALQEFGKINILINCAAGNFLCPASALSFNAFKTVVDIDTIGTFNVSSVLYKKFFRDHGGV
DHI1_SAISC      MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNFFHDDIHHVRKSMEVNFLSYVVLTVAAMP-MLKQSNGS
BPHB_PSES1      LADHQKAARECVAAFGKIDCLIPNAGWDYSMPL--VDIAAFDEVFHINVKGYLLAVKACLPALVQSR-GS
YWC4_CAEEL      PGMVSDAFDKIDMKFGKVPILVNNAAGNFIMATELLSSNAYGTIIDIVLKGTFVTTELGKRCIQNKTGAS
YDFG_SALTY      -----------------IDVLVNNAGLALGLPAHKASVEDWETMIDTNNKGLIYMTRAVLPGMVERNRGH
YDFG_SALTI      -----------------IDVLVNNAGLALGLPAHKASVEDWETMIDTNNKGLIYMTRAVLPGMVERNRGH
RDH8_HUMAN      --------------QGEVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLPGMKRRRQGH
DHK2_STRVN      EADARRLVDTAVEHYGRLDVLVNNAGRTRAIPHADLAAAVWREILGLNVIGTWQTTVAAMPHLARXXXXX
DHB12_XENTR     -----------------IGVLVNNVGVSYEHPEYFLEIPTLDKMININITSVCQMTRLVLPGMLGRGRGV
DECR2_DANRE     PETILAAVDETLKTFGRVDILINNAAGNFLCPATSLSFNAFKTVMEIDTMGTFNTSKVIYDKWFKDHGGS
DCXR_MOUSE      WEATEQALSNV----GPVDXXXXXXXXXXXQPFLEVTKEACDTSFNVNLRAVIQVSQIVAKGMIARGVGA
DRS7C_HUMAN     ISCVPDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKALLPNMISRRTGQ
RDHE2_HUMAN     CSQKEGVYRVADQVKGDVSILINNAGIVTGKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIANDHGH
MFEA_DICDI      ----------AMDSFGGVDILINNAGILRDVSFGKMTDGDWDLVYRVHAKGAYKLSRAAWNHMREKNFGR
DRS7C_XENTR     INNMEAMGKEIQDCYGCVDVLINNASMKMKGPLQSVSLELDKKIMDANYFGPITLVKAILPHMISRRTGQ
DRS7C_MOUSE     ISCVQDVAKEVLDCYGCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKVLLPNMISRRTGQ
T4HR_MAGGR      VEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKH-LEIG-GR
EPHD_MYCTU      AEAVEAFAERVSAEHGVPDIVVNNAGIGQAGRFLDTPAEQFDRXXXXXXXXXXXXCRAFGQRLVERGTGH
EPHD_MYCBO      AEAVEAFAERVSAEHGVPDIVVNNAGIGQAGRFLDTPAEQFDRXXXXXXXXXXXXCRAFGQRLVERGTGH
ENTA_ECOLI      --------------------LVNAAGILRMGATDQLSKEDWQQTFAVNVGGAFNLFQQTMNQFRRQRGGA
HCD2_DROME      EKDVSAALQTAKDKFGRLDLTVNCAGTATAVKFNKNRLEDFQRVININTVGTFIRLSAGLMGANEPNQGV
DECR2_RAT       PPAVMAAVDQALKEFGKIDILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDHGGV
DCXR_CAVPO      WEATEQALSNV----GPXXXXXXXXXXXXXQPFLEVTKEACVTSFNVNLRAVIQVSQIVAKGMIARGVGA
YHXD_BACSU      ------------------------------------------KTFEVNVFSLYWVVKAALPYLPEGA--S
Y5909_MYXXD     ADATLERIRALDAEAGGLDLVVANAGVGGTTNAKRLPWERVRGIIDTNVTGAAATLSAVLPQMVERKRGH
BDH_CHICK       --------------------LVNNAGISTFGEVEFTSMDTYMEVAEVNLWGTVRTTKAFLP-LIRRSKGR
YAY8_SCHPO      ----------ALKKLGWIDVLVNNAYQQVAQSIEDIDDEQWDLTFKTNIFSFFWVTKAAISHMKSGS--S
Y0585_STAHJ     QVEVDALVAKVIDVFGHVDIFVNCAGVMRSSKITDYQVESWDSMVDTNIKGLLYSLNAILPKFEAQGSGH
RDH16_HUMAN     TESVAAAAQWVKECVRDKGLLVNNAG--ISLPTAPNELLTKQTILDVNLLGVIDVTLSLLPLVRRAR-GR
HCD2_HUMAN      EKDVQTALALAKGKFGRVDVAVNCAGIAYNLKKGQTHLEDFQRVLDVNLMGTFNVIRLVAGEMGQGQRGV
GS39_BACSU      EEFCNEAVEKTVKELGGLDILVNNAGEQHPKESIK-DITSEQRTFKTNFYSQFYLTKKAID-YLKPG-SA
Y4EK_RHISN      VSEVYGKIAGEK-----IDVLVNNAG-LLTASASLVDLSEIDAMIDINIRSVFKLTRHVLKQMIERRRGH
RDH2_RAT        TESIVAATQWVKERVGNTGLLVNNAG--ISGHLGPNEWMNKQNILDVNLLGMIEVTLSTVPLVRKAR-GR
DHR11_MOUSE     EEDILSMFSAVRSQHSGVDICINNAGMARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNIGH
DHR11_HUMAN     EEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGH
PGDH_RAT        QKQLRDTFRKVVDHFGRLDILVNNAGV--------NNEKNWEQTLQINLVSVISGTYLGLDYMSKQXXXX
DHB12_ANAPL     REDIYDRIRAGLEGL-EIGVLVNNVGISYSYPEYFIDVPTIDKMININIMSVCKMTRLVLPGMLERSKGV
ADH2_CERRO      KQSIKSALADVVSKVKYIDALINGAGIL-------TDLNV-ELTMNINLIGLINTTLEGLPLMDKNKQGR
ADH2_CERCO      KQSIKSALADVVSKVKYIDALINGAGIL-------TDLNV-ELTMNINLIGLINTTLEALPLMDKNKQGR
YGHA_ECOLI      EKFARSLVHEAHKALGGLDIMALVAGKQVAIPIADLTSEQFQKTFAINVFALFWLTQEAIPLLPKGA--S
YGHA_ECO57      EKFARSLVHEAHKALGGLDIMALVAGKQVAIPIADLTSEQFQKTFAINVFALFWLTQEAIPLLPKGA--S
SOU1_CANAL      PNDVSKVINEIEKDFGTIDIFVANAGVAWTPEIDVQGYDQWKKIVDCDLNGVYYCAHTVGQIFKKNKSGS
RDH7_RAT        TESIVAATQWVKERVGNRGLLVNNAG--ISVPMGPNE---WMRVLDVNLLGVIEVTLNMLPLVRKAR-GR
RDH3_RAT        TESIVAATQWVKERVGNRGLLVNNAG--ISVPVGPNE---WMRVLDVNLLGVIEVTLNMLPLVRKAR-GR
H17B6_HUMAN     MESIAAATQWVKEHVGDRGLLVNNAGI-----LTPITLCEWMNMLKVNLIGVIQVTLSMLPLVRRAR-GR
DHI1_HUMAN      MTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGS
BPHB_RHOGO      LDSHKETVAKCVETFGKLDCYIGNAGVDYSTPEDRLDEA-FDEMYSINVKGYLLGVKAALGA-LYASRGS
MAS12_AGRRH     NDTMAAWVTAAVEKFGRIDGLINNAGCGEPVNLEKDDYKQFHRQWHINCVAPLRMTELCLPYLCETGSGR
DH12B_XENLA     I--YERIEAGLRDLE--IGVLVNNVGISYEYPEYFLEIPTLDKMININIMSVCQMTRLVLPGMLGRGKGV
Y1430_HAEIN     -------------------------------PAHKADLQDWYQMIDTNIKGLVTITRLVLPNMVARNYGQ
MKAR_AJECN      -----------------ISILVNNVGRSHSTPFVLTPLEELENIIMINCTGTLRITQLVAPGMMQRKRGL
DHR11_CHICK     EEEILSMFSAIKTLHQGVDVCINNAGLARPEPLGKTE--GWRTMIDVNVMAVSICTREAYQSMKERNIGH
DH12A_XENLA     I--YERIEAGLRDLE--IGVLVNNVGVSYEYPEYFLEIPTLDKMININIMSVCQMTRLVLPGMLGRGKGV
H17B6_BOVIN     TESIAAATEWVKECVGDRGLLVNNAGIFHSHGYAEIKIETYRDTLRVNLIGVIEVTLSMLPLVRKAQ-GR
DHB1_PANTR      SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRVLQAFLPDMKRRGSGR
DHB1_HUMAN      SKSVAAARERVTEGR--VDVLVCNXXXXXXXXXXXXXXDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
BDH_RAT         SEEVEKAVSGLKDPEKGMWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSFLP-LLRRAKGR
BDH_HUMAN       --------------------LVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMTKSFLPLIRRAK-GR
ADH_BACOL       KASIKSAFADVIAKVQYIDVLVNGAGILTDPNVELT--------MNINLIGLINTTLEAIPLMDKNKKGR
DHRS2_HUMAN     AEDREQLVAKALEHCGGVDFLVCSAGPLVGSTLGTSE-QIWDKILSVNVKSPALLLSQLLPYM-ENRRGA
DHB12_MACFA     IDKIKTGLAGLE-----IGILVNNVGMSYEYPEYFLDVPVIKKMININILSVCKMTQLVLPGMVERSKGA
DHB12_HUMAN     -----------------IGILVNNVGMSYEYPEYFLDVPVIKKMININILSVCKMTQLVLPGMVERSKGA
BDH_MOUSE       --------------------LVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSFLP-LLRRAKGR
BDH_BOVIN       --------------------LVNNAGISTFGDVEFTSMETYKEVAEVNLWGTVRVTKAFLPLIRRAK-GR
YCIK_ECOLI      --------------------VLHNAGLLGDVPMSEQNPQVWQDVMQVNVNATFMLTQALLPLLLKSDAGS
VIBA_VIBCH      --------------------LVCCAGILHVAPLHEMPMEQVSSIFTVNAFGVLACMQGVASSMKARQQGS
PTR1_LEITA      ---------------GRCDVLVNNASSFYPTPLLRKDAGEGKESLEVAAADLFGSNAIAPYFLIKAFAQR
MKAR_PICST      AEDNYKSLGDAISGL-PVTVLINNVGQSHSVPFLETENKELQDIITINVTATLKITQTVAPVIAETVSGL
DHRS7_DICDI     IDDCKNMVEKVIEKWSKIDICVWNAGSGSLIEFSKLDISIYRDNMELNYFSLVNCTHLVYK-YLEQSHGS
DHB14_HUMAN     EDDVKTLVSETIRRFGRLDCVVNNAGH-HPPPQRETSAQGFRQXXXXXXXXXXXXXKLALP-YLRKSQGN
BPHB_COMTE      -------------AFGKIDTLIPNAGWDYSTPEDKIDAA-FDDIFHVNVKGYIHAVKACLPALVSSR-GS
YBBO_ECOLI      --------------------IFNNAGFGMYGPLSTISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGR
YBBO_ECOL6      --------------------IFNNAGFGMYGPLSTISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGR
BPHB_PSEPU      LEDQKQAASRCVAKFGKIDTLIPNAG-IWDYSTALIDLAAFDEVFHINVKGYIHAVKACLPALV-ASRGN
ADH1_CERCA      KESIKQSLADVISKVQHIDALINGAGILTDPNVELT--------MNINLIGLINTTLEALPLMDKNKHGR
HSDL1_CHICK     ADFSKGREAYQAIKEGEIGILVNNVGLFYTYPDYFTNLSLWD-MINVNIASANMMVHIVLPGMVEKRKGA
DHRS3_BOVIN     REEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALPKSQHINTLGQFWTTKAFLPRMLELQNGH
ABA2_ARATH      EDDISNAVDFAVKNFGTLDILINNAGLC-GAPIRNYSLSEFEMTFDVNVKGAFLSMKHAARVMIPEKKXX
DHRS3_MOUSE     REEVYQMAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHVNTLGQFWTTKAFLPRMLELQNGH
DHRS3_HUMAN     REEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGH
DHB12_BOVIN     K--IKASLAGLN-----IGVLVNNVGMSYEYPEYFLDVPTIKKLITVNALSVCKMTRLVLPGMVERSKGA
DH12A_DANRE     YPKIEKGLAGLE-----IGILVNNVGISYSYPLHIPDLENFTTMINVNITSVCQMTRLVLPRMEARAKGV
YXEK_CAEEL      PAKVAKAFDAVEKKLGHTPILINNAAGNFIMATERLSPNAYGTIIDIVLKGTLVTTELGRRCIQQKRGAS
DHMA_FLAS1      ----------------------------------------WDRYVDVNMTGTFLTCXXXXXXXXDGRSAR
DHB2_MOUSE      PEQIKDAHSKVTEKKG-LWAVVNNAGVFHLPIDGELPMSIYRKCMAVNFFGTVEVTKAFLP-LLRKSKGR
Y3106_PSEAE     EGQVAMSVAEVLGQFGRLDGLVCNAAIANNTPLEALSLGEWTRTLAVNLTGPMLLAKYCTP-YLRAHNGA
HCD2_RAT        EKEVQAALTLAKEKFGRIDVAVNCAGIAVAI---KTTLEDFQRVINVNLIGTFNVIRLVAGVMGQGQRGV
YVX3_CAEEL      PGMVSDTFDKIDKKFGKHPILVNNAAGNFIMATERLSPNAHGTIIDIVLKGTMNVTTELGKRCIQSKTGA
YI78_SCHPO      FSSIKKSVEKAISHFGRIDVLLNNAGYSVYSPLESTTEEQIHNIFNTNVFGALEVIKAITPIFRSQHNGM
ADH2_CERCA      KQSIKSALADVVAKVKYIDALINGAGILTDPNVELT--------MNINLIGLINTTLEGLPLMDKNKQGR
YWFH_BACSU      QHTRAGIFQKIESQCGRLDVLINNIPGGAPDTFDNCNIEDMTATFTQKTVAYIDAIKRASSLMKQNEFGR
YI13_SCHPO      LKSIPGVIESLPKEFADIDVLINNAGLALGTD-KVIDLNIDDAMITTNVLGMMAMTRAVLPIFYSKNKGD
Y452_LISIN      REDNKKLVELAIERYGKVDAIFLNAGIMPNSPLSALKEDEWEQMIDINIKGVLNGIAAVLPSFIAQKSGH
Y432_LISMO      ----------AIERYGKVDAIFLNAGIMPNSPLSALKEDEWEQMIDINIKGVLNGIAAVLPSFIAQKSGH
FABG_SCHPO      ----------------------------------------------------------------------
DHRS1_MOUSE     ESEVKSLFEQVDEQKGRLDVLVNNAYAGVQASFWEVPASIWDDINNVGLRGHYLCSVYGARLMVPAGKGL
VDLC_HELPJ      SNALKEVFLNISAKEDHCDVLINSAGYGVFGSVEDTPIEEVKKQFSVNFFALCEVVQLCLPLLKNKPYSK
DR9C7_MOUSE     SENVKEAAQWVRDQVGEQGLLVNNAGVGLSGPNEWLTIKDFVKVININLVGLIDVTLNMLP-MIKKARGR
DHR11_BOVIN     EEDILSMFSAVRSQHSGVDICINNAGLARPDTLLSGSTSGWKEMFNVNVLALSICTREACQSMREVDDGH
DHI2_MOUSE      AEDISRVLTKAHTASTGLWGLVNNAGNIVVADVELSPVATFRKCMEVNFFGALELTKGLLP-LLRHSRGR
HCD2_MOUSE      EKEIQAALTLAKEKFGRIDVAVNCAGIAYHQKKNKIHLEDFQRVINVNLIGTFNVIRLVAGEMGQGQRGV
DHI1_RABIT      MTFAEQFVAKAGKLMGGLDMLILNHITNASLMFFNNDIHHVRKEMEVNFLSYVVLTVAALP-MLKQSNGS
DCXR_TRIRE      ---------------GKIDAFIANAGATANSGVVDGSASDWDHVIQVDLSGTAYCAKAVGAHFKKQGHGS
ADHR_DROPS      --------------------------------------------INTNLTGMMNTVATVLPYMMGGSGGL
ADHR_DROPE      --------------------------------------------INTNLTGMMNTVATVLPYMMGGSGGL
MTDH_AGABI      TDIVTKTIQQIDADLGAISGLIANAGVSVVKPATELTHEDFKFVYDVNVFGVFNTCRAVAKLWLQKQQKG
MKAR_PICGU      AE-SSYEDLAATIADLPVTVLVNNVGQSHSVPFLETDEKELRNIITINNTATLKITQVVAPKIVKKTRGL
DHRS4_PONAB     AEDRERLVATAVKLHGGIDILVSNA--AVNPFFGSLDVTVWDKTLDINVKAPALMTKAVVPEMEKRXXXX
DHRS4_HUMAN     AEDRERLVATAVKLHGGIDILVSNA--AVNPFFGSIDVTVWDKTLDINVKAPALMTKAVVPEMEKRXXXX
ADH1_CERCO      KDNIKQSLADVIAKVQYIDVLVNGAGILNDPNVEWT--------MNINLIGLINTTLEAIPLMDKNKKGR
MKAR_NEUCR      -----------------IGILINNVGQSHSVPFLQTDRDELQNIVTINCLGTLKTTKVVAPILAQRKKGL
HSDL1_HUMAN     ADFSSGRYLPIREALKDVGILVNNVGVFYPYPQYFTQLSLWD-IINVNIAAASLMVHVVLPGMVERKKGA
DHB2_RAT        PEQIKDVHSEVAEKKG-LWAVVNNAGVLHFPIDGELPMTVYRKCMAVNFFGAVEVTKVFLP-LLRKSKGR
BPHB_BURXL      LEDQKQAASRCVARFGKIDTLIPNAG-IWDYSTALVDLAAFDEVFHINVKGYIHAVKACLPALV-ASRGN
ADHR_DROTE      --------------------------------------------INTNLTGMMNTVATVLPYMMGGSGGL
ADHR_DROMA      --------------------------------------------INTNLTGMMNTVATVLPYMMGGSGGL
ADHR_DROER      --------------------------------------------INTNLTGMMNTVATVLPHMMGGSGGL
MTDH_CLAHE      ---------------GQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGS
HSDL1_BOVIN     ADFSSGRIREALQDRD-IGILVNNVGVFYPYPQYFTQVSLWD-IVNVNIAAASLMVHIVLPGMVERKKGA
HCD2_BOVIN      EKDVQAALTLAREKFGRVDVAVNCAGIAVASKTYNLKLEDFQRVINVNLIGTFNVIRLVAGEMGQGQRGV
DHRS9_BOVIN     PENVKRAAQWVKNQVGEKGLLINNAGLGVLAPNDWLTVEDYREPVEVNLFGLISVTLNMLPLVKKAR-GR
ADHR_DROSU      --------------------------------------------INTNLTGMMNTVATVLPYMMGGSGGL
ADHR_DROGU      --------------------------------------------INTNLTGMMNTVATVLPYMMGGSGGL
MTDH_ALTAL      ---------------GKVDVFIANAGKTADNGILDATVEQWNEVIQTDLTGTFNCARAVGLHFRERKTGS
MKAR_PODAN      EDYLAKLIAGLD-----VGILINNVGQSHSIPFLDTEKTELQSIVTINCLGTLKTTKVVAPILAARKKGL
HDHA_CLOSO      IDIYKEMIDTIIKNEGKIDILVNNFGTG--RPEKDLDLVTFFELFNYNVGSVYRLSKLIIPHMIEXXXXX
DS7CA_DANRE     MENISDVVSEICECYGCVDVLICNSSMKVKAPVQNLSLEMDKTIMDVNYFGPITLAKGVLPLMITRRTGQ
ADHR_DROME      --------------------------------------------INTNLTGMMNTVATVLPYMMGGTGGL
ADHR_DROMD      --------------------------------------------INTNLTGMMNTVATVLPYMMGGAGGL
ADHR_DROLE      --------------------------------------------INTNLTGMMNTCATVLPHMKDGSGGL
RDH7_MOUSE      TESIVAATQWVKERVGNRGLLVNNAGIAINEWLKKEDFA---NILDVNLLGMIEVTLSMLPLVRKAR-GR
MKAR_SCHPO      AETFEKLHQDLVGT--PITVLINNVGQSHYMPFAETTVKEMDDIMHINCFGTLHTTKAVLSIMLRERQKN
MKAR_LODEL      ----------------PITVLINNVGQSHSVPFLETEQKELRDIITINNTATLRITQVVAPAIVKKVRGL
HSDL1_PONAB     -----------------IGILVNNVGVFYPYPQYFTQLSLWD-IINVNIAAASLMVHVVLPGMVERKKGA
DHB12_RAT       -----------------IGVLVNNVGMSYEYPEYFLEIPTIKKLININVLSICKVTRLVLPGMVERSKGV
ADHR_DROIM      --------------------------------------------INTNLTGMMNTCATVLPYMDKQQLGK
ADHR_DROAM      --------------------------------------------INTNLTGMMNTVATVLPYMMGGSGGL
YJGI_ECOLI      RD----AVIDVVRKSGALDILVVNAGIGVFGEALELNADDIDRLFKINIHAPYHASVEAARQMPEGG--R
Y048_HAEIN      -------------------------------------------VFNLNYLGSLLPTQVFAKDMLGKQGAN
SOU2_CANAL      FQDVEKVVKQIESDFGTIDIFVANAGVAWTEEIDVKGVDKWNKVVDVDLNSVYYCAHVVGPIFRKKGKGS
RDH1_HUMAN      --------------------LVNNAGVA--GIIGPTPWLTFQRVLNVNTMGPIGVTLALLP-LLQQARGR
MOMAS_ORYSJ     EGXXXXXXXXXXXRFGKLDVMFNNAGVSGPPCFRMSECTKFERVLAVNLVGPFLGTKHAARVMAPARRGX
DH12B_DANRE     YPKIESGLAGLE-----IGVLVNNVGVSYSYPLNIPDVDSFXXXXXXXXXXS-VCTRLVLPRMVDRSKGV
VDLC_HELPY      SNALKEVFSNISAKEKYCDVLINSAGYGVFGSVEDTPIEEVKKQFSVNFFALCEVVQFCLPLLKNKPHSK
TS2_MAIZE       EDDVRRAVDWALSRHGGLDVYCNNAGQTRAASILSFDAAEFDRVLRVNALGAALGMKHAARAMAPRRXXX
S16C6_HUMAN     ---------------GDVTILVNNADLVTGKPFLDIPDHMVEKSFLVNAITHFWTCKAFLPAVIKANHGH
MKAR_CHAGB      -----------------IGILVNNVGRSHSVPFLETAREELQDIITINCLGTLKTTQVVAPILAKRKKGL
DHI1_MESAU      MTFAEQFVLKAGKLMGGLDMLILNHITYTSMNFFRDEIHALRKAMEVNFISYVVMSVAALP-MLKQSNGS
YF3H_SCHPO      PKEVEHAFAEIQKVFDTIDIVVPNNGICTGKSAIDMTYEEFANEINVNLLGVFNVAHNAGPIFQKQGHGS
MKAR_DEBHA      ND-ANYAKILHTVSNLPVTVLVNNVGQSHSVPFLETEDKELRDIITINNTVTLKITQAVAPVIADTVKGL
MAS11_AGRRH     AAWVTAA----VEKFGRIDGLVNNAGYGEPVNLDKVDYQRFHLQWYINCVAPLRMTELCLPHLYETGSGR
DHRS9_MOUSE     PENVKKTAQWVKSHVGEKGLLINNAGVGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKAR-GR
DHI2_RAT        --------------------LVNNAGNMVVADVELSPVVTFRECMEVNFFGALELTKGLLP-LLRHSRGR
DHI2_RABIT      --------------------LVNNAGHNVVADVELSPVATFRNCMEVNFFGALELTKGLLP-LLHHSRGR
DHB12_MOUSE     -----------------IGVLVNNVGMSYEYPEYFLEIPTIKKLININVLSVCKVTRLVLPGMVERSKGV
CSGA_MYXXA      ---------------GPVDVLINNAGSGLWCALGDVDYADMARTFTINALGPLRVTSAMLPGLRQGALRR
25KD_SARPE      ---------------GHVDVLINGVG-------GLADKDV-ETTVAVNLTGLINTTLMFMPYMTQSGHGM
PTR1_LEIMA      ----------------------------------------------------------------------
MKAR_MAGGR      -----------------VAILINNVGRSHSVPFLQTPREELQNIVTINCLGTLKTTQVVAPIMAQRKRGL
MKAR_CANAL      EENYLKLEKAVFDL--PVTILINNVGQSHSVPFLKTEKKELKDIITINTTATLRITQIVAPIIVSTVRGL
HCAB_PHOLL      FEDNERAVAETVRCFGKLDCFVGNAG-IWDHKISLLDASPEQELMGVNLKGYILGAKAALPALTASEGSM
DS7CB_DANRE     MESVPEVISEILECFCCLDVLVFNSSMKLKAPVHSLSLQMDRLLMDVNYFGPITLVKGFLPSLISRRSGH
DR4L2_HUMAN     AEDRERLVAMAVKLHGGIDILVSNA--AVNPFFGSLDVTVWDKTLDINVKAPALMTKAVVPEMEKRXXXX
MKAR_ASPTN      -----------------VAVLINNVGKSHDVPFALTSEEEMTDIVTINCMGTLRVTQLVVPGMMQRRRGL
DHI1_SHEEP      MTFAEQFVAKAGELVGGLDMLILNHINYTPLRVFSNDIHLLRRSLEVNLLSYVVLSTAALP-MLKQTXXX
DHI1_MOUSE      MTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALP-MLKQSNGS
DHB14_BOVIN     EEDVRTLVSETIRRFGRLDCIVNNAG--YHPPPQETSAQGFRQXXXXXXXXXXXXXKLALPHLRKSR-GN
BPHB_PSEPS      ---------------GKIDTLIPNAG-IWDYSTALVDLAAFDEVFHINVKG-YIHAVKALPALV-ASRGN
YAEB_SCHPO      EDSVREVEQEVRKTNGSLHYLINNAGAPCSAPAIDLDIEDVSKVMDVNFYGVIRMNKAFQHQLIRAK-GT
MKAR_VANPO      ----------------PITALINNVGQSHSVPFLETDEDEMRRIITINNTATLMITQIIAPMIIXXXXGL
DR9C7_BOVIN     TESIKAATQWVRDQVGEQGLLVNNAGVGLSGPNEWLTKEDFVKVINVNLVGLIEVTLHMLP-MVKKARGR
NAHB_PSEPU      HATNEKLIKQTIDRFGHLDCFIANAGLSIEEPWEKISSS-FDEIFDINVKSYFSGISAALPELKKTN-GS
HSDL2_HUMAN     EQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKVAH
NAHB_PSEU8      HATNEKLIKQTIDRFGHLDCFIANAGLSIEEPWEKISSS-FDEIFDINVKSYFSGISAALPELKKTN-GS
MKAR_KLULA      ----------------PVTVLINNVGKSHSVPFDQTEESELRDIITINNTATLMITQTLLPQLKASCRGL
MKAR_ASPOR      -----------------VAILVNNVGKSHDTPFALTSQEEMTDIITINCMGTLRATQLIVPGMMQRKRGL
DHRS9_RAT       --------------------LINNAGVGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKAR-GR
YUSR_BACSU      ------------------------------------------------MKGMFFCARAVVPFMKKSKDGA
YQC8_SCHPO      SDTVEAGVEEIQKIFKEIHVVVANAGMPFRRSVLDSPPHEFEKVMNINTNSVYRVAYYMGKIFKKQGFGN
RDH8_BOVIN      -------------------------------------LAAMQNVFDTNFFGAVRLVKAVLPSMKRRRQGH
MKAR_ASPCL      -----------------VSILINNVGKSHDVPFALTPEDEMTDIVTINCLGTLRATQLVIPGMMQRRRGL
HSDL2_PONAB     EQQINAAVEKAIKQFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKVAH
DR9C7_HUMAN     SESIKAAAQWVRDKVGEQGLLVNNAG--VGLPSGPNEWLTFVKVINVNLVGLIEVTLHMLP-MVKRARGR
3BHD_COMTE      ADWTL-VMAAVQRRLGTLNVLVNNAGILLPGDMETGRLEDFSRLLKINTESVFIGCQQGIAAMKETG-GS
Y1570_MYCBO     MDAIAVMADQVLGDLGGVDILINNAGRSISLELSYDRIHDYQRTMQLNYLGAVQLILKFIPGMRERHFGH
Y1543_MYCTU     MDAIAVMADQVLGDLGGVDILINNAGRSISLELSYDRIHDYQRTMQLNYLGAVQLILKFIPGMRERHFGH
DHI1_RAT        MAFAERFVVEAGKLLGGLDMLILNHITQTTMSLFHDDIHSVRRSMEVNFLSYVVLSTAALP-MLKQSNGS
OXIR_STRAT      LSDPASVESFARAWRGPLDILVANAG-IMALPTRTLAPNGWEMQLATNYLGHFALATGLHAALRDAGSAR
MKAR_EMENI      -----------------VAILINNVGKSHSVPFALTPEDELADIITINCMGTLRVTQLVVPGMTQRKRGL
ACR1_ACIBI      MNAIDQLSQQIMASVDHVDFLINNAGRSIRRAVHESFDRFFERTMQLNYFGAVRLVLNLLPHMIKRKNGQ
ACR1_ACIAD      MNAIDQLSQQIMASVDHVDFLINNAGRSIRRAVHESFDRFFERTMQLNYFGAVRLVLNLLPHMIKRKNGQ
MKAR_NEOFI      -----------------VAVLINNVGKSHDTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQRKRGL
MKAR_ASPFU      -----------------VAVLINNVGKSHDTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQRKRGL
MKAR_ASPFC      -----------------VAVLINNVGKSHDTPFALTPEDEMTDIVTINCLGTLRTTQLIIPGMMQRKRGL
LIGD_PSEPA      ADEVEAVFGQAP------TLLSNTAGVNSFGPIEKTTYDDFDWIIGVNLNGVINGMVTFVPRMIASGRGH
RDH1_BOVIN      PQSIRQAVKWVETHVGEAGLLVNNAGVAIIGPTPWQTREDFQRVLNVNTLGPIGVTXXXXXXXXQAR-GR
AYR1_YEAST      -------FLRANLPDGKLDLLYNNAGQSCTFPLDATDAAV-EQCFKVNVFGHIMCRE--LSEFLIKAKGT
HSDL1_RAT       -----------------IGILVNDVGAFYPYPFSQVEDTIWD-IVNVNIAAASLMVHIVLPGMVERKKGA
HSDL1_MOUSE     GREIYAPIREALRDRD-IGILVNDVGAFYPYPFSQVEDTLWD-IVNVNIAAASLMVHIVLPGMVERKKGA
DHB2_HUMAN      PVQIKDAYAAMLQDRG-LWAVINNAGVLGFPTDGELLLMTYKQCMAVNFFGTVEVTKTFLP-LLRKSKGR
RDH12_HUMAN     TKSIRAFAEGFLAEEKQLHILINNAG-VMMCPYSKTADG-FETHLGVNHXXXXXXXXXXXERLKVSAPAR
MKAR_SCLS1      -----------------VGILVNNVGQSHSVPFIQTPKEEMRDIITINCIGTLRVTQIVAPGMVQRKRGL
MKAR_BOTFB      -----------------VGILVNNVGQSHSVPFIQTPKEEMRDIITINCMGTLRVTQIVAPGMVQRKRGL
YIV6_YEAST      RSRMEALVEEIRQKHGKLDGIVANAGKSISQSNSEHDIKQWERLFDVNFFSIVSLVALCLPLLKSSPFGN
YD114_YEAST     LDEIKNLKKAIERDHGXXXXXXXXAGVAHIKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDMIDNREGF
STDH3_CAEEL     -----------------IGMLINNVGMLFEYPVGGIDVVANVTIL--NTLPVTLLSAGILPQMVSRKTGI
RDH13_MOUSE     -----------------VDILVNNAA-VMRCPHWTTEDG-FEMQFGVNYLGHFXXXXXXXXXXKASAPSR
RDH12_BOVIN     TKSIRAFAEGFLAEEKQLHILINNAG-VMLCPYSKTADG-FETHLAVNXXXXXXXXXXXXXXXKESAPAR
FABI_HAEIN      ----------------------------------------------------------------------
BZRD_BACCE      --------------------LINNAGTAPMKPIEKAESEQFITNVHINLLAPMILTSTFMKHTKE--WKR
ADH_SCAAL       -----------------VDLLVNGAGIL--------DDHQIERTIAVNFTGTVNTTTAIMEFWDKRKGGP
ADH_DROCR       -----------------IDLLINGAGIL--------DDHQIERTIAVNFTGTVNTTTAIMEFWRKGGPGG
YIV5_YEAST      DSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQVNEIDVNAWKKLYDINFFSIVSLVGIALPELKKTN-GN
HCAB_ECO5E      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-AGEGS
HCAB_ECO57      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-AGEGS
ADH_DROSL       -----------------VDLLINGAGIL--------DDTQIERTIAVNFTGTVNTTTAIMDFWDKRNGGP
DHRS1_HUMAN     ------------EQQGRLDVLVNNAYAGVQTAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGL
ADH_DROMM       -----------------VDLLINGAGIL--------DDHQIERTIAVNFTGTVNTTTAIMDFWDKRNGGP
ADH_DROHE       -----------------VDLLINGAGIL--------DDTQIERTIAVNFTGTVNTTTAIMDFWRKGGPGG
RDH11_HUMAN     TKSIRAFAKGFLAEEKHLHVLINNAG-VMMCPYSKTADG-FEMHIGVNXXXXXXXXXXXXXXXKESAPSR
ADH2_DROBU      -----------------VDLLINGAGIL--------DDYQIERTIAVNFTGTVNTTTAIM-----AFWGV
OXIR_STRLI      --------------RGPLDILVANAG-IMALPTRTLTPYGWEMQLATNYLGHFALATGLHAALRDAGSAR
H17B6_RAT       TDSISAATQWVKEHVGDKGLLVNNAGVFQAFAYIE-----WCRIFQVNLIGLAQVTLSML-FLVKKARGR
ADH_ZAPTU       -----------------IDLLINGAGIL--------DDHQIERTIAVNFTGLVNTTTAILQFWDKRKGGP
ADH2_DROMU      -----------------VDLLINGAGIL--------DDYQIERTIAVNFTGTVNTTTAIMSFWRKGGPGG
LE767_CAEEL     AAPSAYKDLLATLNQVEIGVLINNVGMSYEYPLHKVDGGIERLAXXXXXXXXXXXXXSALPQMVARKAGV
HCAB_ECO7I      ----------------------------------------FHELFNVNVLGYLLSAKACAPALI-ASEGS
BZRD_BACSU      --------------------LINNAGMVTPIKAGEASLDELQRHYQLNLTAPVLLSQLFTKRFASSGKKT
ADH_DROMY       -----------------VDLLINGAGIL--------DDYQIERTIAVNFTGTVNTTTAIMSFWDKRKGGP
ADH_DROLE       -----------------------------------------ERTIAINFTGLVNTTTAILDFWRKGGPGG
ADH_DROLA       -----------------VDLLINGAGIL--------DDHQIERTIAVNFTGTVNTTTAIMEFWRKGGPGG
ADH_DROBO       -----------------VDLLINGAGIL--------DDHQIERTIAVNFTGTVNTTTAIMEFWRKGGPGG
ADH2_DROAR      -----------------VDLLINGAGIL--------DDYQIERTIAVNFTGTVNTTTAIMSFWDKRKGGP
ADH1_DRONA      -----------------VDLLINGAGIL--------DDYQIERTIAVNFTGTVNTTTAIMSFWDKRKGGP
ADH1_DROMN      -----------------VDLLINGAGIL--------DDHQIERTIAVNFTGTVNTTTAIMEFWRKGGPGG
MKAR_PYRTR      -----------------VSILINNVGLSHSVPFTETPKQEMTDIIMINCMATLRVTQLVTPGMVSRKRGL
DHB3_HUMAN      DDHIKEKLAGLE-----IGILVNNVGMLPNSHFLNAPDEI-QSLIHCNITSVVKMTQLILKHMESRQKGL
ADH_DROVI       -----------------VDLLINGAGIL--------DDHQIERTIAVNFTGTVNTTTAIMEFWDKRKGGP
ADH_DROFL       -----------------VDLLINGAGIL--------DDHQIERTIAVNFTGTVNTTTAIMEFWDKRKGGP
ADH2_DROMN      -----------------VDLLINGAGIL--------DDHQIERTIAVNFTGTVNTTTAIMEFWDKRKGGP
ADH1_DROMT      -----------------VDLLINGAGIL--------DDYQIERTIAVNFAGTVNTTTAIM-----AFWGV
STDH4_CAEEL     -----------------IGILINNVGMCFDNPEVEGGIDTLTNVINVNILPL---TAGILPQMMARKSGI
MKAR_PHANO      -----------------VSILINNVGLSHSVPFAETPKQEMTDIIMINCMATLRVTQLLTPGMISRKRGL
MKAR_MALGO      -----------------IAVLVNNVGLSHTMPFLEMDGRELASICQVNIVATMQVTRVVAPHLVRRGRGL
MKAR_ASHGO      ----------------PVTVLVNNVGVSHSIPFLETTEEELRGIITVNNTATLMVTQTVAPLVIANARGL
HCAB_SHISS      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_SHIBS      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_ECOSM      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_ECOSE      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_ECOLU      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_ECOLI      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_ECOLC      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_ECOHS      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_ECODH      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_ECOBW      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_ECO8A      ----------------------------------------FHELFNVNVLGYLLGAKACAPALISSEGSM
HCAB_ECO55      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_ECO24      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
ADH_DROWI       -----------------------------------------ERTIAVNFTGLVNTTTAILDFWRKGGPGG
ADH_DROPU       -----------------------------------------ERTIAVNFTGLVNTTTAILDFWRKGGPGG
ADH_DROIN       -----------------------------------------ERTIAVNFTGLVNTTTAILDFWRKGGPGG
ADH_DROEQ       -----------------------------------------ERTIAVNFTGLVNTTTAILDFWRKGGPGG
ADH2_DROMO      -----------------VDLLINGAGIL--------DDHQIERTIAVNFTGT-VNTITAIMSFWDGPGGV
ADH1_DROMU      -----------------VDLLINGAGIL--------DDYQIERTIAVNFTGTVNTTTAIMSFWDKRKGGP
RDH13_HUMAN     ---------------------------------------------------------------------R
MKAR_CRYNE      -----------------VGILINNVGASHSMPFHETERSEMSRIIETNVTWTYLVTRSILPSMVAAPKSL
ADH_DROGR       -----------------VDLLINGAGIL--------DDNQIERTIAVNFTGTVNTTTAILDFWRKGGPGG
ADH2_DROWH      -----------------------------------------ERTIAVNFTGTVNTTTAIMSFWRKGGPGG
ADH2_DROHY      -----------------VDLLINGAGIL--------DDYQIERTIAVNFAGTVNTTTAIM-----AFWGV
ADH1_DROHY      -----------------VDLLINGAGIL--------DDYQIERTIAVNFAGTVNTTTAIM-----AFWGV
HSDL2_DANRE     EKQINDAVEQAVEKFGGIDILVNNASATLQTPMKKADL-----MLGINLRGTYLTSKLCIPHLLKSXXXX
HSDL1_DANRE     -----------------------------------------------NIAATTLVTRLALPAMMEKGRGA
H17B6_MOUSE     TESIVAATQWVKERVGDRGLLVNNAGVLQ--PFAYIE---WYRIFQVNLIGLTQVTISML-FLVKKARGR
ADH_DROPL       -----------------VDLLINGAGIL--------DDNQIERTIAVNFTGTVNTTTAIMDFWDKRKGGP
ADH_DRONI       -----------------VDLLINGAGIL--------DDHQIERTIAVNFTGTVNTTTAIMDFWRKGGPGG
ADH_DRODI       -----------------VDLLINGAGIL--------DDNQIERTIAVNFTGTVNTTTAIMDFWDKRKGGP
HSDL2_XENLA     ENQISAAVEKAVDAFGGIDILVNNASAISLTNTLETSMKKVDLMMGINTRGTYLTSKICIPYLKKSKVAH
DHB3_MOUSE      -----------------------------------------QNLIHCNITSVVKMTQLVLKHMESRRKGL
ADH_DROPS       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROPB       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROMD       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROGU       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROAM       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROAF       -----------------VDLLINGAGIL--------DDNQIERTIAVNFTGTVNTTTAIMDFWRKGGPGG
ADH1_DROMO      -----------------VDLLINGAGIL--------DDHQIERTIAVNFTGT-VNTITAIMSFWDGPGGV
YXNA_BACSU      EEDVNRIAETAISTFGRFDTWVNNAAVSTFGHAMDVTVEDMKRMFDTNFWGPVYGTRAAVKHYTGRGVGA
HCAB_SHIFL      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
HCAB_SHIF8      ----------------------------------------FHELFNVNVLGYLLGAKACAPALI-ASEGS
DHB3_RAT        -----------------IGVLVNNVGMLFLSTSGES-----QSVIHCNITSVVKMTQLVLKHMESRRRGL
ADH_DROPE       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
STDH2_CAEEL     -----------------VGILINNVGMFFDYPEGIDSIA---NVIIINTLPATLLSAGILPQMVSRKAGI
SPRE_XENTR      SEGVSAAVRAAGELQAQKLLIINNAGSIFSDPKEVTDYMMFNVSSPLCLTASLLKTFPRRPDLQRV----
DHI2_HUMAN      --------------------LVNNAGHEVVADAELSPVATFRSCMEVNFFGALELTKXXXXXXXXXXXX-
ADH_DROYA       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROTS       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROTE       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROSI       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROSE       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROOR       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROME       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROMA       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROER       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
ADH_DROAN       -----------------------------------------ERTIAVNYTGLVNTTTAILDFWRKGGPGG
YKH1_YEAST      ----------------------------------ETPKSVWLNHYSTNALGPILALQKVYPLLLLKKTRK
MNR1_CAPAN      -------------------------GWTKSGPGSVTNYELTKECIETNYYGAKRMTEAFIPLLQLSNSPR
ADH_DROPI       -----------------VDLLINGAGIL--------DDHQIERTIAVNFAGTVNTTTAILDFWRKGGPGG
STDH1_CAEEL     -----------------IGILINNVGMFFDYPEGIDSIA---NVTIINTLPATLLSAGILPQMVPRKAGI
MKAR_ASPNC      -------------------------GKSHSTPFALTPEDEMTDIVTINCLGTLRATQLVVPGMMQRKRGL
HSDL2_XENTR     ENQISAAVEKAVDTFGGIDILVNNASNTLETPMKKVDL-----MMGINTRGTYLTSKICIPYLKKSKVAH
FABI_BACSU      DAEIETCFASIKEQVGVIH------GIAHCIAFANKE-ELVGEYLNTNRDGFLLAVKAARPMMTEGG--S
ADH_DROSU       -----------------------------------------ERTIAVNYSGLVNTTTAILDFWRKGGPGG
MKAR_COCIM      ----------------------NNVGLSHSVPFVQTPEKEMKDIIAINCLGTLRVTQLVAPGMMQRKRGL
ADH_DROAD       -----------------VDLLINGAGIL--------DDNQIERTIAVNFTGTVNTTTAIMDFWRKGGPGG
YDFG_DICNO      ADALNAAFERLPEDWRAIDVLVNNAGLALQAPAHESRLADWEQMIATN----------------------
YCP9_SCHPO      QQSANEAAQSVAKAVDGIDVLWLNSGQSYYTVMEAPE-EVWNAHYQTNVLGPIHVFKAFYPLLTKKKTRQ
FABI_PSEAE      ----------------------------------------------------------------------
TSC10_CRYNE     PIASTNAIHAACKPHADQAPDYVYLCAGFSRP--KLFVETTKQELKDGLDGVYWVSEACQMMSKQRRTGK
RDH12_MOUSE     -------------------ILINNAG-VMMCPYSKTTDG-FETHFGVNHXXXXXXXXXXXXXXKESAPAR
RDH11_MOUSE     -------------------LLINNAG-VMMCPYSKTADG-FEMHIGVNXXXXXXXXXXXXXXXKESAPSR
MKAR_YARLI      -----------------VSILINNVGLSHSTPFLETPPAELHNIIAINNLATLKITQLIAPKIVESQKGL
MKAR_CANGA      ----------------PISILVNNVGQSHSVPFLATEEEEMRNIITINNTATLMXXRESGDKKLKSQRGL
FABI_AQUAE      --------------------------------------------MDISVYSLIALTRELLPLM-EGRNGA
DECR2_ARATH     QEDARRVVEATFQHFGKLDILVNXXXXXXXXXXEDLSPNGFRTVLDIDAVGTFNMCHAALKYLKKGAPGR
ADH_DROIM       -----------------VDLLINGAGILNDHQIELT--------IAINFTGLVNTTTAIMDFWDKGPGGA
YJNK_SCHPO      -------------------LWVNSGISKSFQPVLKTSDELWMSHYQTNVLGPIHVYQAFYHLLKEGKLKN
YBPE_SCHPO      DKDVEGCVHSLKKMNRTPFALINAAAIAPKNHLLSISRQELQKCFETNVIGQLAITSALFPLLLQDPNPH
MKAR_COPC7      -------------------------------------------IVEINVNATLRVTYAILPGMVKNKRGL
ADH_DROHA       -----------------VDLLINGAGIL--------DDNQIERTIAVNFTGLVNTTTAILDFWDKRKGGP
SPRE_HUMAN      -------------------LLINNAGSLGDVSKGFVDLSDSTQVNNLNLTSMLCLTSSVLKAFPDSGLNR
FABI_SHIFL      ----------------------------------------------------------------------
FABI_SALTY      ----------------------------------------------------------------------
FABI_NEIMB      ----------------------------------------------------------SLPALAKAA--R
FABI_ECOLI      ----------------------------------------------------------------------
FABI_ECO57      ----------------------------------------------------------------------
LE767_CAEBR     -----------------IGVLVNNVGLSYEYPLHKVDGGIERLAXXXXXXXXXXXXXSALPQMVARKAGV
DHS5_CAEEL      ------------------------------------------QILRVNGMGAAEFLSCVLPPMEKSGGGQ
YCP8_SCHPO      LESANEAAQEVTKVVDAVDVLWVNSAVFHSGPVVNTPDDVWNSHYKTNVLGPIHVYQAFYPLIKKGRSKI
YCP6_SCHPO      LESANEAAQEVAKAVGKVDVLWVNSGHSFNTVLNTPD-DVWNSHYKTNVLGPIHVYQAFYPLVKKGESKI
MKAR_LACBS      -------------------------------------------IVSINVQATLQVTHSVLPGMVQRKRGL
FABI1_RHIME     LATIDAVFSALEEKWGKIDFVVHAIADELTGRYLDTSRDNFARTMDISVY-SFTAVAARADRVMNDG-GS
SPRE_XENLA      TEGVSATVRAARELQAGTALIINNAGSIFSAPEEVTEYMKFNVSSPLCLTASLLKTFPRRPDLQRL----
LEU1_RALEJ      ------AITGGTEAQGEVTVRLSKAGR-------------------------------------------
FABI_BRANA      ----------------------------------------------------------------------
MKAR_YEAST      -------------AQLPITVLVNNVGQSHSVPFLETEEKELRXXXXXXXXXXXXXXXXXXPKIVETTRGL


                         +         .         .         .         .         *         .:210
query           IVNVASTAGLIGYGYVSAYCAAKHGVIGLTRSLALELATKGVTVNAVCPGYTETDIVRDAVANIVGKTGR
ACT3_STRCO      IVNIASTGGKQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVETPMAASVREHYSDIWEV
HCDS_XANP2      IVNFGSVAGLVGIPTMAAYCAAKGAVVNLTRQMAADYSGRGIRVNVVCPG---TVAGTDMGRQLLGTDCD
NODG_AZOBR      IINISSVNGVKGQAGQTNYSAAKAGVIGFTKALAAELATKGVTVNAIAPGYIGTDMVM-----------A
BDHA_RHIME      IINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTPLVEKQIPDQARTRGI
YXJF_BACSU      IINIASVNGLVGFAGKSAYNSAKHGVIGLTKVGALEGAPHGITVNALCPGYVDTQLVRNQLSDL-SKTRN
BDHA_RALEH      IINVASTHGLVASAQKSAYVAAKHGIVGFTKVTALETAQTGVTANAICPGWVLTPLVQKQVEARAQKEGI
BACC2_BACSU     IINTCSVGGVVAWPDIPAYNASKGGVLQLTRSMAVDYAKHNIRVNCVCPGIIDTPLNE---KSFLENNEG
BACC_BACSU      IINTCSVGGLVAWPDIPAYNASKGGVLQLTKSMAVDYAKHQIRVNCVCPGIIDTPLNE---KSFLENNEG
FABG_AQUAE      IVNISSVVGFTGNVGQVNYSTTKAGLIGFTKSLAKELAPRNVLVNAVAPGFIETDM-----------TAV
DHKR_STRCM      IINVASTAGKQGVVLGAPYSASKHGVVGFTKALGNELAPTGITVNAVCPGYVETPMAQRVRQGYAAAYDT
DHK1_STRVN      IINIASTGGKQGVVHAVPYSASKHGVVGLTKALGLELARTGITVNAVCPGFVETPMAERVREHYAGIWQV
FABG1_SYNY3     IINITSVAGMMGNPGQANYSAAKAGVIGFTKTVAKELASRGVTVNAVAPGFIATDMTENLNAE-------
FABG_MYCS2      IIFIGSVSGMWGIGNQANYAAAKAGLIGMARSISRELAKAGVTANVVAPGYIDTEMTR-----------A
PHBB_CHRVI      IINISSVNGQRGQFGQANYSAAKAGMHGFTMALAQEGASKGVTVNTISPGYVET-----------AMTLA
FABG_MYCTU      MIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTR-----------A
FABG_MYCBO      MIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANVVAPGYIDTDMTR-----------A
FABG_MYCAV      IIYIGSVSGMWGIGNQANYAAAKAGLIGMARSISRELSKAGVTANVVAPGYIDTEMTR-----------A
PHBB_RALEH      IVNISSVNGQKGQFGQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAIRQDVLDK---
FABG_STAAW      IINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM-----------TDA
FABG_STAAS      IINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM-----------TDA
FABG_STAAR      IINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM-----------TDA
FABG_STAAN      IINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM-----------TDA
FABG_STAAM      IINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM-----------TDA
FABG_STAAC      IINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDM-----------TDA
PHBB_RHIME      IVNISSINGQKGQMGQVNYSAAKAGDLGLTKALAQEGAAKGITVNAICPGYIGTEMVRAVPEKVLNE---
FABG_VIBHA      IINVGSVVGTMGNAGQTNYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDM-----------TKA
FABG_CUPLA      IINIASVVGLVGNAGQANYSAAKAGVIGFTKTVAREYASRNINVNAVAPGFISSDM-----------TSK
BUDC_KLEPN      IINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGK
LVR_LEIAQ       VVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENPR
PHBB_ZOORA      IVNISSINGQKGQMGQANYSAAKAGDLGFTKALAQEGAAKGITVNAICPGYIGTEMVRAIPEKVLNE---
FABG_SHIFL      IITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR----------AL
FABG_ECOLI      IITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTR----------AL
NODG_RHIS3      IINITSVVGVTGNPGQTNYCASKAGMIGFSKSLAQEIATRNITVNCVAPGFIES-----------AMTDK
FABG_BACSU      IINVSSIVGVSGNPGQANYVAAKAGVIGLTKSSAKELASRNITVNAIAPGFISTDM-----------TDK
FABG_PSEAE      IINIGSVVGAMGNAGQTNYAAAKAGLEGFTRALAREVGSRAITVNAVAPGFIDTDMTREL----------
HCDR_XANP2      IVNIASVASLVAFPGRSAYTTSKGAVLQLTKSVAVDYAGSGIRCNAVCPGMIETPMTQWRL---------
FABG_VIBCH      IINVGSVVGTMXXXXXXXXXXXXXXVIGFTKSMAREVASRGVTVNTVAPGFIETDMTK----------AL
UCPA_SALTY      IVMMSSVTGMVADPGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGY-----VRTPMAESIARQSN
UCPA_SALTI      IVMMSSVTGMVADPGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGY-----VRTPMAESIARQSN
BACC_BACAM      IINTCSVGGVVAWPDIPAYNASKGGVLQTDAFYRPSIIAKNIRVNCVCPGIIDTPLNE---KSFLENNEG
FABG_STAES      IINLTSIVGAMGNPGQANYVATKAGVIGLTKTAARELASRGITVNAVAPGFIVSDM-----------TNA
FABG_STAEQ      IINLTSIVGAMGNPGQANYVATKAGVIGLTKTAARELASRGITVNAVAPGFIVSDM-----------TNA
UCPA_ECOLI      IVMMSSVTGMVADPGETAYALTKAAIVGLTKSLAVEYAQSGIRVNAICPGY-----VRTPMAESIARQSN
PHAB_PARDE      IVNISSINGQKGQAGQANYSAAKAGDLGFTKALAQEGARAGITVNAICPGYIGTEMVR----------AI
FABG_RICPR      IINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDM-----------TDK
NODG_RHIME      IINVTSVAGAIGNPGQTNYCASKAGMIGFSKSLAQEIATRNITVNCVAPGFIES-----------AMTDK
UCPA_ECO57      IVMMSSVTGMVADPGETAYALTKAAIVGLTKSLAVEYAQSGIRVNAICPGY-----VRTPMAESIARQSN
FABG_RICTY      IINISSIVGIAGNPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDM-----------TDK
FABG_RICBR      IINITSIVGVSGNPGQANYCASKAGLIGMTKSLAYEVATRGITVNAVAPGFIKSDM-----------TDK
PHAB_ACISR      IVNISSVNGLKGQFGQANYSASKAGIIGFTKALAQEGARSNICVNVVAPGYTATPMV----------TAM
YOHF_ECOLI      IINITSVHEHTPLPDASAYTAAKHALGGLTKAMALELVRHKILVNAVAPGAIATPM-----------NGM
DHRS4_RABIT     VVIVASIAAFNPFSGLGPYNVSKTALVGLTKNLALELAAQNIRVNCLAPG-----LIKTSFSKALWEDKA
FABG_BUCAP      IVTIGSVIGYLGNRGQINYSASKSGLIGFHKSLALEVAQKGITVNIVSPGFIKTNLTKN--LNVF-----
FABG_HAEIN      IINIGSVVGSTGNPGQTNYCAAKAGVVGFSKSLAKEVAARGITVNVVAPGFIATDM-----------TEV
GNO_GLUOX       IVNICSVQSELARPGIAPYTATKGAVKNLTKGMATDWGRHGLQINGLAPGYFATEMTERLVA--------
KDUD_BACSU      IINIASLLSFQGGILVPAYTASKHAVAGLTKSFANEWAASGIQVNAIAPGYIST-------ANT--KPIR
FABG2_BRANA     XXXXASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM-----------TAK
LINC_PSEPA      IVNTASAAGVVGVPMHGEYVGAKHAVVGLTRVAAADYGKHGIRVNALVPGAVRTPMLQRAMDNDAG----
FABG3_BRANA     XXXXASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM-----------TAK
FABG1_BRANA     XXXXASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM-----------TAK
Y4VI_RHISN      IVNVASLAGLLGNPKRSAYAASKAGLISITKSLACRWASRGIRVTAVAPGHVRTPMVAE-----LERAGK
PECR_HUMAN      IVNII-VPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGYSQT-----AVEN-YGSWGQ
HSD_STREX       IVNISSAAGLMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTP--------MTAETGI
PECR_RAT        IVNIIV---LLNNGFPTASGAARAGVYNLTKTMALTWASSGVRINCVAPGYSQT-----AVDN-YGELG-
HSD_MYCTU       IINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMT-DWVPEDIFQTAL
HSD_MYCBO       IINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMT-DWVPEDIFQTAL
FABG_SALTY      IITIGSVVGTMXXXXXXXXXXXXXXLIGFSKSLAREVASRGITVNVVAPGFIETDMTR----------AL
FABG_SALTI      IITIGSVVGTMXXXXXXXXXXXXXXLIGFSKSLAREVASRGITVNVVAPGFIETDMTR----------AL
LIMC_RHOER      IVLTSSAAGLKGYAQISHYSAAKHGVVGLMRSLALELAPHRVRVNSLHPTQVNTPMIQEGTYRIFSPDLE
PECR_MOUSE      IVNIIV---LLNNGFPTATGAAREGVYNLTKSMALAWASSGVRINCVAPGYSQT-----AVDN-YGEMG-
BAIA1_EUBSP     IINTASVTGIYGSLSGIGYPTSKAGVIGLTHGLGREIIRKNIRVVGVAPGVVDTDMTKGLPPEIL-----
Y1385_MYCBO     IVNMSSVSGKVGMVGQTNYSAAKAGIVGMTKAAAKELAHLGIRVNAIAPG-----LIRSAMTEAMPQ--R
Y1350_MYCTU     IVNMSSVSGKVGMVGQTNYSAAKAGIVGMTKAAAKELAHLGIRVNAIAPG-----LIRSAMTEAMPQ--R
DHSO_RHOSH      IINMASQAGRRGEALVGVYCATKAAVISLTQSAGLNLIRHGINVNAIAPGVVDGEHWDGVDAKFADYENL
BAIA2_EUBSP     IINTASVTGIFGSLSGVGYPASKASVIGLTHGLGREIIRKNIRVVGVAPGVVNTDMT----------NGN
YXBG_BACSU      IINTSSMSGRAADLDRSGYNAAKGGITNLTKAMAIDYARNGIRVNSISPGTIETPLI-DKLAGT--KEQE
FIXR_BRAJA      IVNVTSIAGSRVHPFASAYATSKAALASLTRELAHDYAPHGIRVNAIAPGEIRTDML-------------
FABG4_BRANA     XXXXASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM-----------TAK
IDNO_ECOLI      VINICSMQSELGRDTITPYAASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTEMTKALV---------
IDNO_ECOL6      VINICSMQSELGRDTITPYAASKGAVKMLTRGMCVELARHNIQVNGIAPGYFKTEMTKALV---------
FABG_THEMA      XXXXXXXXXXXXXPGQTNYAASKAGVIGMTKTWAKELAGRNIRVNAVAPGFIETPM-----------TEK
FABG_ARATH      XXXXSSVVGLIGNIGQANYAAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDM-----------TAE
BUTA_STAAW      IINATSQAGVEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAGK
BUTA_STAAS      IINATSQAGVEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAGK
BUTA_STAAR      IINATSQAGVEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAGK
BUTA_STAAN      IINATSQAGVEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAGK
BUTA_STAAM      IINATSQAGVEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAGK
BUTA_STAAC      IINATSQAGVEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAGK
PECR_PONAB      IVNIIVSIKT-GLPLAVHSGAARAGVYNLTKSLALEWACSGVRINCVAPGYSQT-----AVENY-GSYGQ
FABG_CHLMU      IVNISSIVGLRGSPGQTNYAAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDMTKGLSDNL------
DHB8_HUMAN      IINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDK---
DHB8_CANFA      IINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFITTPMTQKVPQKVLDK---
PECR_CAVPO      IVNIIIL--LNGQPFVAHSGAARGGVYNLTKSLALGWARSGIRINCVAPGTVYSQTAMDNYGDM-GKT--
HDHA_ECOLI      ILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVIT--------
HDHA_ECO57      ILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVIT--------
FABG_CHLTR      IINISSIVGLRGSPGQTNYAAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDMTKSLNDNL------
YGFF_ECOLI      IVNVSSVASRLGSGEYVDYAASKGAIDTLTTGLSLEVAAQGIRVNCVRPGFIYTEMHASG-----GEPGR
FABG5_BRANA     XXXXASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASDM-----------TAK
CMTB_PSEPU      IINIGADSVRNGLPDHAAYNAAKGGMHGLTTGLAREFARQGVTVNTVAPCAVNTEVVRIKNAN-------
CMTB_PSEP1      IINIGADSVRNGLPDHAAYNAAKGGMHGLTTGLAREFARQGVTVNTVAPCAVNTEVVRIKNAN-------
FABG_RICFE      XXXXXXXXXXXXXPGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDM-----------TDK
DHRS4_BOVIN     XXXXXXXAAYSPFPSLGPYNVSKTALLGLTKNLALELAESNVRVNCLAPG-----LIRTSFSRVLWEDPA
FABG_BUCBP      IITIGSVIAHIGNCGQTNYSAAKLGLVGFHKSLALELAPKGITVNMIAPGLIKT-----------GMTNN
FABG_BUCAI      IITIGSVIAYTGNKGQVNYSASKSGLIGFHKSLALEVASKGITVNIVSPGLIKT--------NFTEKLNS
DHG_BACSU       VINMSSVHEVIPWPLFVHYAASKGGIKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFA--------
DHG2_BACME      VINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAIDTPINAEKFA--------
FABG_RICCN      XXXXXXXXXXXXXPGQANYCASKAGLIGMTKSLSYEVATRGITVNTVAPGFIKSDM-----------TDK
YVAG_BACSU      VIFIASEAAIMPSQEMAHYSATKTMQLSISRSLA-ELATTNVTVNTVMPGSTLTEGVETMLNSLYPGENL
YMFI_BACSU      IVAVSSIWGETGASCEVLYSMAKGAQHSFVKGLAKELAPSGIRVNAVAPGAVDT--------NMMNQFTP
Y2146_BRAJA     IVNMSSCQGLSGDTALTSYAASKAAMNMLSSSLATQYGHAQIRCNAVAPGLIMTERL----------LAK
MOAE_KLEAE      VLFVASIASLAAGPQACGYVTAKHALIGLMRSVARDYGPQGVRANAICPGWVTTPMADEEMHPLMQAEGL
DHRS7_HUMAN     IVTVNSILGIISVPLSIGYCASKHALRGFFNGLRTELATPGIIVSNICPGPVQSNIVENSLAGEVTKTGN
Y4LA_RHISN      IVNMSSCQGLSGDTAQTSYAVSKAAMNMLSASLATQYGHAQIRCNAVAPGLIMTE-------RLLAKLDK
KDUD_ECOLI      IINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWAKHNINVNAIAPGYMATNNTQQL---------R
Y325_THEMA      IVNVSSEAGLIGIPRRCVYSVSKAALLGLTRSLAVDYVDYGIRVNAVCPGTTQSEGLMARV-----KASP
DCXR_BOVIN      IVNVSSQASQRGLTNHSVYCSTKGALDTLTKVMAVELGPHKIRVNAVNP---------TVVMTPMGQAAW
Y2403_STAAW     LINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT-------------
Y2370_STAAS     LINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT-------------
FABG_CHLPN      IINVASIVAKIGSAGQTNYAAAKAGIIAFTKSLAKEVAARNIRVNCLAPGFIETDM-----------TSV
Y2778_STAA8     LINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT-------------
Y2488_STAAC     LINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT-------------
Y2422_STAA3     LINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT-------------
YVRD_BACSU      ILNIASEAGVKPLPTMIPYSMTKTALISLSRGMAEMTKGTNVTVNSVLPGPTWTEGVASYMEGAAQAAGQ
YLX6_SCHPO      IVNIGSVNGHIYLG-SPAYSAAKAGLENLTKALAVRYGPLGIRVNVCAPGTIWSPAWDERF--------K
CBR2_PIG        IVNVSSMVSHVTYPGLAAYSSTKGAMTMLTKSMAMELGPHKIRVNSVNP---------TVVLTAMGRSVT
NOG4_RHIME      IINVTSVAGAIGNPGQTNYCASKAGMIGFSKSWR-RRSTRNITVNCVAPGFIES-----------AMTDK
FABG2_SYNY3     XXXXXXXXXERGNVGQTNYSATKAGVIGMMKSLAREGARYGVRANAVAPGFIDTEM-----------TLA
CBR4_DANRE      IVNIGSVVGVKGNAGQCVYSASKAGLEGFTRSLAKEVASRNIRVNLVAPGLIHTDMT----------AGL
Y2478_STAAM     LINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT-------------
Y2266_STAAN     LINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT-------------
SRLD_ECOLI      XXXXXSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHSLMLGLLKSPMFQSLLPQYATKLGI
YTKK_BACSU      IITYGGAAHAPGWLHRSAFGAAKVGLASLTKTIAIEEAEFGITANMVCPG----DIVGD-------MKEA
Y019_THEMA      IINIASTRAFQSEPDTEPYSASKGGLVALTHSLAVSLSRYHIRVVSISPGWIETSEWKK-------KSLR
Y2049_STAEQ     IINLASVSGFEPTKTNAVYGATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPM-----------TEG
Y2036_STAES     IINLASVSGFEPTKTNAVYGATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPM-----------TEG
CBR4_XENTR      IVNIGSIVGHKGNIGQSIYGASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIHTDMT----------LGL
DHGB_BACME      VINMSSVEWKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFA--------
DHB11_MACFA     VVTVASAAGHISVPFLLAYCSSKFSAVGFHKALTDELAATGVKTTCLCPNFVNTGFIKNPSTSLGPALEP
BUDC_KLETE      IVNACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGFCPGIVKT----------------
TRNH_DATST      IVFNSSAAGVIAVPLSSIYAASKGAINQVTKSLACEWAKDSIRVNAVAPWIINTPII-EAACQV-----P
DHRS4_MOUSE     XXXXXXXAGFTRFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPG-----LIKTRFSSVLW----
Y2567_STAAR     LINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTSISPGMVDTAIT-------------
CPNA_COMTE      IVNVSSIYGLVGAPGAAAYEASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQQIL--------D
CPNA_COMS9      IVNVSSIYGLVGAPGAAAYEASKGAVRLFTKACAVDLAPFNIRVNSVHPGVIATPMTQQIL--------D
DHRS7_MOUSE     IVTVNSIAGIASVSLSSGYCASKHALRGFFNALHSELGQPGITFCNVYPGPVQSDIVKNAFTEEVTKSMR
DHB11_RAT       VVTVASAAGHTVVPFLLAYCSSKFAAVGFHRALTDELAATGVRTSCLCPNFINTGFIKNPSTNL-GPTLE
BUTA_STAES      IINACSIAGHESYEVLGTYSATKHSVRSFTQTAAKELADKGITVNAYCPGVAKTE-MWDRIDEEMVKLDD
BUTA_STAEQ      IINACSIAGHESYEVLGTYSATKHSVRSFTQTAAKELADKGITVNAYCPGVAKTE-MWDRIDEEMVKLDD
YGCW_ECOLI      IINICSLFSYLGGQWSPAYSATKHALAGFTKAYCDELGQYNIQVNGIAPGYYATDIT---------LATR
XYLL_PSEPU      IVNVSSVATR-GIHRVP-YGAAKGGVNALTACLAFETAERGIRVNATAPGGTE---ARHGGFRNSAEPSE
DHB11_PONAB     IVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAATGVKTTCLCPNFVNTGFIKNPSTSL-GPTLE
YQJQ_BACSU      IINIASQAGKIATPKSSLYSATKHAVLGYSNALRMELSGTGIYVTTVNPGPIQTDFF-----SIADKGGD
YOXD_BACSU      IINISSTAGQRGAAVTSAYSASKFAVLGLTESLMQEVRKHNIRVSALTPSTVASDM--------------
CBR4_BOVIN      IVNVGSVVGLKGNSGQSVYSASKGGLVGFSRALAKEVAKKKIRVNVVAPGFIHTDMTKD-----------
YUSZ_BACSU      IINVSSISGLTGFPALSPYVSSKHALEGFSESLRIELLPFGIETALIEPGSYKTSIWSTSLSNFM-----
RHLG_PSEAE      VINIGSVAGISAMGQAYAYGPSKAALHQLSRMLAKELVGEHINVNVIAPGRFPSRMTRH-IAN-------
HETN_ANASP      IVNIASLAGKKGVAFNSVYSASKAGLIMWTDAMRQELVGTGVNISVVCPGY-------------------
DHB11_HUMAN     IVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAATGVKTTCLCPNFVNTGFIKNPSTSL-GPTLE
DER_CHICK       IVNVSSQASQRALRDHAVYCSTKSALDMLSKVMAMELGPHKIRVNTVNPTVVMTD---------MGRINW
FABG6_BRANA     XXXXASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVCPGFIASEM-----------TAK
DRS7B_DANRE     IVVISSVQGKISIPYRSAYAASKHAMQAYYDCLRAEVDSLGLHVSVLSPGYVRTNMSINAVTGDGSKYG-
DHB11_MOUSE     IVTVASAAGHTVVPFLLAYCSSKFAAVGFHRALTDELAATGVRTSCLCPNFINTGFIKNPSTNL-GPTLE
TRN1_DATST      VIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAI-----KKNP
PGDH_CAVPO      IINMSSLAGLMPVAQQPVYCASKHGIIGFTRSAAMKLMNSGVRMNAICPGFVNTSILQ------------
DHRS4_RAT       XXXXXXXXXFVLFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPG-----LIKTHFSSVLWK---
DHG3_BACME      VINMSSVHEMIPWPLFVHYAASKGGMKQMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPV-----
FADH_BACSU      ILNMAATYXXXXXXXXXXXXXXXXXXLSLTRTLAVEWGSKGIRTNAIAPGPIE-------------RTGG
DHGA_BACME      VINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFA--------
DHG4_BACME      VINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPV-----
FOX2_NEUCR      VLNTTSTSGIYGNFGQANYSAAKCAILGFSRAIALEGAKYNIYVNTIAPN----------AGTAMTKTIL
FOX2_CANTR      IINITSTSGIYGNFGQANYSSSKAGILGLSKTMAIEGAKNNIKVNIVAP---------------------
TRN2_DATST      VVFISSVSGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLVEMTIQD------P
PGDH_MACFA      IINMSSLAGLMPVAQQPVYCASKHGIVGFTRSLAANLMNSGVRLNAICPGFVNTAIL-------------
PGDH_HUMAN      IINMSSLAGLMPVAQQPVYCASKHGIVGFTRSLAANLMNSGVRLNAICPGFVNTAIL-------------
DRS7B_PONAB     IVAISSIQGKISIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAV---------
DCXR_CAEEL      IVNISSQAAIRPLDNHTVYCASKAALDMVTRCLANELGSQNIRVNSVNPTVVMTDMGRD---------NW
Y182_METEA      IINISSVVTDVLMPTSAVYSGTKGALNAISGVLANELAPRKIRVNVVSPGYVVTEGTHTA--------GI
Y0419_STAS1     IINIASISGFEVTKKSTLYSASKAAVHSITQGLEKELAKTGVRVTSISPGMVDTPLSGD-----------
PGDH_BOVIN      NINMSSLAGLMPVAQQPVYCASKHGIVGFTRSMAANLMNSGVRLNAICPGFVDTPILK------------
KDSR_HUMAN      IVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDT----------------
GRDH_ORYSJ      IINTSSINAYKGNKTLLDYTATKGAIVAFTRALALQLAEEGIRVNGVAPGPIWTPLIPASFA--------
DRS7B_BOVIN     VVAISSIQGKISLPFRSAYAASKHATQAFFDCLRAEVEQHDIEVTVISPGYIHTNLSLNAVTADGSKYGV
TRN2_HYONI      VVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSMVEMTIQD------P
SDR1_PICAB      XXXXXXXLVAMPIPRYGAYTASKAAVEMMTRILAQELRGTQITANCVAPGPVATDMF---------FAGK
DRS7B_MOUSE     IVAISSIQGKISIPFRSAYSASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNLSVNAV---------
CBR2_MOUSE      IVNVSSMVAHVTFPNLITYSSTKGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTD---------MGKKVS
PGDH_MOUSE      IINMSSLAGLMPVAQQPVYCASKHGIIGFTRSMAANLMKSGVRLNVICPGFVDTPIL-------------
DRS7B_HUMAN     IVAISSIQGKMSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAI---------
GRDH2_ARATH     IINTTSVVAYAGNSSLLEYTATKGAIVSFTRGLALQLAPKGIRVNGVAPGPVWTPLIPASFS--------
GRDH_DAUCA      IINTTSINAYKGNAKLLDYTATKGAIVAFTRGLSLQLISKGIRVNGVAPGPVWTPLIPSSF---------
DHG2_BACSU      VLNISSVHQQIPRPVNVQYSTSKGGIKMMTETLALNYADKGIRVNAIAPGTIATE------SNVDTK---
DHB13_HUMAN     IVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELGKTGIKTSCLCPVFVNTGFTKN-----------
DECR_HUMAN      FLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKT----KGAFSRLDPTGT
ARDH_CANAL      IILIGSMSGTIVNDPQPQYNMSKAGVIHLARSLACEWAKYNIRVNTLSPGYILTPLTRNVIS--------
SDH_RHIRD       VINLSSVAAHYPYLGGNVYGGTKAFLRQFSLGLRSDLHGKGVRVTSIEPGMCETEFT-------LVRTGG
KDSR_BOVIN      VVFVSSQAGQLGLFGYTAYSSSKFALRGLAEALQMEVKPYNVYVTVAYPPDTDT----------------
DRS7B_XENTR     IVVISSVQGKISIPFRSAYSASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKTNLSLNAV---------
KDUD_DICD3      IINIASMLSFQGGIPVPSYTASKKRVMGITRIVANEWAKHNINVNAIAPGYMATNNTQHV---------R
KDSR_MOUSE      IVFVSSQAGQLGLFGFTAYSSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDT-------------PGL
DHBA_BACSU      IVTVGSNAAGVPRTXXXXXXXXXXXXVMFTKCLGLELAEYNIRCNIVSPGSTETDMQWSLWADENG----
YUXG_BACSU      MVFVGSKNSVYAGKNASAYSSVKALETHLARCIAAEGGEFGIRVNSVLP-----DAVLQGSA-IWGSSWR
YKVO_BACSU      IIVTGSTAGSIGNPAFSVYGASKAALRALVRNWILDLKGTEIRVNVVSPGGILTELFGDALEEVL-----
ARDH_CANTR      IILIGSMSGTIVNDPQPQYNMSKAGVIHLARSLACEWAKYNIRVNTLSPGYILTPLTRNVIS--------
DRS7B_XENLA     VVVISSVQGKISIPFRSAYSASKHATQAFFDCLRAEMSPYDIDVTVVNPGYIKTNLSLNAV---------
DHB8_MOUSE      XXXXXXXXXXXXXXXXQTYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM-----------TQK
DHB1_MOUSE      VLVTASVGGLMGLPFHEVYCASKFALEGLCESLAILLPLFGVHVSLIECGAVHTAFYEKLVGGPGGALER
DHB8_RAT        XXXXXXXXXXXXXNIGQTYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPM-----------TQK
YJDA_BACSU      IINMTSGQDLGPLPGELAYAATKGAISAFTRSLSQELAPLGITVNAVNPGPTDSTWMTDEIRNF------
YHXC_BACSU      IINTASITAYKGNKTLIDYSATKGAIVTFTRSLSQSLVQQGIRVNAVAPGPIWTPLIPASFA------AK
RIDH_KLEAE      IIFTAVIAGVVPVIWEPVYTASKFAVQAFVHTTRRQVAQYGVRVGAVLPGPVVTALLDD-----------
GRDH1_ARATH     IINTTSVNAYKGNASLLDYTATKGAIVAFTRGLALQLAEKGIRVNGVAPGPIWTPLI----------PAS
CBR4_XENLA      XXXXXXXXXHKGNIGQSIYGASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIRTDMTSDLKEDSLNK---
SPS19_YEAST     ILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIRSNCIAPG---------AIDNTEGLKRL
LINX_PSEPA      XXXXXXXXXMFPTAGNASYCATKAAVRIMSKAAALEFVDRGVRVNTIVPGGMNTPITANVPPDVL-----
BEND_ACIAD      IVNVSSTRGI----HRIPYSASKGGVNALTASLAFEHAQHGIRVNAVATGGTKAPPRK--IPRNAQPLSK
ARDH_PICST      IILIGSMSGTIVNDPQPQYNMSKAGVIHLVRSLACEWAKYNIRVNTLSPGYILTPLTRNVI------SGH
DHB1_RAT        VLVTASVGGLMGLPFHEVYCASKFALEGLCESLAILLPLFGVHVSLIECGAVHTAFHEKLEGGPGGALER
BDH2_HUMAN      IINMSSVASSVGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERI-----QARG
SDH_AGRT5       VVNLSSVAAHYPYLGGNVYGGTKAFLRQFSLGLRSDLHGKGVRVTSIEPGMCETEFT-------LVRTGG
FABL_BACSU      IVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDAL---------KHFP
DCXR_RAT        IVNVSSQASQRALTNHTVYCSTKGALDMLTKVMALELGPHKIRVNAVNP---------TVVMTPMGRANW
DCXR_MESAU      IVNVSSQASQRALANHSVYCSTKGALDMLTKMMALELGPHKIRVNAVNP---------TVVMTSMGRTNW
BDH2_MOUSE      IINMSSVASSIGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERI-----QARD
BDH2_BOVIN      IINMSSVASSIGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERI-----QARP
UXUB_BACSU      IINLSSMSAYSPMTKVPAYSAAKASINNFTMWMAVHFAETGLRVNAIAPGFFLTKQNHDLLINQDGTTSR
S16C6_BOVIN     LVCISSFAGIVGINELSDYCASKFAAYGFAESLHFELQKSKINTTIVCPYFIKT----------------
FOX2_YEAST      IINTASPAGLFGNFGQANYSAAKMGLVGLAETLAKEGAKYNINVNSIAP---------------------
DHRS4_PIG       XXXXXXXXAYHPFPNLGPYNVSKTALLGLTKNLAVELAPRNIRVNCLAPGLIKTNF-----SQVLWMDKA
RDH10_RAT       IVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKADGIKTTLVCPYLVDTGMFR------------
RDH10_MOUSE     IVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKADGIKTTLVCPYLVDTGMFR------------
RDH10_HUMAN     IVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKADGIKTTLVCPYLVDTGMFR------------
RDH10_BOVIN     IVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKADGIKTTLVCPYLVDTGMFR------------
DRS7B_RAT       IVAISSIQGKISIPFRSAYAASKHATQAFFDCLRAEMKDSDIEVTVISPGYIHTNLSVNAV---------
TRNH1_ARATH     IIFMXXXXXXXXXXXXXXXXXTKGALNQLARNLACEWASDGIRANAVAPAVIATPLAEAVY---------
Y484_MYCTU      IVTVTSIAAIEVYDGGAGYTAAKHAQGALHRTLRGELLGKPVRLTEIAPGAVETE---------------
STCU_EMENI      IILTSSTASVKGVPRHAVYSGSKGAIDTFVRCLAIDCGDKKITVNAVAPGAIKTDVSREYIPN--GET-F
DECR_MOUSE      FLAITTIYAESGSGFVMPSSSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKT----KGAFSRLDPTGR
RD10A_DANRE     IVTVASSLGLFSTAGVEDYCASKFGAIGFHESLSHEIQASGIKMTLVCPYLVDTGMFR------------
DHRS7_ANOGA     IVSISSVQGKFAIPHRSAYSASKHAMQAFCDSLRAEVAKDNIKVTLISPGYINTALSLNALTGTGASYGK
DHB8_PIG        XXXXXXXXXXVGNMGQTNYAASKAGVIGLTQAVARELGRYRIRCNSVLPGFIKTPMAQKVPQKVLDK---
DHB13_RAT       IVTVASVCGHRVIPYLIPYCSSKFAAVGFHRALTAELDTTGIKTSCLCPVFVNTGFTKN-----------
Y4EL_RHISN      IVNITSVDAFKAHPQNAHYAATKAAVVSLTRSFAHAFAKDQVLINSVAPAGMATE-----KAKSLGFLG-
RDH10_XENTR     IVSVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKADGIKTTLVCPYLVDTGMFR------------
RD10B_XENLA     IVSVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKADGIKTTLVCPYLVDTGMFR------------
DHRS7_DROME     ICFISSVQGKFAIPQRAAYSASKHAMQAFADSLRAEVANKNINVSCVSPGYIRTQLSLNALTGSGSSYGK
DECR_RAT        FLAITTIYAESGSGFVMPSSSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKT----KGAFSRLDPTGK
CBR4_HUMAN      XXXXXXXXXLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDL----------
RD10A_XENLA     IVSVASSLGLFSTAGVEDYCASKFGVVGFHESLSHEIKASGIKTTLVCPYLVDTGMFR------------
FABG_ACTAC      IVCITSVSGLIGNRGQVNYXXXXXXXXXXXXXLAVELAKRKITVNCVAPGLIDTDIL-------------
DHG_BACME       VINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFAD-------
YM71_YEAST      IVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTKIRVILIAPGLVETEF------SLVRYRG-
SORD_KLEPN      IVNVXXXXXXXXXXXXXCYAATKAALNSFTRSWSKELGKYGIRVVGVAPGILETGLRTPEYEEALAWTRN
DHG1_BACME      VINMSSVHEKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFAD-------
RD10B_DANRE     IVTVASSLGLFTTAGVEDYCASKFGAIGFHESLSHELKADGIKMTLVCPFLVDT----------------
MTDH_UROFA      ICNRPLTQCF--------YNSSKAAVSNLGKCLAAEWAEKSIRVNMLSPGYVKTD-----------QTSH
DHB4_HUMAN      IIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNMTQTVMPEDLV---------
Y1627_STAS1     IINLASVAGHVVFPGSAVYCGTKYAVRAITEGLRQEEAIVGIRTTILSPGAVSTELT-DHISD------K
VER1_ASPPA      IILTSSTACVKGVPKHAVYSGSKGAIDTFVRCMAIDCGDKKITVNAVAPGAIKTDVSREYIPN--GET-F
DRS7C_BOVIN     IVLVNNIQGKLGIPFRTAYAASKHAALGFFDCLRAEVEEYDVVVSTVSPTF-------------------
DECR2_HUMAN     IVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGISGTEGLR--------RLGG
CBR4_MOUSE      XXXXXXXX-LKGNVGQSAYSATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDMTRHL----------
THR1_GLOLA      LILMGSITGQAGVPKHAVYSGSKGTIETFVRCMAIDFGDKKITVNAVAPGGIKTDMYRDVCREYIPNGGE
DHB4_RAT        IIMTASASGIYGNFGQANYSAAKLGLLGLANTLVIEGRKNNIHCNTIAPNMTETVMPEDLV---------
DHB4_MOUSE      ILMTSSASGIYGNFGQANYSAAKLGILGLCNTLAIEGRKNNIHCNTIAPNMTETVLPEDLV---------
YDFG_ECOL6      IINIGSTAGSWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLTEFSNVR-----FKGDDGK
YDFG_ECO57      IINIGSTAGSWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLTEFSNVR-----FKGDDGK
Y4MP_RHISN      IACMSSVSAQRGGGIFGGYSXXXXXXXXXXXXXXREFGPDSIRVNCVTPGLIQTDITGDKLS--------
DHB13_MOUSE     IVTVASVCGHGVIPYLIPYCSSKFAAVGFHRALTAELDTTGIKTSCLCPVFVNTGFTKN-----------
DECR2_PONAB     IVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGISGTEGLR--------RLGG
YDFG_ECOLI      IINIGSTAGSWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLTEFSNVR-----FKGDDGK
SOU1_SCHPO      LIFTASMSGHIANWQWASYHATKAAVKHLARALAVEWAPFA-RVNSVSPGYIDTDL-----------TLY
RDHE2_MOUSE     LVCISSSAGLIGVNGLSDYCASKFAALGFAESMFIETLAKGIKTTIVCPFFIKT----------------
MAS1_AGRT9      IVNLNSMSGQRVANSLVGYNMTKHGLAGLTKTTQHVGWDHGVRAVDICPGFVATNM--SSWTNLIGPDEM
YDFG_SHIFL      IINIGSTAGSWPYAGGNVYGATKAFVRQFSLNLRTDLHGTTVRVTDIEPGLTEFSNVR-----FKGDDGK
Y945_MYCTU      LVLISSVLGVKGVGVKAAYAASKAGVRSLGESLRAEYAQRPIRVTVLEPGYIESEMTAKSASTMLMVDNA
YQ53_SCHPO      ILQISSVAGYYPSPCLSMYNASKFAVEGLSQTIMRELDPNNIAITIVQPGGMQTE---------------
TODD_PSEP1      AIFTVSNAGFYPGGGGVLYTAGKHAVIGLIKQLAHEWGPR-IRVNGIAPG--------------------
S16C6_MOUSE     LVCISSIAGLVGINGLSDYSSSKFAAFGFAESLFLELTTK-VKSTIVCPYFIKT----------------
BNZE_PSEPU      AIFTVSNAGFYPGGGGVLYTAGKHAVIGLIKQLAHEWGPR-IRVNGIAPG--------------------
DHB8_CALJA      XXXXXXXXXXXXXNMGQTYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVMNK---
CBR4_RAT        XXXXXXXX-LKGNVGQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTKHL----------
KDSR_DICDI      IVFVSSTCGLVGVPGYSTYCPSKFALRGLAETLRSELKPYKITFSVVYPPDTDT----------------
DCXR_HUMAN      IVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNP---------TVVMTSMGQATW
YHDF_BACSU      IINTTSITAYEGDTALIDYSSTKGAIVSFTRSMAKSLADKGIRVNAVAPGPIWTPLI----------PAT
DECR2_MOUSE     IVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPG---------AISGTEGLRRL
DHI1_SAISC      IVIVSSVAGKVAYPMISAYSASKFALYGFFSSIRKEMSEVNVSITLCVLGLIDTDTAMKAVSGIIKMQAA
BPHB_PSES1      VVFTISNAGFYPNGGGPLYTGAKHAVVGMVRELAYELAPH-VRVNGVAPGGMSTDL--------------
YWC4_CAEEL      ITSITAGYARAGAPFIVPSAVSKAGVETMTKSLATEWSKYGLRFNAVSPGPIPTK----------GAWGR
YDFG_SALTY      IINIGSTAGSWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLTEFSSVR--FKGDDEKAGK
YDFG_SALTI      IINIGSTAGSWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLTEFSSVR--FKGDDEKAGK
RDH8_HUMAN      IVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVTEFEGKLLAQV------
DHK2_STRVN      XXXXXXIAGSRPAGSSIPYAVSNGGHRAQTRLLA-NTVGPAVRVNAVAPGLIETPWTQNSIAEHVRQT--
DHB12_XENTR     ILNISSASGMYPVPLLTVYSATKAFVDFFSRGLQAEYRSKGVTVQSVLPFYVATKLAK------------
DECR2_DANRE     IVNISATLGYRGQALQVHAGSAKAANDAMTRHLAVEWGPSGVRVNTVAPG------------PISGTEGR
DCXR_MOUSE      IVNVSSQASQRALTNHTVYCSTKGALDMLTKMMALELGPHKIRVNAVNP---------TVVMTPMGRTNW
DRS7C_HUMAN     IVLVNNIQGKFGIPFRTTYAASKHAALGFFDCLRAEVEEYDVVISTVSPTF-------------------
RDHE2_HUMAN     LVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVETKQKGIKTTIVCPFFIKT----------------
MFEA_DICDI      IIMTSSAAGLYGNFGQANYGSMKMALVGLSNTLAQEGKSKNIHCNTIAP---------------------
DRS7C_XENTR     IVLVNTIQGKIGVPFRAAYAASKHAIQGFFDCLRAEVEEFDVSVSTVSPTFIRSYHVQPQPGN-------
DRS7C_MOUSE     IVLVNNIQAKFGIPFRTAYAASKHAVMGFFDCLRAEVEEYDVVVSTVSPTF-------------------
T4HR_MAGGR      LILMGSITGQAAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDVCREYIPN--GENLS
EPHD_MYCTU      IVNVSSMAAYAPLQSLSAYCTSKAATYMFSDCLRAELDAAGVGLTTICPGVIDTNIVATTGFHAPG-TDE
EPHD_MYCBO      IVNVSSMAAYAPLQSLSAYCTSKAATYMFSDCLRAELDAAGVGLTTICPGVIDTNIVATTGFHAPG-TDE
ENTA_ECOLI      IVTVASDAAHTPRIGMSAYGXXXXXXXXXXXXVGLELAGSGVRCNVVSPGSTDTDMQR----TLWVSDDA
HCD2_DROME      IVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNTPML-----------AA
DECR2_RAT       IVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPG---------AISGTEGLRRL
DCXR_CAVPO      IVNVSSQASQRALTNHTVYCSTKGALYMLTKMMALELGPHKIRVNAVNP---------TVVMTPMGRTNW
YHXD_BACSU      IITTTSVEGYNPSPMLLDYAATKNAIIGFTVGLGKQLASKGIRVNSVAPGWTPLQISGGQPTENIPKFGQ
Y5909_MYXXD     LVGVSSLAGFRGLAGHAAYSASKAFLSTFMESLRVDLRGTGVRVTCIYPGFVKSEL--------------
BDH_CHICK       VVNISSMMGRMGSPARSPYCITKFGVEAFSDCLRYEMQPQGVMVSIVEPG--------------------
YAY8_SCHPO      IVNCSSINAYVGRPDLLDYTSTKGAITAFTRGLSNQYAQHGIRVNAVAPGPIYTPLVSSTF---------
Y0585_STAHJ     VVNLASISANEVSKESALYSATKSAVLMIFNGLEKELAKTGIKTTSILPGMVDTPM-----------TER
RDH16_HUMAN     VVNVSSVMGRVSL-FGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFKTAV--------------
HCD2_HUMAN      IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLL-------------
GS39_BACSU      IINTTSINPYVGNPTLIDYTATKGAINAFTRTMAQALVKDGIRVNAVAPGPIWTPLI----------PAT
Y4EK_RHISN      IFFTGSSGGLAPHPNSSVYGATKAAVSLFSSALRCDLIGLPIRVTELFPGRVETNLYRTA----LGKEGA
RDH2_RAT        VVNVASIAGRLSF-CGGGYCISKYGVEAFSDSLRRELSYFGVKVAIVEPGFFRTDV--------------
DHR11_MOUSE     IININSMCGVPPQSVIHFYSATKYAVTALTEGLRQELLEAQTHIRATCPGLVETQF-----------AFK
DHR11_HUMAN     IININSMSGVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCPGVVETQF-----------AFK
PGDH_RAT        XXXXXXXXXLMPVAQQPVYCASKHGIIGFTRSMAANLMKSGVRLNVICPGFVKTPIL-------------
DHB12_ANAPL     ILNISSAAGMYPTPLLTLYSASKAFVDYFSRGLHAEYKSKGIIVQSVMPYYVAT----------------
ADH2_CERRO      IVNIASVLGLEPCPPAAAYCASKFGVMGFSRSIGYYYNITGVAVVTFCPGLTETPL--------------
ADH2_CERCO      IVNIASVLGLEPCPPAAVYCASKFGVMGFSRSIGYYYNITGVAVVTFCPGLTETPL--------------
YGHA_ECOLI      IITTSSIQAYQPSPHLLDYAATKAAILNYSRGLAKQVAEKGIRVNIVAPG---------PIWTALQISGG
YGHA_ECO57      IITTSSIQAYQPSPHLLDYAATKAAILNYSRGLAKQVAEKGIRVNIVAPG---------PIWTALQISGG
SOU1_CANAL      LIITSSMSGIVNIPQLQAYNAAKAACTHLAKSLSVEWASFGARVNSISPGYILTDIADFA----------
RDH7_RAT        VVNIASTMGLLGGGY----CISKYGVEAFSDSLRRELTYFGVKVAIIEPGGFKTNV--------------
RDH3_RAT        VVNIASTMGLVGGGY----CISKYGVEAFSDSLRRELTYFGVKVAIIEPGGFKTNV--------------
H17B6_HUMAN     IVNVSSILGRVAF-FVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRT----------------
DHI1_HUMAN      IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSTLCVGLIDTETAMKAVSGIVHMQAA
BPHB_RHOGO      VIFTVSNAGFYPAGGGALYTGAKHAIVGMVKQLAYELGPH-IRVNGIAPGGLGGSDLRGLKALDLAEVSL
MAS12_AGRRH     VVNINSMSGQRVLNPFVGYNMTKHALGGLTKTTQHVGWDRGVRAIDICPGFVATEM--SAWTDLISSNDM
DH12B_XENLA     VLNISSASGMYPVPLLTVYSATKAFVDFFSRGLHAEYRSKGVTVQSVLPFFVATKLAK------------
Y1430_HAEIN     IINLSSIAGTYPYAGSNVYGGTKAFVTQFSLNLRADLAGTKIRVSNVEPGLTEFSNVR-----------F
MKAR_AJECN      ILTMASFAGMIPTPLLATYCGSKAFLQYWSIALGAELQPYGVQVELV-----QSHLVTSAMSKI------
DHR11_CHICK     IININSMNGVVPQSVVHFYSATKYAVTALTEGLRQELREAKTHIRATCPGLVET-----------GFAFK
DH12A_XENLA     ILNISSASGMYPVPLLTVYSATKAFVDFFSRGLHAEYRNKGINVQSVLPFYVATKLAK------------
H17B6_BOVIN     IVNVSSILGRIAF-FGAVYSCSKYGVEAFSDILRRELQHFGVKVSMVEPGYFRT----------------
DHB1_PANTR      VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT----------------
DHB1_HUMAN      VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHT----------------
BDH_RAT         VVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEPG--------------------
BDH_HUMAN       VVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPG--------------------
ADH_BACOL       IVNIASVLGLEPAPPAAIYCASKFGVMGFSRSISYYYNLTGIAVATFCPGLTETPL--------------
DHRS2_HUMAN     VILVSSIAAYNPVVALGVYNVSKXXXXXXXXXXXXXXXPKDIRVNCVVPGIIKTDF---------SKVFH
DHB12_MACFA     ILNISSGSGMFPVPLLTIYSATKTFVDFFSQCLHEEYRSKGIFVQSVLPYFVATKLAK------------
DHB12_HUMAN     ILNISSGSGMLPVPLLTIYSATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAK------------
BDH_MOUSE       VVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEPG--------------------
BDH_BOVIN       VVNISSMMGRMANVARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEPG--------------------
YCIK_ECOLI      LVFTSSSVGRQGRANWGAYAASKFATEGMMQVLADEYQQR-LRVNCINPGGTRT----------------
VIBA_VIBCH      MVIIGSNAANTPRMSIGAYGASKAALHMLVKCIGMELAPYGIRCNLVSPGSTRTAMQQQLWTEQYGEAQV
PTR1_LEITA      VVDAMTSQPLLGY---TMYTMAKEALEGLTRSAALELASLQIRVNGVSPGLS---VLPDDMPFSV----Q
MKAR_PICST      ILTMGSFGGLLPTPYLATYSGSKSFLQAWSAALAGELQSQGVDVELV-----------------------
DHRS7_DICDI     IIVISSLAGKFGTALRTSYSSSKHAVMGFFNSLRNE--TKNIQITIVCPGFILTEF-HDNLKTLDGK---
DHB14_HUMAN     VINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRAT
BPHB_COMTE      VVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPH-VRVNGVAPGGMNTDL--------------
YBBO_ECOLI      IVMTSSVMGLISTPGRGAYAASKYALEAWSDALRMELRHSGIKVSLIEPGPIRT----------------
YBBO_ECOL6      IVMTSSVMGLISTPGRGAYAASKYALEAWSDALRMELRHSGIKVSLIEPGPIRT----------------
BPHB_PSEPU      VIFTISNAGFYPNGGGPLYTAAKHAVVGLVRELAFELAPY-VRVNGVGPGGINSDLRGPSSLGMGGKAIS
ADH1_CERCA      IVNIASVLGLEPCPPAAVYCASKFGVVGFSRSLGFYYEHTGVAVVTFCPGLTDTPL--------------
HSDL1_CHICK     IVNVSSASCCQPTPMLTTYGASKAYLDYFSRALYYEYASKGIFVQSLTPFVIATRMV-------------
DHRS3_BOVIN     IVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLCPGVSATTVLPFHTSTEM--------------
ABA2_ARATH      XXXXXXXXXXXXXXXXXXXXXXKHAVLGLTRSVAAELGQHGIRVNCVSPYAVATKL---ALAHL-PEEER
DHRS3_MOUSE     IVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLCPGVSATTVLPFHTSTEM--------------
DHRS3_HUMAN     IVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLCPGVSATTVLPFHTSTEM--------------
DHB12_BOVIN     ILNISSASGMYPVPLLTIYSATKAFVDFFSQCLHEEYKSKGVIVQSVLPYYVATKLAK------------
DH12A_DANRE     ILNISSASGMFPVPLLTIYSSTKAFVDFFSRGLQTEYKCKGIIIQSVLPFFVATKMTK------------
YXEK_CAEEL      VLSITTLYAQSGAPFVVPSAVSKAGVENMTKSLASEWAKHGLRFNAIAPGPIPTEGAFGRL--FAGELKD
DHMA_FLAS1      IITIGSVNSFMXXXXXXXXXXXXXXXXMLTRAMAVDLARHGILVNMIAPGPV------DVTGNNTGYSER
DHB2_MOUSE      LVNVSSMGGTVPLQMTSAYAATKAALTMFSTIIRQELDKWGVKVVTIKPGGFKTNI--------------
Y3106_PSEAE     IVNIASTRAHQSEPDSEAYAASKXXXXXXXXXXXXXXXPD-IRVNALSPGWIDT---REAA---------
HCD2_RAT        IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVVTIAPGLFATPLL-------------
YVX3_CAEEL      VTSITAAYARSGAPFIVPSAVSKAGVEIMTKSLATEWSKYGLRFNAVSPGPIPTK----------GAWGR
YI78_SCHPO      IINVSSIGGKMTFPLGCLYYGTKYAIEGISEALTWEMQSIGVKVKIIEPGFTATE---------------
ADH2_CERCA      IVNIASVLGLEPCPPAAVYCASKFGVMGFSRSIGYYYNITGVAVVTFCPGLTETPL--------------
YWFH_BACSU      IINIVGNLWKEPGANMFTNSMMNAALINASKNISIQLAPHNITVNCLNPGFIATDRYHQFVENVMKKNSI
YI13_SCHPO      ILNVGSIAGRESYVGGSVYCSTKSALAQFTSALRKETIDTRIRIMEVDPGLVETE---------------
Y452_LISIN      IIATSSVAGLKAYPGGAVYGATKWAVRDLMEVLRMESAQEGTNIRTIYPAAINTELLETI-------TDK
Y432_LISMO      IIATSSVAGLKAYPGGAVYGATKWAVRDLMEVLRMESAQEGTNIRTVTPAAINTELLETI-------TDK
FABG_SCHPO      ILNISSRLSTYALPGTSVYAASKAGLESFTKVLAAEVASKGIRVNAISPGYVDTPML-------------
DHRS1_MOUSE     IVIVSSPGGLVPYGVGKAACDR------LAADCAHELRRHGVSYVSLWPGLVQTEMVKEFMA--------
VDLC_HELPJ      IFNLSSIAGRVSMLFLGHYSASKHALEAYSDALRLELKPFNVQVCLIEPGPVKSNWEKTAFEN-------
DR9C7_MOUSE     VVNMSSSGGRVAI-FGGGYCVSKFGVEAFSDSIRRELHFFGVKVSIIEPGNYKTSIL-------------
DHR11_BOVIN     IININSMCGVPPPAETHFYSATKYAVTALTEGLRQELREARSHIRATCPGVVETQF-----------AFK
DHI2_MOUSE      IVTVGSPAGDMPYPCLAAYGTSKAAIALLMDTFGCELLPWGIKVSIIKPGCFKTDAV-------------
HCD2_MOUSE      IINTASVAAFEGQVGQAAYSASKGGIDGMTLPIARDLAPTGIRVVTIAPGLFATPLL-------------
DHI1_RABIT      IVVVSSLAGKIAHPLIAPYSASKFALDGFFSAIRKEHALTNVNVSTLCVGLIDTDTAMKEVSGKIDMKAA
DCXR_TRIRE      LVITASMSGHVANQEQTSYNVAKAGCIHLARSLANEW-RDFARVNSISPGYIDT-----------GLSDF
ADHR_DROPS      IVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLALYYTQNGVAVMAVCCGPTKVFVDRELTA--------
ADHR_DROPE      IVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLALYYTQNGVAVMAVCCGPTKVFVDRELTA--------
MTDH_AGABI      SIVVTXXXXXXXXXXXXXYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTD-----------QTAH
MKAR_PICGU      ILTMGSFGGLLPTPYLATYSGSKAFLQSWSNALSGELQPQGVDVELV-----------------------
DHRS4_PONAB     XXXXXXXAAFSPSPGFSPYNVSXXXXXXXXXXXXIELAPRNIRVNCLAPGLIKTSFSR-----MLWMDKE
DHRS4_HUMAN     XXXXXXXAAFSPSPGFSPYNVSXXXXXXXXXXXXIELAPRNIRVNCLAPGLIKTSFSR-----MLWMDKE
ADH1_CERCO      IVNIASVLGLEPGPPAAIYCASKFGVMGFSRSLGHYYEHTGIAVVTFCPGLTDTPL--------------
MKAR_NEUCR      ILTMGSFAGVMPTPYLATYSGSKAFLQHWSSALSAELKDQGVDVHLV-----------------------
HSDL1_HUMAN     IVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSM--------------
DHB2_RAT        LVNVSSMGAMIPFQMVAAYASTKAAISMFSAVIRQELAKWGVKVVTIHPGGFQTNIV-------------
BPHB_BURXL      VIFTISNAGFYPNGGGPLYTAAKHAIVGLVRELAFELAPY-VRVNGVGSGGINSDL--------------
ADHR_DROTE      IVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLALYYSQNGVAVMAVCCGPTRVFVDRELKA--------
ADHR_DROMA      IVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLALYYSQNGVAVMAVCCGPTRVFVDRELKA--------
ADHR_DROER      IVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLALYYSQNGVAVMAVCCGPTRVFVDRELKA--------
MTDH_CLAHE      LVITASMSGHIANQEQTSYNVAKAGCIHMARSLANEW-RDFARVNSISPGYIDTGL--------------
HSDL1_BOVIN     IVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATNV--------------
HCD2_BOVIN      IINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPMGIRVMTI-----------------------
DHRS9_BOVIN     IINVSSIGGRLAFG-GGGYSPSKYAVEGFNDSLRRDMKAFGVHVACIEPGLFKTNL--------------
ADHR_DROSU      IVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLALYYTQNGVAVMAVCCGPTKVFVDRE-----------
ADHR_DROGU      IVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLALYYTQNGVAVMAVCCGPTKVFVDRE-----------
MTDH_ALTAL      LVITSSMSGHIANQEQASYNVAKAGCIHLAKSLANEW-RDFARVNSISPGYIDTGL-SDFVPQDIQKLWH
MKAR_PODAN      ILTMGSFAGTMPTPYLATYSGSKAFLQHWSSSLASELAPHGVDVQFV-----------------------
HDHA_CLOSO      XXXXXPDISRIGYG------VSKSGVNNITKQIAIQYAKYGIRCNAVLPGLIATDAAMNSM---------
DS7CA_DANRE     FVLVNSIQGKLALPFRTCYAASKHAVQAFFDCLRAEVEEFGISVSTI-----------------------
ADHR_DROME      IVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLALYYSQNGVAVMAVCCGPTRVFVDRELKA--------
ADHR_DROMD      VVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLALYYTQNGVAVMAVCCGPTKVFVDRE-----------
ADHR_DROLE      ILNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLALYYTQNGVAVMAVCCGPTKVFVDRELTA--------
RDH7_MOUSE      VVNISSSMGRVSL-CGGGYCISKYGVEAFSDSLRREISYFGVKVAIIEPGGFRTNV--------------
MKAR_SCHPO      ILTMGSFAGLLPSPYLSTYAGSKAFLSNWSASLGEEVKKQGIDV--------------------------
MKAR_LODEL      ILTMGSFGGLLPTPYLATYSGSKAFLQAWSAALAGELNPKGVDVELV-----------------------
HSDL1_PONAB     IVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSM--------------
DHB12_RAT       ILNISSASGMLPVPLLTVYSATKAFVDFFSQCLHEEYKSKGIFVQSVLPFFVATKLAK------------
ADHR_DROIM      IVNVTSVVGLDPSPVFCAYSASKFGVIGFTRSLALYYTQNGVAVMAVCCGPTKMFVDRQLTA--------
ADHR_DROAM      IVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLALYYNQNGVAVMAVCCGPTKVFVDRE-----------
YJGI_ECOLI      ILIIGSVNGRMPVXXXXXXXXXXXXLQGMARGLARDFGPRGITINVVQPGPIDTD------ANPAN--GP
Y048_HAEIN      IINISSMNAFTPLTKIPAYSGAKAAISNFTQWLAVYFSKVGIRCNAIAPGFL---VSNQNLALLFDTEGK
SOU2_CANAL      FIFTASSASIVNVPQLAAYNAAKAGVKHLSKSLSVEWA-PFARVNSVSPGYIATHLSEFADPDVKSK---
RDH1_HUMAN      VINITSVLGRLAANG-GGYCVSKFGLEAFSDSLRRDVAHFGIRVSIVEPGFFRTPV--------------
MOMAS_ORYSJ     XXXXXXXXXXXXXXXXXXYTTSKHALVGFTENAAGELGRHGIRVNCVSPAGVATPLARAAM---------
DH12B_DANRE     ILNVASASGMYPVPLLTLYSSTKAFVDFFSRGLDAEYKSKGIIIQSVLPFYVTTKL--------------
VDLC_HELPY      IFNLSSIAGRVSMLFLGHYSASKHALEAYSDALRLELKPFNVQVCLIEPG--------------------
TS2_MAIZE       XXXXXXXXXXXXXXXPHAYTASKHAIVGLTKNAACELRAHGVRVNCVSPFGVATPMLINATVPSDQEVEK
S16C6_HUMAN     LVCISSIAGVVGINGLSYYSASKFAAFGFAESLFFELTKTEVKSTIVCPHFINT----------------
MKAR_CHAGB      ILTMGSFAGVMPTPYLATYSGSKAFLQHWSSSLASELKPHGVDVQLV-----------------------
DHI1_MESAU      IVVVSSIAGKMAHPLVASYSASKFALDGFFSSLRREHGVTNVNVSTLCVGLINTETAMKATSGVFNAPAS
YF3H_SCHPO      LVATASMSGVVVNQQQCAYNTSKAGVIQLIKSLAVEW-RKFARVNCVSPGYTTSDM--------------
MKAR_DEBHA      ILTMGSFGGLLPTPYLATYSGSKSFLQAWSSALAGELKPQGIDVQLV-----------------------
MAS11_AGRRH     IVNINSMSGQRVLNPLVGYNMTKHALGGLTKTTQHVGWDRRCAAIDICLGFVATDM--SAWTDLIASKDM
DHRS9_MOUSE     VINVSSIGGRLAFG-GGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTEL--------------
DHI2_RAT        IVTVGSPAGDMPYPCLAAYGTSKAAIALLMDTFSCELLPWGIKVSIIQPGCFKTEAV-------------
DHI2_RABIT      IVTLGSPAGEMPYPCLAAYGTSKAAMALLMDAFSCELLPWGVKVSVIQPGCFKTESV-------------
DHB12_MOUSE     ILNISSASGMLPVPLLTIYSATKAFVDFFSQCLHEEYKSKGIFVQSVMPYLVATKLAK------------
CSGA_MYXXA      VAHVTSRMGSLAAGGAYAYRMSKAALNMAVRSMSTDLRPEGFVTVLLHPGWVQTDM--------------
25KD_SARPE      VVSISSVYGLEPGPAFSVYSAAKHGGIGFTRSMADEYHKTGVAFMCICPAMTSTELM-------------
PTR1_LEIMA      MVDAMTNQPLLGY---TIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLS---VLVDDMPPAVWEGHR
MKAR_MAGGR      ILTMGSFGGWMPTPFLATYSGSKAFLQHWSTSLAEELRSSGVDVHLV-----------------------
MKAR_CANAL      ILTMGSFGGLLPTPYLATYSGSKSFLQAWSAALAGELQADHVDVELV-----------------------
HCAB_PHOLL      IFTLSNSSWFSGGGGV-LYTASKHGAVGMIRQLAYELAPV-IRVNGVAPCGMPSDL--------------
DS7CB_DANRE     ILLVNSIQGKLAMPFRTTYAASKHAVQAFFECLRAEVQEYGITVSTINHTFIKT----------------
DR4L2_HUMAN     XXXXXXXAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCL-----HLDLSRLASAGCSGWTRK
MKAR_ASPTN      ILTMGSFGGLLPTPLLATYSGSKAFLQQWSTSLGSELAPYGITVELV-----------------------
DHI1_SHEEP      XXXXXXXAGKIACPLAAAYSASKFALDGFFSSLRTEYATKNVSITLCILGLIDTDTAMKAVAGIYNAEAS
DHI1_MOUSE      IAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELITKNVSITLCVLGLIDTETAMKEISGIINAQAS
DHB14_BOVIN     VINISSLVGAIGQSQAVPYVATKGAVTAMTKALALDESQYGVRVNCISPGNIWTPLWEELAASTPDPTAT
BPHB_PSEPS      VIFTISNAGFYPNGGGPLYTAAKQAIVGLVRELAFELAPY-VRVNGVGPGGMNSD-MRGPSSLGMGSKAI
YAEB_SCHPO      IVNVNSLVSYVPXXXXXXXXXXXXXXXXXXNTLRIELAPFGVQVTSIMTGGVQTKIQSKPLGTMIPENSI
MKAR_VANPO      ILTMGSFGGLIPTPLLATYSGSKAFLQSWSSSLAGELKEHNVDVELI-----------------------
DR9C7_BOVIN     VVNMSSSGGVIGGGY----CISKFGVEAFSDSIRRELHYFGVKVSIIEPGNFRTAIL-------------
NAHB_PSEPU      VVMTXXXXXXXXXXXXXCYIASKHAVLGMVKALAYELAPE-VRVNAVSPGGTVTSLCGSASAGFDKMHMK
HSDL2_HUMAN     ILNISPPLNLVWFKQHCAYTIAKYGMSMYVLGMAEEFKGE-IAVNALWP----KTAIHTAAMDMLGGPGI
NAHB_PSEU8      VVMTXXXXXXXXXXXXXCYIASKHAVLGMVKALAYELAPE-VRVNAVSPGGTVTSLCGPASAGFDKMHMK
MKAR_KLULA      ILTMGSFGGLLPTPFLATYSGSKAFLQSWSNALAGELSSDSIDVELV-----------------------
MKAR_ASPOR      ILTMGSFGGLLPTPLLATYSGSKAFLQQWSTALGSELEEHGITVELV-----------------------
DHRS9_RAT       VINVSSIGGRLAFG-GGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTGL--------------
YUSR_BACSU      IVNVXXXXXXXXXXXXMPYAVSKSAVHGLTKSLAHALAPE-IRVSGVAPGAVAT------------RWWA
YQC8_SCHPO      LIATASMSATIVNAHIAAYCASKAAVRQLCKALAVEWA-EFARINSVSPGYFATDM--------------
RDH8_BOVIN      IVVVSSVMGLQGVVFNEVYAASKFAMEGFFESLAVQLLQFNIFISLVEPGPVVTE---------------
MKAR_ASPCL      VLTMGSFGGLLPTPLLATYSGSKAFLQQWSTSLGSELEPYGITVELV-----------------------
HSDL2_PONAB     ILNISPPLNLIWFKQHCAYTIAKYGMSMYVLGMAEEFKGE-IAVNALWP----KTAIHTAAMDMLGGPGI
DR9C7_HUMAN     VVNMSSSGGVIGGGY----CVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAIL-------------
3BHD_COMTE      IINMASVSSWLPIEQYAGYSXXXXXXXXXXXXXXXXCRKQGIRVNSIHPDGIYTPMMQASLPKGVSK---
Y1570_MYCBO     IVNVSSVGVQTRAPRFGAYIASKAALDSLCDALQAETVHDNVRFTTVHMALVRTPMI-------------
Y1543_MYCTU     IVNVSSVGVQTRAPRFGAYIASKAALDSLCDALQAETVHDNVRFTTVHMALVRTPMI-------------
DHI1_RAT        IAIISSMAGKMTQPLIASYSASKFALDGFFSTIRKELMTKNVSITLCVLGFIDTETALKETSGIILSQAA
OXIR_STRAT      IVVVSSGAHLDAYDPWVAYGQSKAADVLFTVG-ARRWAADGITVNALNPGYILTRLQRHVDDETMRAFGV
MKAR_EMENI      ILTMGSFGGLVPSPLLATYSGSKAFLQQWSTALGSELQPYGITVELV-----------------------
ACR1_ACIBI      IINISSIGVLANATRFSAYVASKAALDAFSRCLSAEVLKHKISITSIYMPLVRTPMI-------------
ACR1_ACIAD      IINISSIGVLANATRFSAYVASKAALDAFSRCLSAEVLKHKISITSIYMPLVRTPMI-------------
MKAR_NEOFI      VLTMGSFGGLLPTPLLATYSGSKAFLQQWSTSLGSELEPYGITVELV-----------------------
MKAR_ASPFU      VLTMGSFGGLLPTPLLATYSGSKAFLQQWSTSLGSELEPYGITVELV-----------------------
MKAR_ASPFC      VLTMGSFGGLLPTPLLATYSGSKAFLQQWSTSLGSELEPYGITVELV-----------------------
LIGD_PSEPA      IVTVSSLGGFMGSALAGPYSAAKAASINLMEGYRQGLEKYGIGVSVCTPANIKSNIA-EASRLRPAKYGT
RDH1_BOVIN      VINITSVLGRLAANG-GGYCVSKFGLEAFSDSLRRDVAPFGVRVSIVEPGFFRTPV--------------
AYR1_YEAST      IVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPFNVRVINAITGGVATDI--------------
HSDL1_RAT       IVTVSSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVTSSV--------------
HSDL1_MOUSE     IVTVSSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFY-------------------
DHB2_HUMAN      LVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNI--------------
RDH12_HUMAN     VVNVSSVAHHIGYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVR------------
MKAR_SCLS1      ILTMGSFGGWLPTPLLATYSGSKAFLQQWSTSLGGELEGTGVDVELV-----------------------
MKAR_BOTFB      ILTMGSFGGWLPTPLLATYSGSKAFLQQWSTSLGGELKGTGVDVELV-----------------------
YIV6_YEAST      IVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQKD-----------
YD114_YEAST     IINIASVLGELTPARLTSYGASKGAMIGFFRSLSTECNKTGIKTLLVCPGKIKTNMFID-----------
STDH3_CAEEL     IVNIGSVAGAAKMAEWSVYSASKKYVEWLTGCLRKEYEHQGIIIQAITPGHTETSLFAKSALNTVGTTGY
RDH13_MOUSE     IINLSSLAHVAGYDTKAAYCQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTELGR------------
RDH12_BOVIN     VVNLSSVAHHLGYNLGFAYCHSKLANVLFTRELAKRLKGTGVTTYAVHPGIVRSKLVR------------
FABI_HAEIN      -------------------CLAKASLEAATRVMAADLGKEGIRVNAISAGPIRT-LAASGIKNFKKMLST
BZRD_BACCE      VINISSGAGKNPYFGWGAYCTTKAGVNMFTQCVATEEVEKPVKIVAFAPGVVDTNMQAQ-----IRETAK
ADH_SCAAL       IANICSVTGFNSIYQVPVYSASKAAALSFTSSLARLAPITGVTVYSINPGITDTTLV-------------
ADH_DROCR       VVNICSVTGFNSIYQVPVYSASKAAALSFTSSIAKLATITGVTVYSINPGITDTTLV-------------
YIV5_YEAST      VVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKAIAVAPGIVDTDMQVNIREN-VGPSSM
HCAB_ECO5E      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECO57      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
ADH_DROSL       IANICSVTGFNSIYQVPVYSASKAAALSFTTSLAKLAHITGVTVYSINPGITKTVLV-------------
DHRS1_HUMAN     IV-VISSPGSLQYMFNVPYGVGXXXXXXXXXXXXHELRRHGVSCVSLWPGIVQTELLKEHMA--------
ADH_DROMM       IANICSVTGFNSIYQVPVYSASKAAALSFTNSLARLASVTGVTAYSINPGITKTVLV-------------
ADH_DROHE       VVNICSVTGFNSIYQVPVYSASKAAALSFTTSLAKLAHITGVTVYSINPGITKTVLV-------------
RDH11_HUMAN     IVNVSSLAHHLGYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVR------------
ADH2_DROBU      IANICSVTGFNAIYQVPVYSASKAAALSFTNSLAKLAPITGVTAYSINPGITKTTLV-------------
OXIR_STRLI      IVVVSSGAHLRPYDPWAAYGNSKTADVLFTVG-ARRWAADGITANALNPGYILTRLQRHVDDETMRAFGV
H17B6_RAT       IVNVSSVLGRVAL-FGGFYSCSKYGVEAFSDVLRREIRDFGVKVSIIEPGSFKT----------------
ADH_ZAPTU       IANICSVTGFNAIYQVPVYSASKAAVVSFTQSIAKLAPITGVTAYSINPGITKTTLV-------------
ADH2_DROMU      IINICSVTGFNAIYQVPVYSASKAAALSFTNSLAKLAPITGVTAYSINPGITKTTLV-------------
LE767_CAEEL     IVNVGSSAGANQMALWAVYSATKKYVSWLTAILRKEYEHQGITVQTIAP---------------------
HCAB_ECO7I      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
BZRD_BACSU      VVNITSGAAKNPYKGWSAYCSSKAGLDMFTRTFGFEQEDEELPVNMISPGVMDTEM--------------
ADH_DROMY       IANICSVTGFNAIYQVPVYSASKAAALSFTNSLAKLAPITGVTAYSINPGITKTTLV-------------
ADH_DROLE       IINICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLV-------------
ADH_DROLA       VVNICSVTGFNAIYQVPVYSASKAAALSFTNSLARLAPITGVTAYSINPGITRTPLV-------------
ADH_DROBO       VVNICSVTGFNAIYQVPVYSASKAAALSFTNSLARLAPITGVTAYSINPGITRTPLV-------------
ADH2_DROAR      IANICSVTGFNAIYQVPVYSASKAAALSFTNSLARLAPITGVTAYSINPGITKTTLV-------------
ADH1_DRONA      IANICSVTGFNAIYQVPVYSASKAAALSFTNSLAKLAPITGVTAYSINPGITKTTLV-------------
ADH1_DROMN      VVNICSVTGFNAIYQVPVYSASKAAALSFTNSLARLAPITGVTAYSINPGITRTPLV-------------
MKAR_PYRTR      VLTMASFGGFFPTPLLATYSGSKAFLQQWSTALASELEPHGVYVQCV-----------------------
DHB3_HUMAN      ILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKT--
ADH_DROVI       IANICSVTGFNAIYQVPVYSASKAAALSFTNSLARLAPITGVTAYSINPGITRTPLV-------------
ADH_DROFL       IANICSVTGFNAIYQVPVYSASKAAALSFTNSLARLAPITGVTAYSINPGITRTPLV-------------
ADH2_DROMN      IANICSVTGFNAIYQVPVYSASKAAALSFTNSLARLAPITGVTAYSINPGITRTPLV-------------
ADH1_DROMT      IANICSVTGFNSIYQVPVYSASKAAAISFTNSLAKLAPITGVTAYSINPGITKTPLV-------------
STDH4_CAEEL     IVNIGSAAGSIHMAKWSVYSATKKYIEWFTSILQKEYENEGIICQTITPLLVSTNMIKNPLSSI------
MKAR_PHANO      ILTMASFGGFFPTPLLATYSGSKAFLQQWSSALGSELEPHGVHVQCV-----------------------
MKAR_MALGO      ILNLGSFSGQWSTPLLATYAGSKAFLIAWTQALGEEMRRSHVDV--------------------------
MKAR_ASHGO      VLTMGSFDGLLPTPLLATYSGSKDFVQAWSTALVVDLAPLNVDVQIV-----------------------
HCAB_SHISS      MIFTLSNAARYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_SHIBS      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECOSM      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECOSE      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECOLU      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECOLI      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECOLC      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECOHS      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECODH      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECOBW      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECO8A      IFTLSNAAWYPGGGG-PLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECO55      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_ECO24      MIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
ADH_DROWI       VINIGSVTGFNAIYQVPVYSASKAAVVSFTQSIAKLANVTGVTAFTVNPGITKTTLV-------------
ADH_DROPU       VINIGSVTGFNAIYQVPVYSASKAAVVSFTQSIAKLANVTGVTAFTVNPGITKTTLV-------------
ADH_DROIN       VINIGSVTGFNAIYQVPVYSASKAAVVSFTQSIAKLANVTGVTAFTVNPGITKTTLV-------------
ADH_DROEQ       VINIGSVTGFNAIYQVPVYSASKAAVVSFTQSIAKLANVTGVTAFTVNPGITKTTLV-------------
ADH2_DROMO      IANVCSVTGFNAIYQVPVYSASKAAALSFTNSLARLAPITGVTAYSINPGITKTTLV-------------
ADH1_DROMU      IANICSVTGFNAIYQVPVYSASKAAALSSTNSLAKLAPITGVTAYSINPGITKTPLV-------------
RDH13_HUMAN     IINLSSLAHVAGYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRH--TGIHGSTFS
MKAR_CRYNE      VITIGSLSGRIPSPLLASYSGXXXXXXXXXXXXXEEVKPQGVIVELV-----------------------
ADH_DROGR       VVNICSVTGFNSIYQVPVYSASKAAALSFTTSIAKLAHITGVTAYSINPGITKTVLV-------------
ADH2_DROWH      IINICSVTGFNAIYQVPVYSASKAAALSFTNSLAKLAPITGVTAYSINPGITVTPLV-------------
ADH2_DROHY      IANICSVTGFNAIYQVPVYSASKAAALSFTNSLAKLAPITGVTAYSINPGITKTTLV-------------
ADH1_DROHY      IANICSVTGFNAIYQVPVYSASKAAALSFTNSLAKLAPITGVTAYSINPGITKTTLV-------------
HSDL2_DANRE     XXXXXXXXXXIWFKNHTAYTIAKYGMSMCVLGMAEEF-RGSIAVNALWP----KTAIQTAAMDMLGGSEV
HSDL1_DANRE     VVNISSGHCFHPIPRKAAFSASTAFLDNFSRSLHYEYGDQGVFVQSLLP---------------------
H17B6_MOUSE     IVNVSSALGRVAL-FGGFYSCSKYGVEAFSDVLRHEVQDFGVKVSIIEPGSFKTEM--------------
ADH_DROPL       IANICSVTGFNSIYQVPVYSASKAAALSFTTSLAKLAHITGVTAYSINPGITKTVLV-------------
ADH_DRONI       IVNICSVTGFNSIYQVPVYSASKAAALSFTGSIAKLAPITGVTAYSINPGITKTVLV-------------
ADH_DRODI       IANICSVTGFNSIYQVPVYSASKAAALSFTTSLAKLAHITGVTAYSINPGITKTVLV-------------
HSDL2_XENLA     IXXXXXXXXXXXMWFKNAYTIAKYGMSMCALGMSEEYKGE-IAVNALWP----KTAIHTAAMDMLGGSGV
DHB3_MOUSE      ILNISSGAALRPWPLYSLYSASKAFVYTFSKALSVEYRDKGIIIQVLTPYSISTPMTK------------
ADH_DROPS       IINIGSVTGFNAIYQVPVYSGSKAAVVNFTSSLAKLAPITGVTAYTVNPGITKTTLV-------------
ADH_DROPB       IINIGSVTGFNAIYQVPVYSGSKAAVVNFTSSLAKLAPITGVTAYTVNPGITKTTLV-------------
ADH_DROMD       IINIGSVTGFNAIYQVPVYSGSKAAVVNFTSSLAKLAPITGVTAYTVNPGITKTTLV-------------
ADH_DROGU       IINIGSVTGFNAIYQVPVYSGSKAAVVNFTSSLAKLAPITGVTAYTVNPGITKTTLV-------------
ADH_DROAM       IINIGSVTGFNAIYQVPVYSGSKAAVVNFTSSLAKLAPITGVTAYTVNPGITKTTLV-------------
ADH_DROAF       VVNICSVTGFNSIYQVPVYSASKAAALSFTTSIAKLAHITGVTAYSINPGITKTVLV-------------
ADH1_DROMO      IANVCSVTGFNAIYQVPVYSASKAAALSFTNSLAKLAPITGVTAYSINPGITKTPLL-------------
YXNA_BACSU      LINVGSLFGDRGTVIQSTYASAKFALHGWTESIRMELEKEPVSVTLIHPGRIDT----------------
HCAB_SHIFL      MIFTLSNAAWYPGGGGPLYTTSKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
HCAB_SHIF8      MIFTLSNAAWYPGGGGPLYTTSKHAATGLIRQLAYELAPK-VRVNGVGPCGMASDL--------------
DHB3_RAT        ILNISSGVGVRPWPLYSLYSASKAFVCTFSKALNVEYRDKGIIIQVLTPYSVSTPMTKYLNTSRVTKT--
ADH_DROPE       IINIGSVTGFNAIYQVPVYSGSKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
STDH2_CAEEL     IVNIGSFAGVVKLAEWSIYSATKKYVEWLTGCLRKEYSHHGIIFQAITPAMVAT----------------
SPRE_XENTR      VVNVSSLAALQPFKSWALYCSGKAARDMIFRVLAEE--EKDVRVLNYAPGPLDTDM------HVVARTQT
DHI2_HUMAN      IVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRN-----------
ADH_DROYA       IINIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
ADH_DROTS       IINIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
ADH_DROTE       IINIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
ADH_DROSI       IINIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
ADH_DROSE       IINIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
ADH_DROOR       IINIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
ADH_DROME       IINIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
ADH_DROMA       IINIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
ADH_DROER       IINIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
ADH_DROAN       IINIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLV-------------
YKH1_YEAST      IFFISSVAGSINAFVVSAYGQSKAALNYAVKTLSFELKPEGFTVVAFHPGMVSTDM--------------
MNR1_CAPAN      IVNVASSMGKLKLSYFTAYKVSKASLIAYTRVLATKYPN--FRINSVCPGYCKTDV--------------
ADH_DROPI       VVNICSVTGFNSIYQVPVYSASKAAALSFTMSIAKLAHITGVTAYSINPGITKTILV-------------
STDH1_CAEEL     IVNIGSVAGLATMAEWSVYSATKKYVEWITGCLQKEYGHQGIIFQAITPAMVAT----------------
MKAR_ASPNC      VLTMGSFGGLLPTPLLATYSGSKAFLQQWSTSLGSELEPYGITVELV-----------------------
HSDL2_XENTR     IXXXXXXXXXIWFKNHCAYTIAKYGMSMCALGMSEEYKGE-IAVNALWP----KTAIHTAAMDMLGGSGV
FABI_BACSU      IVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRT----------LSAKGI
ADH_DROSU       IINIGSVTGFNAIYQVPVYSGSKAAVVNFTSSLAKLAPITGVTAYTVNPGITKTTLV-------------
MKAR_COCIM      ILTMGSFGGLLPTPLLATYSGSKAFLQHWSTALASELEPYNIHVQLV-----------------------
ADH_DROAD       VVNICSVTGFNSIYQVPVYSASKAAALSFTTSFRKLAGITGVTAYSINPGITKTVLV-------------
YDFG_DICNO      ----------------------------------------------------------------------
YCP9_SCHPO      VIFTSSECGSMGTGF-SAYGQSKAAINFTMKELSVELADEHFTFISIHPGVVKTDMNADAI---------
FABI_PSEAE      ---------------------AKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRT---------LAASGIK
TSC10_CRYNE     IIFVASFLSYVSFAGYSSYSPAKYALRGLSDALRSEMLLHNIDIHIFLP---------------------
RDH12_MOUSE     VVNLSSIAHLIGYCSAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEITRNS----------
RDH11_MOUSE     IVNLSSLGHHLGYSAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTR------------
MKAR_YARLI      ILTMGSFGGLLPTPLLATYSGSKAFLQHWSNALAVELAPEHVDVELV-----------------------
MKAR_CANGA      ILTMGSFGGLIPTPLLATYSGSKAFLQNWSSSLAGELAADNVDVELV-----------------------
FABI_AQUAE      IVTLSYYGAEKVVPHYNVMGIAKAALESTVRYLAYDIAKHGHRINAISAGPVKTL----AAYSITGFHLL
DECR2_ARATH     XXXXXATLHYTASWYQIHVSAAKAAVDATTRNLALEWGT-------------------------------
ADH_DROIM       IANICSVTGFNAIYQVPVYSASKAAVVSFTSSLAKLAPITGVIAYSINPGITKTTLV-------------
YJNK_SCHPO      IVFTSSMAACMGGNTYSAYGQSKAALNYTMKEISFELEKDGFVVVSIHPGVVNTDMFVNAMQKLASK---
YBPE_SCHPO      VVNIASSLAYFSAMGVGAYSSSKAALVSLHETLEEEVLSQ------------------------------
MKAR_COPC7      ILNIGSFAGAIPSPMLATYSGTKAFLSTFSSALGEEVKKDGIIVENV-----------------------
ADH_DROHA       VANICSVTGFNSIYQVPVYSASKAAALSFTTSIAKLAHITGVTAYSINPGITKT----------------
SPRE_HUMAN      VVNISSLCALQPFKGWALYCAGKAARDMLFQVLALE--EPNVRVLNYAPGPLDTDLARETSVDPDMRKGL
FABI_SHIFL      ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPIRT---------LAASGIK
FABI_SALTY      ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPIRT---------LAASGIK
FABI_NEIMB      PMMRGRNSAIVALSYLGAVRAINYNVMGMAKATAACLGKEGIRCNGISAGPIKT-LAASGIADFGKLLGH
FABI_ECOLI      ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPIRT---------LAASGIK
FABI_ECO57      ---------------------AKASLEANVRYMANAMGPEGVRVNAISAGPIRT---------LAASGIK
LE767_CAEBR     IVNVGSSASANQMALWAVYSATKKYVSWLTAILRKEYEHQGITIQTIAP---------------------
DHS5_CAEEL      IVVLSSSQGVRPIPMLAAYCATKALMTFLCESIDREYST--INVQTLIPALVAT----------------
YCP8_SCHPO      IVFTSSLAGSMGAFFPSAYGQSKAALNYTMKEISFELQDEGFIVISIHPGAVRTDSAQEIV---------
YCP6_SCHPO      IVFTSSLVGSMGAFFPSGYGQSKAALNFTMKEISFELQDEGFIVISIHPGMVRTDSAQEAV---------
MKAR_LACBS      ILNVGSFAGAVPSPMLATYSGTKAFLTTFSSALGEEVRKDNITV--------------------------
FABI1_RHIME     ILTLTYYGAEKVMPHYNVMGVAKAALEASVRYLAVDLGNRGIRVNAISAGPIKT-LAASGIGDFRYILKW
SPRE_XENLA      VVNVSSLAALQPYKSWVLYCSGKAARDMMFRVLAEE--EDDVRVLSYAPGPLDTDM--------------
LEU1_RALEJ      ----------------------------------------------------------------------
FABI_BRANA      -------------GYGGGMSSAKAALESDTRVLAFEAGRKNIRVNTISAGPLGSRAAK-AIGFIDTMIEY
MKAR_YEAST      ILTMGSFGGLIPTPLLATYSGSKSFLQGWSNSLAGELSKDAIDVELI-----------------------


                         .         .         .         +         .         .         .:280
query           SEEQARAELAARNPQRRLVRPDEVADAVAWLCQPSASAITGQAVPVAGGEVMAG
ACT3_STRCO      STEEAFDRITARVPIGRYVQPSEVAEMVAYLIGPGAAAVTAQALNVCGG-----
HCDS_XANP2      PELEARR--LAKYPMGRFGTPEDIAEAAVFLLSTKAAFVTGSVLAVDGG-----
NODG_AZOBR      IREDIRQAITDSVPMKRLGRPDEIGGAVSYLASEIAGYVTGSTLNINGG-----
BDHA_RHIME      TEEQVINEVMLKQPTKKFITVEQVASLALYLAGDDAAQITGTHVSMDGG-----
YXJF_BACSU      VPYDSVLEIFPLVPQKRLLSVKEIADYAVFLASEKAKGVTGQAVVLDGG-----
BDHA_RALEH      PVEQAKRELVEKQPSGQFVTPDELGALAVFLSSEAARQVRGAIWNMDGGWV---
BACC2_BACSU     TLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGG-----
BACC_BACSU      TLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGG-----
FABG_AQUAE      LSEEIKQKYKEQIPLGRFGSPEEVANVVLFLCSELASYITGEVIHVNGG-----
DHKR_STRCM      TEEAILTKFQAKIPLGRYSTPEEVAGLIGYLASDTAASITSQALNVCGG-----
DHK1_STRVN      SEEETFDRITNRVPLGRYVETREVAAMVEYLXXXXXXXXXXXXLNVCGG-----
FABG1_SYNY3     -------PILQFIPLARYGQPEEVAGTIRFLADPAAAYITGQTFNVDGGMVM--
FABG_MYCS2      LDERIQAGALDFIPAKRVGTAEEVAGAVSFLASEDASYIAGAVIPVDGG-----
PHBB_CHRVI      MNDDVRNSIISGIPMRRMAQPNEIAAAIAFLAGDESGYMTGANLPVNGGLFM--
FABG_MYCTU      LDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-----
FABG_MYCBO      LDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGG-----
FABG_MYCAV      LDERIQAGALEFIPAKRVGTAAEVPGAVSFLASEDASYIAGAVIPVDGG-----
PHBB_RALEH      --------IVATIPVKRLGLPEEIASICAWLSSEESGFSTGADFSLNGG-----
FABG_STAAW      LSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM--
FABG_STAAS      LSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM--
FABG_STAAR      LSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM--
FABG_STAAN      LSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM--
FABG_STAAM      LSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM--
FABG_STAAC      LSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM--
PHBB_RHIME      -------RIIPQIPVGRLGEPEEVARCVVFLASDDAGFITGSTISANGGQYFA-
FABG_VIBHA      LNDDQRAATLSNVPAGRLGDPREIASAVVFLASPEAAYITGETLHVNGGMYM--
FABG_CUPLA      LGDDINKKILETIPLGRYGQPEEVAGLVEFLANPASSYVTGQVFTIDGGMTM--
BUDC_KLEPN      PLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMV---
LVR_LEIAQ       ---KAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSAA-
PHBB_ZOORA      -------RIIPQIPVGRLGEPDEIARIVVFLASDEAGFITGSTISANGGQ----
FABG_SHIFL      SDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM--
FABG_ECOLI      SDDQ-RAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGMYM--
NODG_RHIS3      LNDKQKEAIMAAIPTRRMGTSVEVASAVAYLASNEAAYVTGQTIHVNGGLAM--
FABG_BACSU      LAKDVQDEMLKQIPLARFGEPSDVSSVVTFLASEGARYMTGQTLHIDGGMVM--
FABG_PSEAE      -PEAQREALLGQIPLGRLGQAEEIAKVVGFLASDGAAYVTGATVPVNGGMYMS-
HCDR_XANP2      DQPELRDQVLARIPQKEIGTAAQVADAVMFLAGEDATYVNGAALVMDG------
FABG_VIBCH      NDEQRTATL-AQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYM--
UCPA_SALTY      PDESVLTEMAKAIPLRRLADPLEVGELAAFLASDESSYLTGTQNVIDGGSTL--
UCPA_SALTI      PDESVLTEMAKAIPLRRLADPLEVGELAAFLASDESSYLTGTQNVIDGGSTL--
BACC_BACAM      TLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGG-----
FABG_STAES      LSDDLKDQMLEQIPLKRFGEDTDIANTVAFLASDKAKYITGQTIHVNGGMYM--
FABG_STAEQ      LSDDLKDQMLEQIPLKRFGEDTDIANTVAFLASDKAKYITGQTIHVNGGMYM--
UCPA_ECOLI      PEESVLTEMAKAIPMRRLADPLEVGELAAFLASDESSYLTGTQNVIDGGSTL--
PHAB_PARDE      DEKVLNEGIIPQIPVAAWAEPEEIARCVVFLASEDAGFITGSTHQAPNG-----
FABG_RICPR      LNEKQREAIVQKIPLGTYGIPEDVAYAVAFLASNNASYITGQTLHVNGGMLM--
NODG_RHIME      LNHKQKEKIMVAIPIHRMGTGTEVASAVAYLASDHAAYVTGQTIHVNGGMAM--
UCPA_ECO57      PEESVLTEMAKAIPLRRLADPLEVGELAAFLASDESSYLTGTQNVIDGGSTL--
FABG_RICTY      LNEKQREAIVQKIPLGTYGIPEDVAYAVAFLASNHASYITGQTLHVNGGMLM--
FABG_RICBR      LNDEQKEAITRKIPKGTYGMPEDIANAVAFLASKQSSYITGQTLHVNGGMLM--
PHAB_ACISR      REDVIKS-IEAQIPLQRLAAPAEIAAAVMYLVSEHGAYVTGETLSINGGLYM--
YOHF_ECOLI      DDSDVKPDAEPSIPLRRFGATHEIASLVVWLCSEGANYTTGQSLIVDGGFMLA-
DHRS4_RABIT     QEENIIQKLRI----RRLGKPEECAGIVSFLCSEDASYITGETVVVAGG-----
FABG_BUCAP      ---QYKKHL-SKIPMKRIGTAEEIANAVIFLSSEKASYITGQTIHVNGGMYM--
FABG_HAEIN      LTDEQKAGILSNVPAGRLGEAKDIAKAVAFLASDDAGYITGTTLHVNGG-----
GNO_GLUOX       -DEEFTDWLCKRTPAGRWGQVEELVGAAVFLSSRASSFVNGQVLMVDGG-----
KDUD_BACSU      DDEKRNEDILKRIPAGRWGQADDIGGTAVFLASRASDYVNGHILAVDGG-----
FABG2_BRANA     LGEDMEKKILGTIPLGRYGQPEDVAGLVEFLASPAASYITGQAFTIDGG-----
LINC_PSEPA      ----LEPYLNSIHPIGRFSEPHEQAQAAVWLLSDAASFVTGSCLAADGG-----
FABG3_BRANA     LGEDMEKKILGTIPLGRYGQPEDVAGLVEFLASPAASYITGQAFTIDGG-----
FABG1_BRANA     LGEDMEKKILGTIPLGRYGQPEDVAGLVEFLASPAASYITGQAFTIDGG-----
Y4VI_RHISN      LDVSA---IRRRVPLGRIARPDEIARAVRFLASAQASYITGSTLVVDGG-----
PECR_HUMAN      SFFEGSFQ---KIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGG-----
HSD_STREX       RQGEGN---YPNTPMGRVNEPGEIAGAVVKLLSDTSSYVTGAELAVDGG-----
PECR_RAT        ---QTMFEMAFENPAKRVGLPEEISPLVCFLLSPAASFITGQLINVDGGQAL--
HSD_MYCTU       G---------------RAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTV---
HSD_MYCBO       G---------------RAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTV---
FABG_SALTY      SDDQ-RAGILAQVPAGRLGGAQEIASAVAFLASDEASYITGETLHVNGGMYM--
FABG_SALTI      SDDQ-RAGILAQVPAGRLGGAQEIASAVAFLASDEASYITGETLHVNGGMYM--
LIMC_RHOER      NPTREDFEIASTTTNAPWVESVDVSNALLFLVSEDARYITGAAIPVDAGTTL--
PECR_MOUSE      ---QTLFEMAFDSPAKRLGVPEEISPLVCFLLSPAASYITGQLINVDGGQAL--
BAIA1_EUBSP     ------EDYLKTLPMKRMLKPEEIANVYLFLASDLASGITATTISVDG------
Y1385_MYCBO     IWDQKLAEV----PMGRAGEPSEVASVAVFLASDLSSYMTGTVLDVTGG-----
Y1350_MYCTU     IWDQKLAEV----PMGRAGEPSEVASVAVFLASDLSSYMTGTVLDVTGG-----
DHSO_RHOSH      PRGEKKRQVGAAVPFGRMGRAEDLTGMAIFLATPEADYIVAQTYNVDGGNWMS-
BAIA2_EUBSP     PPEIMEGYLKAL-PMKRMLEPEEIANVYLFLASDLASGITATTVSVDG------
YXBG_BACSU      MGEQFREANKWITPLGRLGQPKEMATVALFLASDDSSYVTGEDITADGG-----
FIXR_BRAJA      -SPDAEARVVASIPLRRVGTPDEVAKVIFFLCSDAASYVTGAEVPINGGQ----
FABG4_BRANA     LGEDMEKKILGTIPLGRYGQPEDVAGLVEFLASPAASYITGQTFTIDGG-----
IDNO_ECOLI      EDEAFTAWLCKRTPAARWGDPQELIGAAVFLSSKASDFVNGHLLFVDGGMLVA-
IDNO_ECOL6      EDEAFTAWLCKRTPAARWGDPQELIGAAVFLSSKASDFVNGHLLFVDGGMLVA-
FABG_THEMA      LPEKARETALSRIPLGRFGKPEEVAQVILFLASDESSYVTGQVIGIDGGLVI--
FABG_ARATH      LGEDMEKKILGTIPLGRYGKAEEVAGLVEFLASPAASYITGQAFTIDGG-----
BUTA_STAAW      PEAWGWEQFTSQIALGRVSQPEDVSNVVSFLAGKDSDYITGQTIIVDGG-----
BUTA_STAAS      PEAWGWEQFTSQIALGRVSQPEDVSNVVSFLAGKDSDYITGQTIIVDGG-----
BUTA_STAAR      PEAWGWEQFTSQIALGRVSQPEDVSNVVSFLAGKDSDYITGQTIIVDGG-----
BUTA_STAAN      PEAWGWEQFTSQIALGRVSQPEDVSNVVSFLAGKDSDYITGQTIIVDGG-----
BUTA_STAAM      PEAWGWEQFTSQIALGRVSQPEDVSNVVSFLAGKDSDYITGQTIIVDGG-----
BUTA_STAAC      PEAWGWEQFTSQIALGRVSQPEDVSNVVSFLAGKDSDYITGQTIIVDGG-----
PECR_PONAB      SFFE---ESFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGG-----
FABG_CHLMU      -----KNEWLKGVPLGRVGTPEEIAMAALFLASNQSSYITGQVLSVDGG-----
DHB8_HUMAN      --------ITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM--
DHB8_CANFA      --------VIGMIPMGHLGDPEDVADAVTFLASEDSGYITGASVEVTGGLYM--
PECR_CAVPO      ----LFADAFQKIPAKRLGVPEEVSSLVCFLLSPAASFITGQLVNVDGGQ----
HDHA_ECOLI      --PEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGV---
HDHA_ECO57      --PEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGV---
FABG_CHLTR      -----KNEWLKGVPLGRVGMPEEIAKAALFLASDGSSYITGQVLSVDGG-----
YGFF_ECOLI      VD-----RVKSNIPMQRGGQAEEVAQAIVWLLSDKASYVTGSFIDLAGGK----
FABG5_BRANA     LGEDMEKKILGTIPLGRYGQPEYVAGLVEFLASPASSYITGHTFSIHGG-----
CMTB_PSEPU      ------PELAQRIPMGRVGEIEEVASMVGYLAQPEAAFVTGQVISVNGGSTM--
CMTB_PSEP1      ------PELAQRIPMGRVGEIEEVASMVGYLAQPEAAFVTGQVISVNGGSTM--
FABG_RICFE      LNEKQREAIVQKIPLGTYGMPEDVANAVAFLASDQASYITGQTIHVNGGMLM--
DHRS4_BOVIN     RQESIKATFQI----KRIGKPEECAGIVSFLCSEDASYITGETVVVAGGSL---
FABG_BUCBP      LSQKQLSKYLSKIPMKRLGTIKEISKITLFLISNDANYITGQVIHVNGGMYM--
FABG_BUCAI      IQYQ---KYLSNIPMKRFGQKEEVADAVIFLASKKASYITGHTLHVNGGMYM--
DHG_BACSU       -DPKQKADVESMIPMGYIGEPEEIAAVAAWLASKEASYVTGITLFADGG-----
DHG2_BACME      -DPEQRADVESMIPMGYIGKPEEIASVAAFLASSQASYVTGITLFADGG-----
FABG_RICCN      LNEKQREAIVQKIPLGTYGMPEDVAHAVAFLASDQASYITGQTIHVNGGMLM--
YVAG_BACSU      TVQEAEARFMKENRPQRLIRPEEIAHFVTFLSSPLSSAINGAALRADGGLV---
YMFI_BACSU      AEKE---EIADEIPIGRLARPQEIADATAFLLSEKASYITGQILSVNGG-----
Y2146_BRAJA     LDACMQTHLRRHQLLPRVGRPEDVAALVAFLLSDDAAFITGQVVCIDGG-----
MOAE_KLEAE      SLTEAYQRVCRDVPLRRPASPEEIAQACQFLCSPQAAIISGATLVADGG-----
DHRS7_HUMAN     NGDQSHKMTTSR------------------------------------------
Y4LA_RHISN      CMQR---HLSRHQLLPRVGHPEDVAALVAFLLSDDASFITGQVVCIDGG-----
KDUD_ECOLI      ADEQRSAEILDRIPAGRWGLPSDLMGPIVFLASSASDYVNGYTIAVDGG-----
Y325_THEMA      NPEELLKKMTSRIPMKRLGKXXXXXXXXXXXXCDEAGFMTGSIINIDGG-----
DCXR_BOVIN      SDPQKAKAMLDRIPLGRFAEVENVVDTILFLLSDRSSMTTGSTVPVDGG-----
Y2403_STAAW     ---------AAYNPDRKKLDPQDIAEAVLYLTQPS-------------------
Y2370_STAAS     ---------AAYNPDRKKLDPQDIAEAVLYLTQPS-------------------
FABG_CHLPN      LNDNLKAEWLKSIPLGRAGTPEDVARVALFLASQLSSYMTAQTLVVDGG-----
Y2778_STAA8     ---------AAYNPDRKKLEPQDIAEAVLYLTQP--------------------
Y2488_STAAC     ---------AAYNPDRKKLEPQDIAEAVLYLTQP--------------------
Y2422_STAA3     ---------AAYNPDRKKLEPQDIAEAVLYLTQP--------------------
YVRD_BACSU      DTDTFIKDYFKVNEPTSLIQAEEVANTIVFLASDAASAINGTAQRVEGG-----
YLX6_SCHPO      KHPDVGDRMKRWYPVGRLGTPEDVARAVIFLADSKNSFITGTTLYVDGG-LLAG
CBR2_PIG        SDPELARKLKERHPMRKFAEVEDVVNSILFLLSDRSASTSGSSIFVDAG-----
NOG4_RHIME      LNHKQKEKIMVAIPIHRMGTGTEVASAVAYLASDHAAYVTGQTIHVNGGMAM--
FABG2_SYNY3     IREDIREKITKEIPFRRFGKPEEIAWAVAFLLSPVASSVTGEVLRVNG------
CBR4_DANRE      AEEAAVRTI----PLGRFGEPAEVAQAMLFLLE--SPYITGQILLVDGG-----
Y2478_STAAM     ---------AAYNPDRKKLDPQDIAEAVLYLTQP--------------------
Y2266_STAAN     ---------AAYNPDRKKLDPQDIAEAVLYLTQP--------------------
SRLD_ECOLI      KPDQVEQYYIDKVPLKRGCDYQDVLNMLLFYASPKASYCTGQSINVTGGQVM--
YTKK_BACSU      SIEEARMRIGEKTPIGRSGTGEDIARIIAFLCEENSDLVTGTVIEATGG-----
Y019_THEMA      KKPDLRPIDHEQHPAGRVGNPLDIAHLCVFLADEKAGFITGTNFIVDGG-----
Y2049_STAEQ     TDFGERKKLEAQN----------IADAVVYLTQPS-------------------
Y2036_STAES     TDFGERKKLEAQN----------IADAVVYLTQPS-------------------
CBR4_XENTR      EED----SLTKMVPLGRFGDPEEVAQSVLFLLE--SPYITGHVLVVDGG-----
DHGB_BACME      -DPEQRADVESMIPMGYIGEPEEIA-AVAWLASSEASYVTGITLFADGG-----
DHB11_MACFA     EEVVNRLMNGILTEQKMIFSPSSIA-----------------------------
BUDC_KLETE      ------------------------------------------------------
TRNH_DATST      SQKKNIESLIGRAPMKRAGEPSEVSSLVTYLCLPTASYITGQIICVDGGYTVNG
DHRS4_MOUSE     -EEKAREDFIKEAMQRRLGKPEDCAGIVSFLCSEDASYINGETVVVGGG-----
Y2567_STAAR     ---------ATYNPDRKKLEPQDIAEAVLYLTQP--------------------
CPNA_COMTE      APQSARA-LLGPTLLGRAAQPMEVSQAVLFLVSDEASFVHGSELVVDGG-----
CPNA_COMS9      APQSARA-LLGPTLLGRAAQPMEVSQAVLFLVSDEASFVHGSELVVDGG-----
DHRS7_MOUSE     N----NIDQSYKMPTSRCVR----------------------------------
DHB11_RAT       PEE---------------------------------------------------
BUTA_STAES      SLEDAFEAFSSEIKLGRYQEPSDVANLVSFLASNDSDYITGQSILTDGGLV---
BUTA_STAEQ      SLEDAFEAFSSEIKLGRYQEPSDVANLVSFLASNDSDYITGQSILTDGGLV---
YGCW_ECOLI      SNPETNQRVLDHIPANRWGDTQDLMGAAVFLASPASNYVNGHLLVVDGG-----
XYLL_PSEPU      QEKVWYQQIVDQSLDSSLMKRDEQVEAILFLASDAASYITGITLPVAGGDL---
DHB11_PONAB     PEE---------------------------------------------------
YQJQ_BACSU      ---------YAKNVGRWMLDPDDVA-----------------------------
YOXD_BACSU      ------------------------------------------------------
CBR4_BOVIN      ----LNEELLKKNPLGRFGDALDVAQAAVFLLE--SPYVTGHVLVVDGG-----
YUSZ_BACSU      ------------------------------------------------------
RHLG_PSEAE      -DPQALEADSASIPMGRWGRPEEMAALAISLAGTAGAYMTGNVIPIDGG-----
HETN_ANASP      ------------------------------------------------------
DHB11_HUMAN     PEE---------------------------------------------------
DER_CHICK       SDPQKSAAMINRIPLGKFAEVDDVVNSILFLLSDKSAMTTGSSLMVDGG-----
FABG6_BRANA     LGEDMEKKILGTIPLGRYGQPEDVAGLVEFLASPAASYITGQTFTIDGG-----
DRS7B_DANRE     ------------------------------------------------------
DHB11_MOUSE     PEE---------------------------------------------------
TRN1_DATST      HQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGG-----
PGDH_CAVPO      ------------------------------------------------------
DHRS4_RAT       --EKAREEMIKETMQRRLGKPEDCVGIVSFLCSEDASYINGETVVVGGG-----
DHG3_BACME      ----QRADVESMIPMGYIGKPEEVXXXXXXXXXXXXXYVTGITLFADGG-----
FADH_BACSU      AEEKAMARTMNSVPLGRLGTPEEIAALAAFLLSDEASYINGDCITMDGGQ----
DHGA_BACME      -DPEQRADVESMIPMGYIGKPEEVXXXXXXXXXXXXXYVTGITLFADGG-----
DHG4_BACME      ----QRADVESMIPMGYIGKPEEVXXXXXXXXXXXXXYVTGITLFADGG-----
FOX2_NEUCR      PEELVQA-----------FKPDYVAPLVLALC----------------------
FOX2_CANTR      HAETAMTLTIFREQDKNLYHADQVAPLLVYLGTDDV-PVTGETFEIGGG-----
TRN2_DATST      EQKENLNKLIDRCALRRMGEPKELAAMVAFLCFPAASYVTGQIIYVDGG-----
PGDH_MACFA      ------------------------------------------------------
PGDH_HUMAN      ------------------------------------------------------
DRS7B_PONAB     ------------------------------------------------------
DCXR_CAEEL      SDPDKKKKMLDRMPIKRFAEVDEVVNAVLFLLSDNASMTTGSTLPVDGG-----
Y182_METEA      AGSEMEAGLVAQT