[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF09387.1

[Show Plain Result]


## Summary of Sequence Search
    1::209
    8::191     2e-21  30%  195 aa  EAMB_SALTI RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     2e-21  30%  195 aa  EAMB_SALPA RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     9e-21  29%  195 aa  EAMB_SALTY RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     9e-21  29%  195 aa  EAMB_SALCH RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     5e-20  29%  195 aa  EAMB_ECO24 RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     6e-20  28%  195 aa  EAMB_SHISS RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     6e-20  28%  195 aa  EAMB_SHIFL RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     6e-20  28%  195 aa  EAMB_SHIF8 RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     6e-20  28%  195 aa  EAMB_ECOUT RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     6e-20  28%  195 aa  EAMB_ECOLI RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     6e-20  28%  195 aa  EAMB_ECOL6 RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     6e-20  28%  195 aa  EAMB_ECOL5 RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     6e-20  28%  195 aa  EAMB_ECOK1 RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     6e-20  28%  195 aa  EAMB_ECOHS RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     3e-19  28%  195 aa  EAMB_ECO57 RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::191     5e-19  28%  195 aa  EAMB_SHIBS RecName: Full=Cysteine/O-acetylserine efflux protein;
    8::132     1e-15  29%  196 aa  EAMB_KLEP7 RecName: Full=Cysteine/O-acetylserine efflux protein;
   10::165     9e-10  33%  212 aa  LEUE_KLEP7 RecName: Full=Leucine efflux protein;
   24::165     5e-08  27%  212 aa  LEUE_ECOLI RecName: Full=Leucine efflux protein;
   24::165     5e-08  27%  212 aa  LEUE_ECOHS RecName: Full=Leucine efflux protein;
   24::98      2e-07  32%  212 aa  LEUE_SHISS RecName: Full=Leucine efflux protein;
   24::98      2e-07  32%  212 aa  LEUE_SHIDS RecName: Full=Leucine efflux protein;
   24::98      2e-07  32%  212 aa  LEUE_ECOUT RecName: Full=Leucine efflux protein;
   24::98      2e-07  32%  212 aa  LEUE_ECOL6 RecName: Full=Leucine efflux protein;
   24::98      2e-07  32%  212 aa  LEUE_ECOL5 RecName: Full=Leucine efflux protein;
   24::98      2e-07  32%  212 aa  LEUE_ECOK1 RecName: Full=Leucine efflux protein;
   24::98      2e-07  32%  212 aa  LEUE_ECO24 RecName: Full=Leucine efflux protein;
    3::77      2e-07  32%  191 aa  LEUE_SHIBS RecName: Full=Putative leucine efflux protein;
   24::98      3e-07  31%  212 aa  LEUE_ECO57 RecName: Full=Leucine efflux protein;
   15::198     7e-07  28%  211 aa  LEUE_ENT38 RecName: Full=Leucine efflux protein;
    3::94      1e-06  30%  210 aa  Y1307_HAEIN RecName: Full=Uncharacterized membrane protein HI1307;
   23::191     2e-06  25%  216 aa  Y4757_PSEAE RecName: Full=Uncharacterized membrane protein PA4757;
   56::215     1e-05  28%  220 aa  YISU_BACSU RecName: Full=Putative amino-acid transporter yisU;
    3::86      1e-05  31%  206 aa  RHTB_SHIFL RecName: Full=Homoserine/homoserine lactone efflux
    3::86      1e-05  31%  206 aa  RHTB_ECOLI RecName: Full=Homoserine/homoserine lactone efflux
    3::86      1e-05  31%  206 aa  RHTB_ECOL6 RecName: Full=Homoserine/homoserine lactone efflux
    3::86      1e-05  31%  206 aa  RHTB_ECO57 RecName: Full=Homoserine/homoserine lactone efflux
    5::91      5e-05  24%  206 aa  RHTC_SALTY RecName: Full=Threonine efflux protein;
    5::91      5e-05  24%  206 aa  RHTC_SALTI RecName: Full=Threonine efflux protein;
   28::205     3e-04  28%  211 aa  ARGO_SHIFL RecName: Full=Arginine exporter protein argO;
   28::205     3e-04  28%  211 aa  ARGO_ECO57 RecName: Full=Arginine exporter protein argO;
  810::872     3e-04  32%  881 aa  SYE_TRIEI RecName: Full=Glutamyl-tRNA synthetase;       
   24::117     5e-04  27%  223 aa  YAHN_ECOLI RecName: Full=Uncharacterized membrane protein yahN;
    1::209

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEAWLTGLSTAQFLALVTLLAVGAFTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGA
EAMB_SALTI      --------------AFWTYTLITALTPGPNNILALSAATAHGFRQSIRVLAGMSLGFLVVMLLCAGIAFS
EAMB_SALPA      --------------AFWTYTLITALTPGPNNILALSAATAHGFRQSIRVLAGMSLGFLVVMLLCAGIAFS
EAMB_SALTY      --------------AFWTYTLITALTPGPNNILALSAATAHGFRQSIRVLAGMSLGFLVVMLLCAGIAFS
EAMB_SALCH      --------------AFWTYTLITALTPGPNNILALSAATAHGFRQSIRVLAGMSLGFLVVMLLCAGIAFS
EAMB_ECO24      --------------AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_SHISS      --------------AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_SHIFL      --------------AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_SHIF8      --------------AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_ECOUT      --------------AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_ECOLI      --------------AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_ECOL6      --------------AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_ECOL5      --------------AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_ECOK1      --------------AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_ECOHS      --------------AFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_ECO57      --------------AFWTYTLITAMTPGPNNILALSSATTHGFHQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_SHIBS      --------------AFWTYTLITAMTPRPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGISFS
EAMB_KLEP7      --------------AFLTYTLITALTPGPNNILALSSVTSHGLRRSLRVLAGMSVGFIITMLICAALTFS
LEUE_KLEP7      ---YLTYLVGAVFIILV---------PGPNTFFVLKTGIAHGVKKGYLAAAGVFIGDAVLMFLAFAGVAT
LEUE_ECOLI      --------------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVAT
LEUE_ECOHS      --------------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVAT
LEUE_SHISS      --------------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVAT
LEUE_SHIDS      --------------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVAT
LEUE_ECOUT      --------------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVAT
LEUE_ECOL6      --------------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVAT
LEUE_ECOL5      --------------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVAT
LEUE_ECOK1      --------------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVAT
LEUE_ECO24      --------------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVAT
LEUE_SHIBS      --------------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGVAT
LEUE_ECO57      --------------------------PGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFLAWAGMAT
LEUE_ENT38      ---------------------VGAFVPGPNTLFVLKTGIGHGVKKGYLAATGVFIGDAVLMFLAWAGVAA
Y1307_HAEIN     -------------LNLIIVHLFGLMTPGPDFFYVSRMAASNSRRNTVCGILGITLGIAFWGMLSMLGLAV
Y4757_PSEAE     --------------------------PGPNSLFVLATSAQRGVATGYRAACGVFLGDAVLMLLSALGVAS
YISU_BACSU      ----------------------------------------------LPAVISASVCDTLLIVLAVAGVSV
RHTB_SHIFL      LEWWFAYLLTSIILSL---------SPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVGLGT
RHTB_ECOLI      LEWWFAYLLTSIILSL---------SPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVGLGT
RHTB_ECOL6      LEWWFAYLLTSIILSL---------SPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVGLGT
RHTB_ECO57      LEWWFAYLLTSIILSL---------SPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVGLGT
RHTC_SALTY      ------------FFTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGVALLGLHL
RHTC_SALTI      ------------FFTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGVALLGLHL
ARGO_SHIFL      ---------------------------------------NQGIRRQYHIMIALLCAISDLVLICAGGGSA
ARGO_ECO57      ---------------------------------------NQGIRRQYHIMIALLCAISDLVLICAGGGSA
SYE_TRIEI       ------------------------------------------------------FGWLALVILTFTFMAV
YAHN_ECOLI      ----------------VGLFVITFFNPGANLFVVVQTSLASGRRXXXXXXXXXXXXDAFYSGLGLFGLAT


                         .         .         *         .         .         .         .:140
query           LILASPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAVAASYMA
EAMB_SALTI      LAVIDPAIIHLLSWVGAAYILWLAWKIATSPAADEKVRPKPVGFWVSFGLQFVNVKIILYGITALSTFVL
EAMB_SALPA      LAVIDPAIIHLLSWVGAAYILWLAWKIATSPAADEKVRPKPVGFWVSFGLQFVNVKIILYGITALSTFVL
EAMB_SALTY      LAVIDPAIIHLLSWVGAAYILWLAWKIATSPAADENARPKPVGFWVSFGLQFVNVKIILYGITALSTFVL
EAMB_SALCH      LAVIDPAIIHLLSWVGAAYILWLAWKIATSPAADENARPKPVGFWVSFGLQFVNVKIILYGITALSTFVL
EAMB_ECO24      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_SHISS      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_SHIFL      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_SHIF8      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_ECOUT      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_ECOLI      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_ECOL6      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_ECOL5      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_ECOK1      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_ECOHS      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_ECO57      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQTKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_SHIBS      LAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKIILYGVTALSTFVL
EAMB_KLEP7      LVELDSRFTLVLGWIGAAYILWLAWQIAKSKPATGTPSVEPVGFWASLGLQFVNVKIILYGITALSTFV-
LEUE_KLEP7      LIKTTPVLFNVVRYLGAIYLLWLTQRDGQSDASAESAILK-----RSLTLSLTNPKAILFYVSFFVQFIV
LEUE_ECOLI      LIKTTPILFNIVRYLGAFYLLYLGSKILYATLKGKNSEAKSDEPQYGAILSLTNPKAILFYVSFFVQFIV
LEUE_ECOHS      LIKTTPILFNIVRYLGAFYLLYLGSKILYATLKGKNSEAKSDEPQYGAILSLTNPKAILFYVSFFVQFIV
LEUE_SHISS      LIKTTPILFNIVRYLGAFYLLYLGSKILYAT---------------------------------------
LEUE_SHIDS      LIKTTPILFNIVRYLGAFYLLYLGSKILYAT---------------------------------------
LEUE_ECOUT      LIKTTPILFNIVRYLGAFYLLYLGSKILYAT---------------------------------------
LEUE_ECOL6      LIKTTPILFNIVRYLGAFYLLYLGSKILYAT---------------------------------------
LEUE_ECOL5      LIKTTPILFNIVRYLGAFYLLYLGSKILYAT---------------------------------------
LEUE_ECOK1      LIKTTPILFNIVRYLGAFYLLYLGSKILYAT---------------------------------------
LEUE_ECO24      LIKTTPILFNIVRYLGAFYLLYLGSKILYAT---------------------------------------
LEUE_SHIBS      LIKTTPILFNIVRYLGAFYLLYLESKILYAT---------------------------------------
LEUE_ECO57      LIKTTPILFNIVRYLGAFYLLYLGSKILYAT---------------------------------------
LEUE_ENT38      LIQTTPVLFNIVRXXXXXXMLWSVIMRKNSAHAGSSTILK-----RSLVLSLTNPKAILFYVSFFVQFIV
Y1307_HAEIN     LFVTIPALHGVIMLLGGSYLAYLGFLMARSKKYAK-----------------------------------
Y4757_PSEAE     LLKAEPMLFIGLKYLGAAYLFWRKLRNPEATAAQAEQVDVHQPFRKALLLSLSNPKAILFFISFFIQFVP
YISU_BACSU      IVQELPVFETVMMAGGFLFLLWVTWNIRPNTSQNEKAILDTIGVIGTSSLQYSGLEKWLISLAIAGRLFQ
RHTB_SHIFL      LFSRSVIAFEVLKWAGAAYLIWL-----------------------------------------------
RHTB_ECOLI      LFSRSVIAFEVLKWAGAAYLIWL-----------------------------------------------
RHTB_ECOL6      LFSRSVIAFEVLKWAGAAYLIWL-----------------------------------------------
RHTB_ECO57      LFSRSVIAFEVLKWAGAAYLIWL-----------------------------------------------
RHTC_SALTY      IIEKMAWLHTIIMVGGGLYLCWMGYQMLR-----------------------------------------
RHTC_SALTI      IIEKMAWLHTIIMVGGGLYLCWMGYQMLR-----------------------------------------
ARGO_SHIFL      LLMQSPWLLALVTWGGVVFLLWYAFKTAMSSNLASAEVLK-QGRWKMLAVTWLNPHVYLDTFVVLGSLGG
ARGO_ECO57      LLMQSPWLLALVTWGGVVFLLWYAFKTAMSSNLASAEVLK-QGRWKMLAVTWLNPHVYLDTFVVLGSLGG
SYE_TRIEI       VIEALPILSIIFELIGVIYLVWFVYRYLLKRSNRQELLDKIENI--------------------------
YAHN_ECOLI      LITQCEEIFSLIRIVGGAYLLWFAWCSMRRQSTPQMSTLQ------------------------------


                         +         .         .         .         .         *         .:210
query           GAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLALALTAIWIAVAGQPH
EAMB_SALTI      PQTQALNWVIGVSILLALIGTFGNVCWALAGHLFQR------AFRHYGRQLNIILALLLVYCAV-----
EAMB_SALPA      PQTQALNWVIGVSILLALIGTFGNVCWALAGHLFQR------AFRHYGRQLNIILALLLVYCAV-----
EAMB_SALTY      PQTQALNWVIGVSILLALIGTFGNVCWALAGHLFQR------AFRHYGRQLNIILALLLVYCAV-----
EAMB_SALCH      PQTQALNWVIGVSILLALIGTFGNVCWALAGHLFQR------AFRHYGRQLNIILALLLVYCAV-----
EAMB_ECO24      PQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLIYCAV-----
EAMB_SHISS      PQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLVYCAV-----
EAMB_SHIFL      PQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLVYCAV-----
EAMB_SHIF8      PQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLVYCAV-----
EAMB_ECOUT      PQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLVYCAV-----
EAMB_ECOLI      PQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLVYCAV-----
EAMB_ECOL6      PQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLVYCAV-----
EAMB_ECOL5      PQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLVYCAV-----
EAMB_ECOK1      PQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLVYCAV-----
EAMB_ECOHS      PQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLVYCAV-----
EAMB_ECO57      PQTQALSWIVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLIYCAV-----
EAMB_SHIBS      PQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLF------RQYGRQLNIVLALLLVYCAV-----
EAMB_KLEP7      ---------------------------------------------------------------------
LEUE_KLEP7      NAKTPGVAFFILALTLEVISF------------------------------------------------
LEUE_ECOLI      NAPHTGISFFILAATLELVSF------------------------------------------------
LEUE_ECOHS      NAPHTGISFFILAATLELVSF------------------------------------------------
LEUE_SHISS      ---------------------------------------------------------------------
LEUE_SHIDS      ---------------------------------------------------------------------
LEUE_ECOUT      ---------------------------------------------------------------------
LEUE_ECOL6      ---------------------------------------------------------------------
LEUE_ECOL5      ---------------------------------------------------------------------
LEUE_ECOK1      ---------------------------------------------------------------------
LEUE_ECO24      ---------------------------------------------------------------------
LEUE_SHIBS      ---------------------------------------------------------------------
LEUE_ECO57      ---------------------------------------------------------------------
LEUE_ENT38      SATNTGTSFLILATTLELISFMYMSFLIFSGAFVTRYLKTKKKLKLGNGLIGL----------------
Y1307_HAEIN     ---------------------------------------------------------------------
Y4757_PSEAE     GYAYPGLSFLVLAVILELVSALYLSFLIFTGVRLAAWFRRRQRL-------------------------
YISU_BACSU      TIDTSGRLMLIVNKCSAAVMWAAAGYFGV----------------------------------------
RHTB_SHIFL      ---------------------------------------------------------------------
RHTB_ECOLI      ---------------------------------------------------------------------
RHTB_ECOL6      ---------------------------------------------------------------------
RHTB_ECO57      ---------------------------------------------------------------------
RHTC_SALTY      ---------------------------------------------------------------------
RHTC_SALTI      ---------------------------------------------------------------------
ARGO_SHIFL      QLDVEPKRWFALGTISASFLWFFGLA--ILAAWLAPRLRTAKSQRIINLVVGCVMWFIALQLARDGIAH
ARGO_ECO57      QLDVEPKRWFALGTISASFLWFFGLA--ILAAWLAPRLRTAKSQRIINLVVGCVMWFIALQLARDGIAH
SYE_TRIEI       ---------------------------------------------------------------------
YAHN_ECOLI      ---------------------------------------------------------------------