[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF09433.1

[Show Plain Result]


## Summary of Sequence Search
    1::278
  144::409     3e-86  58%  424 aa  YI2A_ECOLX RecName: Full=Insertion element IS2A uncharacterized
   21::286     3e-86  58%  301 aa  INSD_ECOLX RecName: Full=Transposase insD for insertion element
   21::286     3e-86  58%  301 aa  INSD_ECOLI RecName: Full=Transposase insD for insertion element
   20::192     6e-50  57%  195 aa  Y4601_AGRT7 RecName: Full=Insertion element IS136 uncharacterized
   20::192     6e-50  57%  195 aa  Y4601_AGRT5 RecName: Full=Insertion element IS136 uncharacterized
   95::250     6e-10  28%  253 aa  T904_LACLA RecName: Full=Transposase for insertion sequence element
  907::991     1e-06  33% 1268 aa  YRD6_CAEEL RecName: Full=Uncharacterized protein K02A2.6;
   34::259     4e-06  23%  277 aa  YI71_BURM1 RecName: Full=Insertion element IS407 uncharacterized
  125::252     6e-06  28%  278 aa  TRA9_MYCTU RecName: Full=Putative transposase for insertion
  125::252     6e-06  28%  278 aa  TRA9_MYCTA RecName: Full=Putative transposase for insertion
  125::252     6e-06  28%  278 aa  TRA9_MYCBO RecName: Full=Putative transposase for insertion
   58::275     1e-05  25%  283 aa  INSK_ECOLI RecName: Full=Putative transposase insK for insertion
  255::354     2e-05  31%  362 aa  INTG_SPV1C RecName: Full=Putative integrase ORF3;
    1::58      1e-04  41%  159 aa  YI31_AGRT7 RecName: Full=Insertion element IS136 uncharacterized
  104::325     2e-04  27%  346 aa  YI61_XANEU RecName: Full=Insertion element IS476 uncharacterized
  328::403     6e-04  33%  581 aa  POL_MLVRK RecName: Full=Pol polyprotein;Contains:  RecName:
  943::1018    6e-04  33% 1196 aa  POL_MLVRD RecName: Full=Pol polyprotein;Contains:  RecName:
    1::278

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKTVCDVLGVARSAVAAKQARSSEWRDGRRARQYDDTALVAEIHELVAGLPTYGYRRVWALLRRSHELSG
YI2A_ECOLX      -------LRVSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVIGELPTYGYRRVWALLRRQAELDG
INSD_ECOLX      -------LRVSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVIGELPTYGYRRVWALLRRQAELDG
INSD_ECOLI      -------LRVSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVIGELPTYGYRRVWALLRRQAELDG
Y4601_AGRT7     ----------------------------------------------------------------------
Y4601_AGRT5     ----------------------------------------------------------------------
T904_LACLA      ----------------------------------------------------------------------
YRD6_CAEEL      ----------------------------------------------------------------------
YI71_BURM1      ---------------------------------HENEVLAARLVELAHERRRFGYRRLHALVERE-----
TRA9_MYCTU      ----------------------------------------------------------------------
TRA9_MYCTA      ----------------------------------------------------------------------
TRA9_MYCBO      ----------------------------------------------------------------------
INSK_ECOLI      ----------------------------------------------------YGYRRVTLSLHRE-----
INTG_SPV1C      ----------------------------------------------------------------------
YI31_AGRT7      MKAVADTLGVSRSNLIERLKGRSKPRGPYN--KAEDAELLPAIRRLVDQRPTYGYRRIAA----------
YI61_XANEU      -------------------------------------ALSARLVELAQTHRRFGYRRLHDLLRPEFP---
POL_MLVRK       ----------------------------------------------------------------------
POL_MLVRD       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ASPVNAKRVYRVMHDHQXXXXXXXXXXXXXXHDGRVAVDRSNTRWCSDGFEFRCDDGSPLRVTFALDCHD
YI2A_ECOLX      MPAINAKRVYRIMRQNALLLERKPAVPPSKRHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCD
INSD_ECOLX      MPAINAKRVYRIMRQNALLLERKPAVPPSKRHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCD
INSD_ECOLI      MPAINAKRVYRIMRQNALLLERKPAVPPSKRHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCD
Y4601_AGRT7     -------------------------------HDGKVMVMRSNLRWCSDGLEFACWNGEVIRLAFIIDAFD
Y4601_AGRT5     -------------------------------HDGKVMVMRSNLRWCSDGLEFACWNGEVIRLAFIIDAFD
T904_LACLA      -----------------------------------------NKVWLGDMTYIPTKEGT-LYLAVNIDVFS
YRD6_CAEEL      ----------------------------------------------------------------------
YI71_BURM1      GTHANHKRIYRLYREAGLAVRRRRKRQGVMIEREQLALPGANEVWSIDFVMDALSNGRRVKCLTVVDDFT
TRA9_MYCTU      -------------------------------------------------------------VAFVTDAYA
TRA9_MYCTA      -------------------------------------------------------------VAFVTDAYA
TRA9_MYCBO      -------------------------------------------------------------VAFVTDAYA
INSK_ECOLI      GKQINHKAVQRLMGTLSLKAAIKVKRYRSYRGEGQTAPNRPNEKWVTDVTEFAVN-GRKLYLSPVIDLFN
INTG_SPV1C      ----------------------------------------------------------------------
YI31_AGRT7      ----------------------------------------------------------------------
YI61_XANEU      --SVNHKKIYRLYEEAELXXXXXXXXXXPVGERQKLASSMPNDTWSMDFVFDALANARRIKCLTVVDDFT
POL_MLVRK       ----------------------------------------------------------------------
POL_MLVRD       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           REAISWAATTGGHSGDIVRDVMLAAVEQRFGAVQTEQTIEWLSDNGSAYIDHRTRSFARELGLEPLTTPV
YI2A_ECOLX      REALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAV
INSD_ECOLX      REALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAV
INSD_ECOLI      REALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAV
Y4601_AGRT7     REIIAWTAVANGISGSDVRDMMLEAVEKRFHATRAPHAIEHLSDNGSAYTARDTRLFAQALNLTPCFTPV
Y4601_AGRT5     REIIAWTAVANGISGSDVRDMMLEAVEKRFHATRAPHAIEHLSDNGSAYTARDTRLFAQALNLTPCFTPV
T904_LACLA      RKIVGWSMSSRMQD-KLVRDCFLQAC----GKEHPQPGLIVHTDQGSQYTSSRYQSTLRQVGAQSSMSRK
YRD6_CAEEL      -----------------------------------------ISDNGTQLTSHLFAQMCQSHGIEHKTSAV
YI71_BURM1      KEAVDIVVDHGISGLYVARALDRAARFRGYPAVRTDQ--------GPEFTSRALDQWAYANGVTLKLIQA
TRA9_MYCTU      RRILGWRVAS-----TMATSMVLDAIEQAIWTRQQEGVLDLKTDRGSQYTSIRFSERLAEAGIQPSVGAV
TRA9_MYCTA      RRILGWRVAS-----TMATSMVLDAIEQAIWTRQQEGVLDLKTDRGSQYTSIRFSERLAEAGIQPSVGAV
TRA9_MYCBO      RRILGWRVAS-----TMATSMVLDAIEQAIWTRQQEGVLDLKTDRGSQYTSIRFSERLAEAGIQPSVGAV
INSK_ECOLI      NEVISYSL-----SERPVMNMVENMLDQAFKKLNPHEHPVLHSDQGWQYRMRRYQNILKEHGIKQSMSRK
INTG_SPV1C      ------------------------------------------TDNGSEFINNYRNNFLTDKNILHQTTPV
YI31_AGRT7      ----------------------------------------------------------------------
YI61_XANEU      RESVDIAVDHGISGAYVVRLLDQAACFRGYPAVRT--------DNGPEFTSRAFIAWTQQHGIEHILIEP
POL_MLVRK       ------AFPTKHETAKIVTKKLLEEIFPRFGMPQVLGT-----DNGPAFVSQVSQSVAKLLGIDWKLHCA
POL_MLVRD       ------AFPTKHETAKIVTKKLLEEIFPRFGMPQVLGT-----DNGPAFVSQVSQSVAKLLGIDWKLHCA


                         .         .         .         +         .         .         .:280
query           RSPQSNGMAESFVKTMKRDYIAFMNKPDVPTALSQLTVAFEQYNDWHPHKALKYRSPREFRRAxxxxx
YI2A_ECOLX      RSPESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLR------
INSD_ECOLX      RSPESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLR------
INSD_ECOLI      RSPESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLR------
Y4601_AGRT7     ASPQSNGMSEAFVKTLKRDYIRISALPDAQTALRLIDGWIEDYNEIHPHSALKMASPRQFIRA-----
Y4601_AGRT5     ASPQSNGMSEAFVKTLKRDYIRISALPDAQTALRLIDGWIEDYNEIHPHSALKMASPRQFIRA-----
T904_LACLA      GNPYDNAMMESFYKTLKRELINDAHFETRAEATQEIFKYIEYYNTKRMHSGLDYKSPKDFEK------
YRD6_CAEEL      YYPRSNGAAERFVDTLKRGIAKIKGEGSVQQILNKFLISYRN----TPHSALNGSTPAE---------
YI71_BURM1      GKPTQNAYIESFNGKFRDECLNEHWFTTLAHARAVIAAWRQDYNEQRPHSALNYLAPSEF--------
TRA9_MYCTU      GSSYDNALAETINGLYKTELI----KPGKPRSIEDVELATARWVDWFNHRRL----------------
TRA9_MYCTA      GSSYDNALAETINGLYKTELI----KPGKPRSIEDVELATARWVDWFNHRRL----------------
TRA9_MYCBO      GSSYDNALAETINGLYKTELI----KPGKPRSIEDVELATARWVDWFNHRRL----------------
INSK_ECOLI      GNCLDNAVVECFFGTLKSECFYLDEFSNISELKDAVTEYIEYYNSRRISLKLKGLTPIEYR-------
INTG_SPV1C      RSPQSNGKIERFHQNYTKLFVFEEKILNAVSLQNKLNDYYYFYNFERVHKSLNFQTPFNF--------
YI31_AGRT7      --------------------------------------------------------------------
YI61_XANEU      GAPTQNAYIESFNGKFRDECLNEHWFTSLAQARDVIADWRRHYNQIRPHSSCGRIPPAQF--------
POL_MLVRK       YRPQSSGQVERMNRTIK---------------------------------------------------
POL_MLVRD       YRPQSSGQVERMNRTIK---------------------------------------------------