[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF09441.1

[Show Plain Result]


## Summary of Sequence Search
    1::634
    3::383     5e-83  46%  454 aa  RHLE_ECOLI RecName: Full=Putative ATP-dependent RNA helicase rhlE; 
    6::385     6e-82  43%  439 aa  SRMB_HAEIN RecName: Full=ATP-dependent RNA helicase srmB homolog;  
    4::364     1e-78  44%  528 aa  CSHA_BACHK RecName: Full=DEAD-box ATP-dependent RNA helicase cshA; 
    4::364     1e-78  44%  528 aa  CSHA_BACCZ RecName: Full=DEAD-box ATP-dependent RNA helicase cshA; 
    4::364     1e-78  44%  533 aa  CSHA_BACCR RecName: Full=DEAD-box ATP-dependent RNA helicase cshA; 
    4::364     1e-78  44%  525 aa  CSHA_BACC1 RecName: Full=DEAD-box ATP-dependent RNA helicase cshA; 
    4::364     1e-78  44%  528 aa  CSHA_BACAN RecName: Full=DEAD-box ATP-dependent RNA helicase cshA; 
    4::364     1e-78  44%  528 aa  CSHA_BACAH RecName: Full=DEAD-box ATP-dependent RNA helicase cshA; 
   18::389     5e-77  43%  444 aa  SRMB_ECOLI RecName: Full=ATP-dependent RNA helicase srmB;       
    4::364     7e-77  42%  467 aa  CSHA_GEOKA RecName: Full=DEAD-box ATP-dependent RNA helicase cshA; 
    5::365     3e-76  44%  494 aa  CSHA_BACSU RecName: Full=DEAD-box ATP-dependent RNA helicase cshA; 
  189::568     6e-76  44%  696 aa  DED1_PHANO RecName: Full=ATP-dependent RNA helicase DED1;       
  200::564     8e-76  45%  688 aa  DED1_CHAGB RecName: Full=ATP-dependent RNA helicase DED1;       
  189::559     8e-76  43%  681 aa  DED1_ASPCL RecName: Full=ATP-dependent RNA helicase ded1;       
  177::544     1e-75  44%  659 aa  DED1_COCIM RecName: Full=ATP-dependent RNA helicase DED1;       
  186::556     2e-75  43%  675 aa  DED1_ASPOR RecName: Full=ATP-dependent RNA helicase ded1;       
  157::524     2e-75  46%  623 aa  RH52C_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 52C; 
    5::365     7e-75  43%  487 aa  CSHA_BACLD RecName: Full=DEAD-box ATP-dependent RNA helicase cshA; 
   65::459     9e-75  46%  602 aa  RH52A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 52A; 
  190::560     9e-75  43%  676 aa  DED1_NEOFI RecName: Full=ATP-dependent RNA helicase ded1;       
  186::556     1e-74  43%  674 aa  DED1_ASPTN RecName: Full=ATP-dependent RNA helicase ded1;       
    5::333     1e-74  46%  629 aa  DEAD_SHIFL RecName: Full=Cold-shock DEAD box protein A;       
    5::333     1e-74  46%  629 aa  DEAD_ECOLI RecName: Full=Cold-shock DEAD box protein A;       
    5::333     1e-74  46%  629 aa  DEAD_ECOL6 RecName: Full=Cold-shock DEAD box protein A;       
    5::333     1e-74  46%  629 aa  DEAD_ECO57 RecName: Full=Cold-shock DEAD box protein A;       
    5::333     2e-74  46%  643 aa  DEAD_KLEPN RecName: Full=Cold-shock DEAD box protein A;       
  188::553     3e-74  43%  678 aa  DED1_SCLS1 RecName: Full=ATP-dependent RNA helicase ded1;       
  188::558     4e-74  43%  674 aa  DED1_ASPFU RecName: Full=ATP-dependent RNA helicase ded1;       
   77::469     7e-74  43%  515 aa  RRP3_NEUCR RecName: Full=ATP-dependent rRNA helicase rrp-3;        
  187::557     7e-74  43%  678 aa  DED1_ASPNC RecName: Full=ATP-dependent RNA helicase ded1;       
   10::373     7e-74  42%  563 aa  DEAD_MYCTU RecName: Full=Cold-shock DEAD box protein A homolog;    
  188::553     1e-73  43%  683 aa  DED1_BOTFB RecName: Full=ATP-dependent RNA helicase ded1;       
  160::526     2e-73  44%  618 aa  DED1_YARLI RecName: Full=ATP-dependent RNA helicase DED1;       
  193::553     3e-73  44%  675 aa  DED1_GIBZE RecName: Full=ATP-dependent RNA helicase DED1;       
   58::412     4e-73  42%  482 aa  RRP3_SCLS1 RecName: Full=ATP-dependent rRNA helicase rrp3;       
  141::524     4e-73  44%  627 aa  DED1_KLULA RecName: Full=ATP-dependent RNA helicase DED1;       
   10::343     4e-73  49%  457 aa  DBPA_ECOLI RecName: Full=ATP-independent RNA helicase dbpA;        
    3::378     5e-73  42%  524 aa  EXP9_STRR6 RecName: Full=Probable ATP-dependent RNA helicase exp9; 
    3::378     5e-73  42%  524 aa  EXP9_STRPN RecName: Full=Probable ATP-dependent RNA helicase exp9; 
   43::414     8e-73  42%  465 aa  RRP3_EMENI RecName: Full=ATP-dependent rRNA helicase rrp3;       
  159::526     8e-73  47%  633 aa  RH37_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 37;   
   46::428     1e-72  41%  485 aa  RRP3_AJECN RecName: Full=ATP-dependent rRNA helicase RRP3;       
  205::591     2e-72  43%  734 aa  DRS1_ASHGO RecName: Full=ATP-dependent RNA helicase DRS1;       
   54::416     2e-72  43%  486 aa  RRP3_GIBZE RecName: Full=ATP-dependent rRNA helicase RRP3;       
   36::422     2e-72  42%  473 aa  RRP3_ASPCL RecName: Full=ATP-dependent rRNA helicase rrp3;       
  196::561     5e-72  43%  688 aa  DED1_NEUCR RecName: Full=ATP-dependent RNA helicase ded-1;       
   62::416     9e-72  42%  486 aa  RRP3_BOTFB RecName: Full=ATP-dependent rRNA helicase rrp3;       
  156::516     9e-72  44%  617 aa  DBP1_YEAST RecName: Full=ATP-dependent RNA helicase DBP1;       
  156::516     9e-72  44%  617 aa  DBP1_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP1;       
  146::510     1e-71  47%  646 aa  RH52_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 52;   
  169::538     1e-71  43%  636 aa  DED1_SCHPO RecName: Full=ATP-dependent RNA helicase ded1;       
   54::408     2e-71  42%  472 aa  RRP3_NEOFI RecName: Full=ATP-dependent rRNA helicase rrp3;       
   34::408     2e-71  41%  472 aa  RRP3_ASPFU RecName: Full=ATP-dependent rRNA helicase rrp3;       
  186::554     3e-71  42%  668 aa  DED1_EMENI RecName: Full=ATP-dependent RNA helicase ded1;       
   10::379     3e-71  42%  397 aa  RHLB_PSESM RecName: Full=ATP-dependent RNA helicase rhlB;       
  198::575     3e-71  42%  694 aa  DED1_AJECN RecName: Full=ATP-dependent RNA helicase DED1;       
  191::558     4e-71  44%  672 aa  DED1_USTMA RecName: Full=ATP-dependent RNA helicase DED1;       
  175::540     4e-71  44%  664 aa  DED1_LODEL RecName: Full=ATP-dependent RNA helicase DED1;       
  120::504     6e-71  43%  604 aa  DBP1_CANGA RecName: Full=ATP-dependent RNA helicase DBP1;       
  151::516     8e-71  45%  612 aa  RH11_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 11;   
  174::542     1e-70  45%  637 aa  RH37_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 37;   
  151::534     1e-70  44%  637 aa  DED1_PICGU RecName: Full=ATP-dependent RNA helicase DED1;       
  189::549     1e-70  43%  671 aa  DED1_MAGGR RecName: Full=ATP-dependent RNA helicase DED1;       
   50::417     3e-70  41%  474 aa  RRP3_COCIM RecName: Full=ATP-dependent rRNA helicase RRP3;       
   11::380     4e-70  42%  397 aa  RHLB_PSEAE RecName: Full=ATP-dependent RNA helicase rhlB;       
   11::380     4e-70  42%  397 aa  RHLB_PSEAB RecName: Full=ATP-dependent RNA helicase rhlB;       
   11::380     4e-70  42%  397 aa  RHLB_PSEA8 RecName: Full=ATP-dependent RNA helicase rhlB;       
   40::393     5e-70  43%  484 aa  RRP3_CRYNE RecName: Full=ATP-dependent rRNA helicase RRP3;       
  140::497     5e-70  43%  607 aa  DB10_NICSY RecName: Full=ATP-dependent RNA helicase-like protein
  138::521     8e-70  44%  630 aa  DED1_DEBHA RecName: Full=ATP-dependent RNA helicase DED1;       
  148::510     8e-70  44%  623 aa  DED1_ASHGO RecName: Full=ATP-dependent RNA helicase DED1;       
   58::427     1e-69  41%  477 aa  RRP3_DEBHA RecName: Full=ATP-dependent rRNA helicase RRP3;       
   13::344     1e-69  45%  479 aa  DBPA_BACSU RecName: Full=ATP-dependent RNA helicase dbpA;       
  162::525     1e-69  44%  650 aa  DED1_VANPO RecName: Full=ATP-dependent RNA helicase DED1;       
   53::444     2e-69  40%  493 aa  RRP3_CHAGB RecName: Full=ATP-dependent rRNA helicase RRP3;       
   11::380     3e-69  42%  398 aa  RHLB_PSEPK RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::330     3e-69  43%  613 aa  DEAD_HAEIN RecName: Full=Cold-shock DEAD box protein A homolog;    
   66::432     7e-69  42%  475 aa  RRP3_PICGU RecName: Full=ATP-dependent rRNA helicase RRP3;       
  169::536     3e-68  44%  638 aa  RH52B_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 52B; 
    5::332     3e-68  43%  601 aa  DEAD_BUCAI RecName: Full=Cold-shock DEAD box protein A homolog;    
  176::516     4e-68  44%  591 aa  RH30_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 30;   
  208::582     5e-68  40%  725 aa  DRS1_CANGA RecName: Full=ATP-dependent RNA helicase DRS1;       
    4::332     5e-68  42%  601 aa  DEAD_BUCAP RecName: Full=Cold-shock DEAD box protein A homolog;    
   11::385     8e-68  39%  543 aa  RHLB_XYLFT RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     8e-68  40%  425 aa  RHLB_TOLAT RecName: Full=ATP-dependent RNA helicase rhlB;       
  180::548     8e-68  43%  660 aa  DDX3Y_HUMAN RecName: Full=ATP-dependent RNA helicase DDX3Y;        
   11::385     1e-67  39%  543 aa  RHLB_XYLFA RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-67  40%  430 aa  RHLB_PECCP RecName: Full=ATP-dependent RNA helicase rhlB;       
  255::624     2e-67  43%  662 aa  PRP28_SCHPO RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  112::456     2e-67  43%  540 aa  DBP2_CRYNE RecName: Full=ATP-dependent RNA helicase DBP2-A;        
  147::507     3e-67  43%  617 aa  DED1_CANGA RecName: Full=ATP-dependent RNA helicase DED1;       
  180::548     3e-67  43%  658 aa  DDX3Y_PONAB RecName: Full=ATP-dependent RNA helicase DDX3Y;        
   64::433     4e-67  39%  484 aa  RRP3_PICST RecName: Full=ATP-dependent rRNA helicase RRP3;       
   11::380     4e-67  39%  574 aa  RHLB_XANOR RecName: Full=ATP-dependent RNA helicase rhlB;       
  297::664     4e-67  44%  798 aa  DDX3_DROME RecName: Full=ATP-dependent RNA helicase bel;       
  142::509     4e-67  41%  572 aa  DBP2_SCLS1 RecName: Full=ATP-dependent RNA helicase dbp2;       
   50::404     5e-67  41%  467 aa  RRP3_ASPNC RecName: Full=ATP-dependent rRNA helicase rrp3;       
  111::486     5e-67  40%  613 aa  DRS1_CANAL RecName: Full=ATP-dependent RNA helicase DRS1;       
   11::380     7e-67  39%  573 aa  RHLB_XANC5 RecName: Full=ATP-dependent RNA helicase rhlB;       
   11::380     7e-67  39%  571 aa  RHLB_XANAC RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     7e-67  39%  439 aa  RHLB_SHESR RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     7e-67  39%  439 aa  RHLB_SHESM RecName: Full=ATP-dependent RNA helicase rhlB;       
   11::380     9e-67  39%  573 aa  RHLB_XANCP RecName: Full=ATP-dependent RNA helicase rhlB;       
   11::380     9e-67  39%  573 aa  RHLB_XANCB RecName: Full=ATP-dependent RNA helicase rhlB;       
   11::380     9e-67  39%  573 aa  RHLB_XANC8 RecName: Full=ATP-dependent RNA helicase rhlB;       
   11::383     9e-67  37%  456 aa  RH10_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 10;   
  180::544     9e-67  43%  660 aa  DDX3Y_PANTR RecName: Full=ATP-dependent RNA helicase DDX3Y;        
   42::408     1e-66  39%  472 aa  RRP3_ASPOR RecName: Full=ATP-dependent rRNA helicase rrp3;       
    7::382     1e-66  39%  439 aa  RHLB_SHESW RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     1e-66  39%  439 aa  RHLB_SHEPC RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     1e-66  39%  439 aa  RHLB_SHEON RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     1e-66  38%  432 aa  RHLB_SHEDO RecName: Full=ATP-dependent RNA helicase rhlB;       
    8::388     1e-66  38%  457 aa  DDX47_BOVIN RecName: Full=Probable ATP-dependent RNA helicase
   95::462     1e-66  41%  514 aa  DBP2_BOTFB RecName: Full=ATP-dependent RNA helicase dbp2;       
    7::379     1e-66  40%  435 aa  RHLB_SHESH RecName: Full=ATP-dependent RNA helicase rhlB;       
  162::530     2e-66  41%  637 aa  DED1_CRYNE RecName: Full=ATP-dependent RNA helicase ded1;       
  386::733     2e-66  41%  785 aa  DDX17_DICDI RecName: Full=Probable ATP-dependent RNA helicase
    7::382     3e-66  39%  439 aa  RHLB_SHESA RecName: Full=ATP-dependent RNA helicase rhlB;       
   11::379     3e-66  39%  435 aa  RHLB_SHELP RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     3e-66  40%  430 aa  RHLB_ERWCT RecName: Full=ATP-dependent RNA helicase rhlB;       
  117::479     4e-66  40%  546 aa  RRP3_PHANO RecName: Full=ATP-dependent rRNA helicase RRP3;       
    7::404     4e-66  39%  421 aa  RHLB_ENTS8 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::404     4e-66  40%  421 aa  RHLB_ENT38 RecName: Full=ATP-dependent RNA helicase rhlB;       
  181::545     4e-66  43%  660 aa  DDX3L_MOUSE RecName: Full=Putative ATP-dependent RNA helicase Pl10;
    7::382     6e-66  39%  438 aa  RHLB_SHEB9 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     6e-66  39%  438 aa  RHLB_SHEB8 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     6e-66  39%  438 aa  RHLB_SHEB5 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     6e-66  39%  438 aa  RHLB_SHEB2 RecName: Full=ATP-dependent RNA helicase rhlB;       
  116::478     7e-66  39%  539 aa  RRP3_CANAL RecName: Full=ATP-dependent rRNA helicase RRP3;       
    7::382     7e-66  39%  434 aa  RHLB_SHEFN RecName: Full=ATP-dependent RNA helicase rhlB;       
  193::551     7e-66  42%  672 aa  DED1_CANAL RecName: Full=ATP-dependent RNA helicase DED1;       
    7::379     1e-65  39%  441 aa  RHLB_SHEWM RecName: Full=ATP-dependent RNA helicase rhlB;       
  370::742     1e-65  43%  796 aa  PRP28_NEOFI RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  370::742     1e-65  43%  796 aa  PRP28_ASPFU RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  231::609     1e-65  43%  712 aa  DDX3_DICDI RecName: Full=Probable ATP-dependent RNA helicase ddx3; 
  182::546     1e-65  42%  662 aa  DDX3X_MOUSE RecName: Full=ATP-dependent RNA helicase DDX3X;        
    7::382     2e-65  40%  421 aa  RHLB_KLEP7 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::380     2e-65  40%  413 aa  RHLB_ACTSZ RecName: Full=ATP-dependent RNA helicase rhlB;       
  233::603     2e-65  39%  752 aa  DRS1_VANPO RecName: Full=ATP-dependent RNA helicase DRS1;       
  224::609     2e-65  38%  748 aa  DRS1_KLULA RecName: Full=ATP-dependent RNA helicase DRS1;       
  182::546     2e-65  42%  662 aa  DDX3X_HUMAN RecName: Full=ATP-dependent RNA helicase DDX3X;        
    7::358     2e-65  41%  437 aa  RHLB_SHEPW RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-65  40%  428 aa  RHLB_SERP5 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-65  40%  421 aa  RHLB_KLEP3 RecName: Full=ATP-dependent RNA helicase rhlB;       
  223::587     2e-65  41%  697 aa  DDX3_XENLA RecName: Full=Putative ATP-dependent RNA helicase an3;  
   30::390     3e-65  38%  445 aa  RRP3_ASPTN RecName: Full=ATP-dependent rRNA helicase rrp3;       
    7::382     3e-65  38%  432 aa  RHLB_PROMH RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     3e-65  38%  434 aa  RHLB_ALISL RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_SHISS RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_SHIFL RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ESCF3 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECOUT RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECOSE RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECOLU RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECOLI RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECOLC RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECOL6 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECOL5 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECOK1 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECOHS RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECODH RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECOBW RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECO8A RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECO81 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECO7I RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECO55 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECO45 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECO27 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-65  40%  421 aa  RHLB_ECO24 RecName: Full=ATP-dependent RNA helicase rhlB;       
   26::386     4e-65  38%  455 aa  DDX47_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
  199::549     4e-65  44%  658 aa  DDX3Y_MOUSE RecName: Full=ATP-dependent RNA helicase DDX3Y;        
    7::382     5e-65  40%  421 aa  RHLB_SHIDS RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     5e-65  40%  421 aa  RHLB_ECOSM RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     5e-65  40%  421 aa  RHLB_ECO5E RecName: Full=ATP-dependent RNA helicase rhlB;       
  402::772     5e-65  42%  820 aa  DDX23_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
    7::379     6e-65  40%  421 aa  RHLB_SHIF8 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     6e-65  39%  421 aa  RHLB_CITK8 RecName: Full=ATP-dependent RNA helicase rhlB;       
  224::599     6e-65  39%  741 aa  DRS1_PICST RecName: Full=ATP-dependent RNA helicase DRS1;       
   16::386     6e-65  38%  455 aa  DDX47_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
   75::442     8e-65  40%  493 aa  RRP3_CANGA RecName: Full=ATP-dependent rRNA helicase RRP3;       
  179::533     8e-65  41%  619 aa  DDX41_DROME RecName: Full=ATP-dependent RNA helicase abstrakt;     
  113::449     8e-65  43%  568 aa  DDX17_TRYBB RecName: Full=Putative DEAD-box RNA helicase HEL64;    
    7::382     1e-64  40%  421 aa  RHLB_SHIBS RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     1e-64  40%  421 aa  RHLB_SHIB3 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     1e-64  39%  421 aa  RHLB_SALAR RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::394     1e-64  39%  415 aa  RHLB_HAEIN RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     1e-64  40%  421 aa  RHLB_ECO57 RecName: Full=ATP-dependent RNA helicase rhlB;       
  320::682     1e-64  42%  736 aa  RH21_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 21;   
  307::659     1e-64  40%  986 aa  DDX42_DICDI RecName: Full=Probable ATP-dependent RNA helicase
    7::382     1e-64  39%  421 aa  RHLB_SALPK RecName: Full=ATP-dependent RNA helicase rhlB;       
  217::594     1e-64  40%  752 aa  DRS1_YEAST RecName: Full=ATP-dependent RNA helicase DRS1;       
  219::596     1e-64  40%  754 aa  DRS1_YEAS7 RecName: Full=ATP-dependent RNA helicase DRS1;       
   46::407     1e-64  39%  489 aa  DDX47_CAEEL RecName: Full=Putative ATP-dependent RNA helicase
  198::543     1e-64  44%  596 aa  DBP3_SCLS1 RecName: Full=ATP-dependent RNA helicase dbp3;       
    7::382     2e-64  39%  421 aa  RHLB_SALTY RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-64  39%  421 aa  RHLB_SALTI RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-64  39%  421 aa  RHLB_SALSV RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-64  39%  421 aa  RHLB_SALPC RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-64  39%  421 aa  RHLB_SALPB RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-64  39%  421 aa  RHLB_SALNS RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-64  39%  421 aa  RHLB_SALHS RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-64  39%  421 aa  RHLB_SALG2 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-64  39%  421 aa  RHLB_SALEP RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-64  39%  421 aa  RHLB_SALDC RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-64  39%  421 aa  RHLB_SALCH RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-64  39%  421 aa  RHLB_SALA4 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::394     2e-64  39%  415 aa  RHLB_HAEIG RecName: Full=ATP-dependent RNA helicase rhlB;       
  383::760     2e-64  43%  817 aa  PRP28_COCIM RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  372::744     2e-64  42%  798 aa  PRP28_ASPCL RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
    8::330     2e-64  41%  602 aa  DEAD_BUCBP RecName: Full=Cold-shock DEAD box protein A homolog;    
  238::606     2e-64  40%  942 aa  DDX42_PONAB RecName: Full=ATP-dependent RNA helicase DDX42;        
  238::606     2e-64  40%  929 aa  DDX42_MOUSE RecName: Full=ATP-dependent RNA helicase DDX42;        
  238::606     2e-64  40%  938 aa  DDX42_HUMAN RecName: Full=ATP-dependent RNA helicase DDX42;        
  129::461     2e-64  43%  562 aa  DBP2_CANAL RecName: Full=ATP-dependent RNA helicase DBP2;       
    7::382     2e-64  38%  415 aa  RHLB_SODGM RecName: Full=ATP-dependent RNA helicase rhlB;       
   60::432     3e-64  37%  480 aa  RRP3_YARLI RecName: Full=ATP-dependent rRNA helicase RRP3;       
    7::380     3e-64  38%  419 aa  RHLB_HAES2 RecName: Full=ATP-dependent RNA helicase rhlB;       
  194::567     3e-64  39%  802 aa  RH28_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 28;   
  402::772     3e-64  42%  820 aa  DDX23_PONAB RecName: Full=Probable ATP-dependent RNA helicase
    7::382     4e-64  38%  428 aa  RHLB_YERPY RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-64  38%  428 aa  RHLB_YERPS RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-64  38%  428 aa  RHLB_YERPP RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-64  38%  428 aa  RHLB_YERPN RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-64  38%  428 aa  RHLB_YERPE RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-64  38%  428 aa  RHLB_YERPB RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-64  38%  428 aa  RHLB_YERPA RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-64  38%  428 aa  RHLB_YERP3 RecName: Full=ATP-dependent RNA helicase rhlB;       
  373::750     4e-64  42%  803 aa  PRP28_ASPOR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
   77::450     5e-64  39%  501 aa  RRP3_YEAST RecName: Full=ATP-dependent rRNA helicase RRP3;       
   77::450     7e-64  39%  501 aa  RRP3_YEAS7 RecName: Full=ATP-dependent rRNA helicase RRP3;       
    7::358     7e-64  39%  439 aa  RHLB_SHEAM RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     7e-64  39%  428 aa  RHLB_PHOLL RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::380     7e-64  38%  419 aa  RHLB_HAES1 RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     7e-64  38%  430 aa  RHLB_ERWT9 RecName: Full=ATP-dependent RNA helicase rhlB;       
   11::382     7e-64  38%  429 aa  RHLB_AERS4 RecName: Full=ATP-dependent RNA helicase rhlB;       
  100::483     7e-64  41%  934 aa  DBP10_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-10;       
    7::394     1e-63  39%  415 aa  RHLB_HAEIE RecName: Full=ATP-dependent RNA helicase rhlB;       
   11::382     1e-63  38%  429 aa  RHLB_AERHH RecName: Full=ATP-dependent RNA helicase rhlB;       
  352::729     1e-63  41%  782 aa  PRP28_EMENI RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  248::620     1e-63  39%  771 aa  DRS1_DEBHA RecName: Full=ATP-dependent RNA helicase DRS1;       
  121::483     1e-63  36%  546 aa  DDX47_DICDI RecName: Full=Probable ATP-dependent RNA helicase
  106::471     2e-63  39%  538 aa  RRP3_MAGGR RecName: Full=ATP-dependent rRNA helicase RRP3;       
  320::684     2e-63  42%  733 aa  RH21_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 21;   
  345::730     2e-63  42%  783 aa  PRP28_ASPTN RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  227::577     2e-63  42%  808 aa  DRS1_CRYNE RecName: Full=ATP-dependent RNA helicase DRS1;       
  150::533     2e-63  40%  647 aa  DED1_PICST RecName: Full=ATP-dependent RNA helicase DED1;       
    7::382     2e-63  38%  437 aa  RHLB_VIBHB RecName: Full=ATP-dependent RNA helicase rhlB;       
  160::488     2e-63  44%  619 aa  RH14_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 14;   
    7::382     3e-63  37%  436 aa  RHLB_VIBSL RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     3e-63  38%  422 aa  RHLB_HAMD5 RecName: Full=ATP-dependent RNA helicase rhlB;       
  295::669     3e-63  42%  721 aa  PRP28_GIBZE RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
    7::382     3e-63  38%  435 aa  RHLB_VIBVU RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     3e-63  38%  437 aa  RHLB_PHOPR RecName: Full=ATP-dependent RNA helicase rhlB;       
  144::504     3e-63  40%  604 aa  DED1_YEAST RecName: Full=ATP-dependent RNA helicase DED1;       
  144::504     3e-63  40%  604 aa  DED1_YEAS7 RecName: Full=ATP-dependent RNA helicase DED1;       
    7::382     4e-63  38%  437 aa  RHLB_VIBPA RecName: Full=ATP-dependent RNA helicase rhlB;       
  386::760     4e-63  41%  816 aa  PRP28_SCLS1 RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  112::443     4e-63  43%  544 aa  DBP2_CANGA RecName: Full=ATP-dependent RNA helicase DBP2;       
  300::674     6e-63  42%  728 aa  PRP28_NEUCR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  169::524     6e-63  45%  578 aa  DBP3_SCHPO RecName: Full=ATP-dependent RNA helicase dbp3;       
    7::358     8e-63  39%  436 aa  RHLB_SHEPA RecName: Full=ATP-dependent RNA helicase rhlB;       
   83::467     8e-63  38%  748 aa  RH3_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 3;     
  387::761     8e-63  41%  783 aa  PRP28_BOTFB RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  238::606     8e-63  38%  944 aa  DDX42_CHICK RecName: Full=ATP-dependent RNA helicase DDX42;        
  283::630     8e-63  44%  719 aa  DDX17_DROME RecName: Full=ATP-dependent RNA helicase p62;       
   72::423     1e-62  41%  487 aa  RRP3_KLULA RecName: Full=ATP-dependent rRNA helicase RRP3;       
    7::382     1e-62  38%  435 aa  RHLB_VIBVY RecName: Full=ATP-dependent RNA helicase rhlB;       
  163::493     1e-62  43%  645 aa  RH46_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 46;   
  103::454     1e-62  41%  650 aa  DDX17_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
  103::454     1e-62  41%  650 aa  DDX17_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
    7::358     1e-62  39%  436 aa  RHLB_SHEHH RecName: Full=ATP-dependent RNA helicase rhlB;       
  286::646     1e-62  38%  829 aa  DRS1_NEUCR RecName: Full=ATP-dependent RNA helicase drs-1;       
  118::451     1e-62  42%  552 aa  DBP2_YARLI RecName: Full=ATP-dependent RNA helicase DBP2;       
   87::472     1e-62  42%  900 aa  DBP10_AJECN RecName: Full=ATP-dependent RNA helicase DBP10;        
    7::382     2e-62  38%  432 aa  RHLB_VIBFM RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     2e-62  38%  432 aa  RHLB_VIBF1 RecName: Full=ATP-dependent RNA helicase rhlB;       
  247::589     2e-62  38%  661 aa  VASA_DROME RecName: Full=ATP-dependent RNA helicase vasa;       
   89::471     2e-62  40%  920 aa  DBP10_SCLS1 RecName: Full=ATP-dependent RNA helicase dbp10;        
  342::694     3e-62  40% 1018 aa  DDX46_DANRE RecName: Full=Probable ATP-dependent RNA helicase
  235::599     3e-62  39%  947 aa  DDX42_XENLA RecName: Full=ATP-dependent RNA helicase DDX42;        
    7::382     4e-62  38%  438 aa  RHLB_VIBCM RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-62  38%  438 aa  RHLB_VIBCH RecName: Full=ATP-dependent RNA helicase rhlB;       
    7::382     4e-62  38%  438 aa  RHLB_VIBC3 RecName: Full=ATP-dependent RNA helicase rhlB;       
    9::387     4e-62  37%  397 aa  FAL1_USTMA RecName: Full=ATP-dependent RNA helicase FAL1;       
   96::441     4e-62  42%  614 aa  DDX5_PONAB RecName: Full=Probable ATP-dependent RNA helicase DDX5; 
   96::441     4e-62  42%  614 aa  DDX5_HUMAN RecName: Full=Probable ATP-dependent RNA helicase DDX5; 
   83::463     4e-62  40%  897 aa  DBP10_GIBZE RecName: Full=ATP-dependent RNA helicase DBP10;        
  221::574     5e-62  39%  770 aa  RH24_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 24;   
  333::703     5e-62  42%  746 aa  PRP28_PHANO RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  379::756     5e-62  42%  810 aa  PRP28_ASPNC RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
   96::441     5e-62  42%  614 aa  DDX5_MACFA RecName: Full=Probable ATP-dependent RNA helicase DDX5; 
  255::634     5e-62  40%  700 aa  DDX4_XENLA RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
   91::442     6e-62  41%  506 aa  RRP3_VANPO RecName: Full=ATP-dependent rRNA helicase RRP3;       
  115::446     6e-62  44%  554 aa  DBP2_KLULA RecName: Full=ATP-dependent RNA helicase DBP2;       
  437::765     8e-62  44% 1088 aa  RH40_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 40;   
  182::512     8e-62  44%  708 aa  RH14_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 14;   
   96::441     8e-62  42%  614 aa  DDX5_MOUSE RecName: Full=Probable ATP-dependent RNA helicase DDX5; 
  267::640     8e-62  40%  724 aa  DDX4_RANLE RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
   82::470     8e-62  41%  927 aa  DBP10_COCIM RecName: Full=ATP-dependent RNA helicase DBP10;        
    4::365     1e-61  36%  503 aa  Y956_STAHJ RecName: Full=Probable DEAD-box ATP-dependent RNA
    4::365     1e-61  36%  509 aa  Y1679_STAES RecName: Full=Probable DEAD-box ATP-dependent RNA
  179::518     1e-61  44%  581 aa  DBP3_GIBZE RecName: Full=ATP-dependent RNA helicase DBP3;       
  124::455     1e-61  43%  550 aa  DBP2_SCHPO RecName: Full=ATP-dependent RNA helicase dbp2;       
  106::459     1e-61  39%  551 aa  RRP3_USTMA RecName: Full=ATP-dependent rRNA helicase RRP3;       
  269::642     1e-61  41%  724 aa  DDX4_HUMAN RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
  127::458     1e-61  42%  542 aa  DBP2_COCIM RecName: Full=ATP-dependent RNA helicase DBP2;       
    4::365     2e-61  36%  509 aa  Y1688_STAEQ RecName: Full=Probable DEAD-box ATP-dependent RNA
  396::772     2e-61  38% 1014 aa  PRP11_SCHPO RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   90::495     2e-61  40%  929 aa  DBP10_ASPOR RecName: Full=ATP-dependent RNA helicase dbp10;        
    4::365     2e-61  37%  506 aa  Y802_STAS1 RecName: Full=Probable DEAD-box ATP-dependent RNA
   96::441     2e-61  42%  614 aa  DDX5_PANTR RecName: Full=Probable ATP-dependent RNA helicase DDX5; 
  420::813     2e-61  38%  834 aa  DDX23_DICDI RecName: Full=ATP-dependent RNA helicase ddx23;        
  205::539     2e-61  44%  592 aa  DBP3_BOTFB RecName: Full=ATP-dependent RNA helicase dbp3;       
  267::640     3e-61  41%  722 aa  DDX4_PIG RecName: Full=Probable ATP-dependent RNA helicase DDX4;   
    3::380     3e-61  40%  483 aa  DDX49_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
  139::470     3e-61  41%  565 aa  DBP2_ASPNC RecName: Full=ATP-dependent RNA helicase dbp2;       
  115::446     4e-61  42%  546 aa  DBP2_YEAST RecName: Full=ATP-dependent RNA helicase DBP2;       
  115::446     4e-61  42%  546 aa  DBP2_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP2;       
  242::615     5e-61  41%  702 aa  DDX4_MOUSE RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
    3::364     5e-61  42%  480 aa  DDX49_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
  196::536     5e-61  42%  592 aa  DBP3_PHANO RecName: Full=ATP-dependent RNA helicase DBP3;       
  127::458     5e-61  42%  549 aa  DBP2_ASPCL RecName: Full=ATP-dependent RNA helicase dbp2;       
   26::387     7e-61  36%  397 aa  FAL1_YARLI RecName: Full=ATP-dependent RNA helicase FAL1;       
  132::463     7e-61  42%  554 aa  DBP2_ASPOR RecName: Full=ATP-dependent RNA helicase dbp2;       
   87::466     7e-61  41%  762 aa  DBP10_CHAGB RecName: Full=ATP-dependent RNA helicase DBP10;        
   85::442     9e-61  40%  512 aa  RH5_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 5;     
  249::609     9e-61  36%  796 aa  DRS1_GIBZE RecName: Full=ATP-dependent RNA helicase DRS1;       
  128::471     9e-61  42%  532 aa  DBP3_YARLI RecName: Full=ATP-dependent RNA helicase DBP3;       
   99::432     9e-61  42%  530 aa  DBP2_PICST RecName: Full=ATP-dependent RNA helicase DBP2;       
  270::643     1e-60  40%  725 aa  DDX4_MACFA RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
  132::464     1e-60  41%  552 aa  DBP2_USTMA RecName: Full=ATP-dependent RNA helicase DBP2;       
  123::454     1e-60  41%  547 aa  DBP2_ASPFU RecName: Full=ATP-dependent RNA helicase dbp2;       
   91::482     1e-60  41%  934 aa  DBP10_NEOFI RecName: Full=ATP-dependent RNA helicase dbp10;        
   66::440     2e-60  38%  487 aa  RRP3_ASHGO RecName: Full=ATP-dependent rRNA helicase RRP3;       
   34::396     2e-60  37%  484 aa  DHH1_VANPO RecName: Full=ATP-dependent RNA helicase DHH1;       
  230::597     2e-60  39%  760 aa  RH24_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 24;   
  322::692     2e-60  40%  738 aa  PRP28_CRYNE RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  142::473     2e-60  41%  563 aa  DBP2_EMENI RecName: Full=ATP-dependent RNA helicase dbp2;       
  107::440     2e-60  41%  536 aa  DBP2_DEBHA RecName: Full=ATP-dependent RNA helicase DBP2;       
   43::414     3e-60  36%  472 aa  RH10_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 10;   
  121::452     3e-60  41%  545 aa  DBP2_NEOFI RecName: Full=ATP-dependent RNA helicase dbp2;       
   71::462     3e-60  41%  869 aa  DBP10_ASPFU RecName: Full=ATP-dependent RNA helicase dbp10;        
    7::393     4e-60  37%  423 aa  RHLB_PASMU RecName: Full=ATP-dependent RNA helicase rhlB;       
  193::540     4e-60  44%  605 aa  DBP3_CRYNE RecName: Full=ATP-dependent RNA helicase DBP3;       
  149::474     5e-60  42%  535 aa  DBP3_LODEL RecName: Full=ATP-dependent RNA helicase DBP3;       
  127::460     5e-60  42%  554 aa  DBP2_PICGU RecName: Full=ATP-dependent RNA helicase DBP2;       
   39::401     6e-60  38%  851 aa  RH29_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 29;   
  272::649     6e-60  41%  674 aa  PRP28_MAGGR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  257::608     6e-60  37%  790 aa  DRS1_MAGGR RecName: Full=ATP-dependent RNA helicase DRS1;       
   38::396     6e-60  36%  514 aa  DHH1_KLULA RecName: Full=ATP-dependent RNA helicase DHH1;       
   32::384     6e-60  38%  516 aa  DHH1_DEBHA RecName: Full=ATP-dependent RNA helicase DHH1;       
   29::382     8e-60  38%  522 aa  DHH1_YARLI RecName: Full=ATP-dependent RNA helicase DHH1;       
   31::393     8e-60  36%  507 aa  DHH1_CANGA RecName: Full=ATP-dependent RNA helicase DHH1;       
  535::884     1e-59  37% 1166 aa  RH42_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 42;   
   46::408     1e-59  36%  506 aa  DHH1_YEAST RecName: Full=ATP-dependent RNA helicase DHH1;       
   46::408     1e-59  36%  506 aa  DHH1_YEAS7 RecName: Full=ATP-dependent RNA helicase DHH1;       
  254::627     1e-59  40%  713 aa  DDX4_RAT RecName: Full=Probable ATP-dependent RNA helicase DDX4;   
  136::467     1e-59  40%  555 aa  DBP2_GIBZE RecName: Full=ATP-dependent RNA helicase DBP2;       
   92::481     1e-59  40%  936 aa  DBP10_EMENI RecName: Full=ATP-dependent RNA helicase dbp10;        
  127::459     2e-59  41%  542 aa  DBP2_AJECN RecName: Full=ATP-dependent RNA helicase DBP2;       
   93::422     2e-59  40%  494 aa  RH20_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 20;   
  271::644     2e-59  40%  729 aa  DDX4_BOVIN RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
   31::374     3e-59  38%  547 aa  DHH1_PICGU RecName: Full=ATP-dependent RNA helicase DHH1;       
  156::545     4e-59  39%  580 aa  PRP28_DEBHA RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  118::449     4e-59  43%  552 aa  DBP2_LODEL RecName: Full=ATP-dependent RNA helicase DBP2;       
   89::449     4e-59  37%  495 aa  DBP2_ENCCU RecName: Full=ATP-dependent RNA helicase DBP2;       
    7::378     5e-59  38%  417 aa  RHLB_MANSM RecName: Full=ATP-dependent RNA helicase rhlB;       
   13::396     5e-59  36%  512 aa  DHH1_CHAGB RecName: Full=ATP-dependent RNA helicase DHH1;       
  224::579     5e-59  38%  671 aa  DDX41_DICDI RecName: Full=Probable ATP-dependent RNA helicase
   21::401     7e-59  37%  538 aa  DHH1_BOTFB RecName: Full=ATP-dependent RNA helicase dhh1;       
  120::466     7e-59  40%  527 aa  DBP3_DEBHA RecName: Full=ATP-dependent RNA helicase DBP3;       
   90::481     7e-59  39%  935 aa  DBP10_ASPCL RecName: Full=ATP-dependent RNA helicase dbp10;        
  482::831     9e-59  38% 1156 aa  PRP5_USTMA RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   32::384     9e-59  37%  509 aa  DHH1_PICST RecName: Full=ATP-dependent RNA helicase DHH1;       
   43::403     9e-59  37%  423 aa  DDX6_DICDI RecName: Full=Probable ATP-dependent RNA helicase ddx6; 
  166::508     9e-59  40%  585 aa  DBP3_USTMA RecName: Full=ATP-dependent RNA helicase DBP3;       
  145::482     1e-58  43%  792 aa  RH40_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 40;   
   38::419     1e-58  36%  524 aa  DHH1_MAGGR RecName: Full=ATP-dependent RNA helicase DHH1;       
  119::458     1e-58  41%  464 aa  DBP3_COCIM RecName: Full=ATP-dependent RNA helicase DBP3;       
   99::453     1e-58  37%  542 aa  RH43_ARATH RecName: Full=Putative DEAD-box ATP-dependent RNA
   51::401     1e-58  38%  851 aa  RH29_ORYSI RecName: Full=DEAD-box ATP-dependent RNA helicase 29;   
   53::430     1e-58  36%  505 aa  DHH1_NEUCR RecName: Full=ATP-dependent RNA helicase dhh-1;       
  263::582     2e-58  40%  666 aa  RH30_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 30;   
  169::540     2e-58  37%  789 aa  RH28_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 28;   
  263::650     2e-58  39%  705 aa  PRP28_CHAGB RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  198::552     2e-58  39%  686 aa  DRS1_LODEL RecName: Full=ATP-dependent RNA helicase DRS1;       
  148::502     3e-58  38%  591 aa  RH35_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 35;   
   34::395     3e-58  35%  405 aa  IF4A_DICDI RecName: Full=Eukaryotic initiation factor 4A;       
   31::392     3e-58  35%  402 aa  IF4A_CAEEL RecName: Full=Eukaryotic initiation factor 4A;       
   44::427     3e-58  36%  486 aa  DHH1_GIBZE RecName: Full=ATP-dependent RNA helicase DHH1;       
    7::396     3e-58  35%  421 aa  RHLB_PSEA6 RecName: Full=ATP-dependent RNA helicase rhlB;       
  134::488     4e-58  36%  508 aa  RH8_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 8;     
   28::389     4e-58  35%  400 aa  FAL1_NEUCR RecName: Full=ATP-dependent RNA helicase fal-1;       
   22::401     4e-58  36%  503 aa  DHH1_ASPCL RecName: Full=ATP-dependent RNA helicase dhh1;       
  134::467     4e-58  39%  562 aa  DBP2_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-2;       
   90::482     4e-58  40%  928 aa  DBP10_ASPTN RecName: Full=ATP-dependent RNA helicase dbp10;        
   67::444     6e-58  36%  602 aa  RH53_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 53;   
   27::401     6e-58  37%  507 aa  DHH1_NEOFI RecName: Full=ATP-dependent RNA helicase dhh1;       
   32::384     6e-58  36%  549 aa  DHH1_CANAL RecName: Full=ATP-dependent RNA helicase DHH1;       
   27::401     6e-58  37%  507 aa  DHH1_ASPFU RecName: Full=ATP-dependent RNA helicase dhh1;       
  103::449     6e-58  40%  503 aa  DBP3_ASPFU RecName: Full=ATP-dependent RNA helicase dbp3;       
   89::430     6e-58  40%  487 aa  DBP3_AJECN RecName: Full=ATP-dependent RNA helicase DBP3;       
  138::471     6e-58  40%  562 aa  DBP2_CHAGB RecName: Full=ATP-dependent RNA helicase DBP2;       
   92::473     6e-58  39%  914 aa  DBP10_MAGGR RecName: Full=ATP-dependent RNA helicase DBP10;        
    4::365     7e-58  36%  506 aa  Y2316_STAA8 RecName: Full=Probable DEAD-box ATP-dependent RNA
    4::365     7e-58  36%  506 aa  Y2168_STAAR RecName: Full=Probable DEAD-box ATP-dependent RNA
    4::365     7e-58  36%  506 aa  Y2081_STAAM RecName: Full=Probable DEAD-box ATP-dependent RNA
    4::365     7e-58  36%  506 aa  Y2072_STAAC RecName: Full=Probable DEAD-box ATP-dependent RNA
    4::365     7e-58  36%  506 aa  Y2037_STAA3 RecName: Full=Probable DEAD-box ATP-dependent RNA
    4::365     7e-58  36%  506 aa  Y2004_STAAW RecName: Full=Probable DEAD-box ATP-dependent RNA
    4::365     7e-58  36%  506 aa  Y1985_STAAS RecName: Full=Probable DEAD-box ATP-dependent RNA
    4::365     7e-58  36%  506 aa  Y1885_STAAN RecName: Full=Probable DEAD-box ATP-dependent RNA
  113::466     7e-58  39%  537 aa  RH5_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 5;     
  156::540     7e-58  38%  575 aa  PRP28_PICGU RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
   29::390     7e-58  35%  401 aa  FAL1_MAGGR RecName: Full=ATP-dependent RNA helicase FAL1;       
   22::401     7e-58  36%  505 aa  DHH1_ASPNC RecName: Full=ATP-dependent RNA helicase dhh1;       
  152::473     7e-58  40%  534 aa  DBP3_PICGU RecName: Full=ATP-dependent RNA helicase DBP3;       
    4::365     1e-57  36%  506 aa  Y1965_STAAB RecName: Full=Probable DEAD-box ATP-dependent RNA
   29::403     1e-57  36%  522 aa  DHH1_PHANO RecName: Full=ATP-dependent RNA helicase DHH1;       
   27::401     1e-57  37%  511 aa  DHH1_ASPOR RecName: Full=ATP-dependent RNA helicase dhh1;       
  101::430     2e-57  38%  501 aa  RH20_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 20;   
   27::388     2e-57  35%  399 aa  FAL1_EMENI RecName: Full=ATP-dependent RNA helicase fal1;       
  200::555     2e-57  39%  705 aa  DRS1_PICGU RecName: Full=ATP-dependent RNA helicase DRS1;       
  296::633     2e-57  38%  820 aa  DRS1_ASPOR RecName: Full=ATP-dependent RNA helicase drs1;       
  124::478     2e-57  36%  498 aa  RH6_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 6;     
   24::384     2e-57  34%  395 aa  IF4A_YARLI RecName: Full=ATP-dependent RNA helicase eIF4A;       
   21::384     2e-57  34%  394 aa  FAL1_SCHPO RecName: Full=ATP-dependent RNA helicase fal1;       
   29::390     2e-57  35%  401 aa  FAL1_GIBZE RecName: Full=ATP-dependent RNA helicase FAL1;       
  184::538     3e-57  38%  627 aa  RH35A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 35A; 
   16::394     3e-57  35%  404 aa  RH34_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 34;   
  105::488     3e-57  38%  594 aa  RH25_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 25;   
   58::401     3e-57  37%  509 aa  DHH1_ASPTN RecName: Full=ATP-dependent RNA helicase dhh1;       
  131::485     4e-57  35%  505 aa  RH8_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 8;     
   27::394     4e-57  35%  450 aa  FAL1_AJECN RecName: Full=ATP-dependent RNA helicase FAL1;       
  233::575     4e-57  35%  631 aa  DDX53_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
  114::460     4e-57  39%  548 aa  DBP2_MAGGR RecName: Full=ATP-dependent RNA helicase DBP2;       
   27::388     5e-57  34%  399 aa  FAL1_ASPCL RecName: Full=ATP-dependent RNA helicase fal1;       
  205::551     5e-57  37%  619 aa  DDX59_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
  374::723     5e-57  39% 1032 aa  DDX46_RAT RecName: Full=Probable ATP-dependent RNA helicase DDX46; 
  374::723     5e-57  39% 1032 aa  DDX46_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
  374::723     5e-57  39% 1031 aa  DDX46_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
   27::388     6e-57  35%  399 aa  FAL1_NEOFI RecName: Full=ATP-dependent RNA helicase fal1;       
   28::388     6e-57  34%  399 aa  FAL1_CANAL RecName: Full=ATP-dependent RNA helicase FAL1;       
  205::551     6e-57  38%  619 aa  DDX59_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
   16::394     8e-57  35%  404 aa  RH2_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 2;     
   20::381     8e-57  33%  391 aa  IF4A3_NICPL RecName: Full=Eukaryotic initiation factor 4A-3;       
   11::388     8e-57  34%  399 aa  FAL1_SCLS1 RecName: Full=ATP-dependent RNA helicase fal1;       
   29::382     8e-57  35%  394 aa  FAL1_CHAGB RecName: Full=ATP-dependent RNA helicase FAL1;       
   11::388     8e-57  34%  399 aa  FAL1_BOTFB RecName: Full=ATP-dependent RNA helicase fal1;       
   27::388     8e-57  35%  399 aa  FAL1_ASPTN RecName: Full=ATP-dependent RNA helicase fal1;       
   26::387     8e-57  35%  398 aa  FAL1_ASPOR RecName: Full=ATP-dependent RNA helicase fal1;       
   27::388     8e-57  35%  399 aa  FAL1_ASPNC RecName: Full=ATP-dependent RNA helicase fal1;       
   26::387     8e-57  35%  398 aa  FAL1_ASPFU RecName: Full=ATP-dependent RNA helicase fal1;       
    7::382     1e-56  36%  418 aa  RHLB_PSYIN RecName: Full=ATP-dependent RNA helicase rhlB;       
   33::394     1e-56  35%  405 aa  IF4A_CRYPV RecName: Full=Eukaryotic initiation factor 4A;       
   39::400     1e-56  34%  410 aa  IF4A3_TAEGU RecName: Full=Eukaryotic initiation factor 4A-III;     
   40::401     1e-56  34%  411 aa  IF4A3_RAT RecName: Full=Eukaryotic initiation factor 4A-III;       
   40::401     1e-56  34%  411 aa  IF4A3_PIG RecName: Full=Eukaryotic initiation factor 4A-III;       
   40::401     1e-56  34%  411 aa  IF4A3_HUMAN RecName: Full=Eukaryotic initiation factor 4A-III;     
   41::402     1e-56  34%  412 aa  IF4A3_CHICK RecName: Full=Eukaryotic initiation factor 4A-III;     
   40::401     1e-56  34%  411 aa  IF4A3_BOVIN RecName: Full=Eukaryotic initiation factor 4A-III;     
   58::401     1e-56  36%  512 aa  DHH1_COCIM RecName: Full=ATP-dependent RNA helicase DHH1;       
   95::449     1e-56  34%  481 aa  DDX6_XENTR RecName: Full=Probable ATP-dependent RNA helicase DDX6; 
   48::401     1e-56  37%  465 aa  RRP3_SCHPO RecName: Full=ATP-dependent rRNA helicase rrp3;       
  430::776     1e-56  37% 1049 aa  RH42_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 42;   
  147::501     1e-56  36%  521 aa  RH12_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 12;   
   40::401     1e-56  34%  411 aa  IF4A3_MOUSE RecName: Full=Eukaryotic initiation factor 4A-III;     
  248::602     1e-56  36%  753 aa  DRS1_YARLI RecName: Full=ATP-dependent RNA helicase DRS1;       
  374::723     1e-56  39% 1032 aa  DDX46_PONAB RecName: Full=Probable ATP-dependent RNA helicase
   37::398     2e-56  35%  408 aa  RH2_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 2;     
  191::579     2e-56  38%  597 aa  PRP28_LODEL RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
   25::388     2e-56  33%  398 aa  IF4A_BOTFB RecName: Full=ATP-dependent RNA helicase eIF4A;       
   95::449     2e-56  34%  481 aa  DDX6_XENLA RecName: Full=Probable ATP-dependent RNA helicase DDX6; 
  116::447     2e-56  41%  557 aa  DBP2_ASHGO RecName: Full=ATP-dependent RNA helicase DBP2;       
   96::476     2e-56  38%  671 aa  RH7_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 7;     
   25::388     2e-56  33%  398 aa  IF4A_SCLS1 RecName: Full=ATP-dependent RNA helicase eIF4A;       
   58::412     2e-56  34%  459 aa  DDX6_DROME RecName: Full=Putative ATP-dependent RNA helicase me31b;
  183::537     2e-56  38%  622 aa  DDX41_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
   96::450     3e-56  34%  483 aa  DDX6_MOUSE RecName: Full=Probable ATP-dependent RNA helicase DDX6; 
   96::450     3e-56  34%  483 aa  DDX6_HUMAN RecName: Full=Probable ATP-dependent RNA helicase DDX6; 
   96::450     3e-56  34%  483 aa  DDX6_CHICK RecName: Full=Probable ATP-dependent RNA helicase DDX6; 
   24::384     4e-56  35%  392 aa  RH34_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 34;   
   35::396     4e-56  35%  406 aa  IF4A3_SALSA RecName: Full=Eukaryotic initiation factor 4A-III;     
   40::401     4e-56  34%  411 aa  IF4A3_MACFA RecName: Full=Eukaryotic initiation factor 4A-III;     
  253::604     5e-56  38%  648 aa  DDX43_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
  183::537     5e-56  38%  622 aa  DDX41_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
   50::395     5e-56  38%  806 aa  DBP4_COCIM RecName: Full=ATP-dependent RNA helicase DBP4;       
   88::441     5e-56  40%  495 aa  DBP3_ASPNC RecName: Full=ATP-dependent RNA helicase dbp3;       
  107::474     7e-56  37%  758 aa  RH3_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 3;     
  132::464     7e-56  39%  540 aa  DBP3_CANGA RecName: Full=ATP-dependent RNA helicase DBP3;       
  179::549     9e-56  37%  581 aa  PRP28_CANAL RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
   44::405     9e-56  34%  415 aa  IF4A3_XENTR RecName: Full=Eukaryotic initiation factor 4A-III;     
    3::350     1e-55  36%  400 aa  RRP3_ENCCU RecName: Full=ATP-dependent rRNA helicase RRP3;       
   85::439     1e-55  34%  472 aa  DDX6_CAVPO RecName: Full=Probable ATP-dependent RNA helicase DDX6; 
   50::404     1e-55  34%  430 aa  CGH1_CAEEL RecName: Full=ATP-dependent RNA helicase cgh-1;       
   43::404     2e-55  34%  414 aa  I4A3B_XENLA RecName: Full=Eukaryotic initiation factor 4A-III-B;   
   93::493     2e-55  39%  914 aa  DBP10_PICGU RecName: Full=ATP-dependent RNA helicase DBP10;        
  380::768     2e-55  39%  974 aa  PRP5_YARLI RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   27::388     2e-55  34%  399 aa  FAL1_COCIM RecName: Full=ATP-dependent RNA helicase FAL1;       
   32::409     2e-55  40%  802 aa  DBP10_CRYNE RecName: Full=ATP-dependent RNA helicase DBP10;        
  104::512     2e-55  38%  969 aa  DBP10_CANGA RecName: Full=ATP-dependent RNA helicase DBP10;        
  154::508     3e-55  35%  528 aa  RH6_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 6;     
   96::450     3e-55  33%  483 aa  DDX6_PONAB RecName: Full=Probable ATP-dependent RNA helicase DDX6; 
  405::752     3e-55  40%  994 aa  PRP5_LODEL RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  409::760     3e-55  36% 1072 aa  PRP5_CRYNE RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   25::388     3e-55  33%  398 aa  IF4A_ASPNC RecName: Full=ATP-dependent RNA helicase eIF4A;       
  335::697     3e-55  40%  932 aa  DRS1_USTMA RecName: Full=ATP-dependent RNA helicase DRS1;       
  100::515     3e-55  37%  926 aa  DBP10_YARLI RecName: Full=ATP-dependent RNA helicase DBP10;        
   28::391     5e-55  34%  401 aa  IF4A_CRYNE RecName: Full=ATP-dependent RNA helicase eIF4A;       
   28::389     5e-55  34%  399 aa  FAL1_YEAST RecName: Full=ATP-dependent RNA helicase FAL1;       
   28::389     5e-55  34%  399 aa  FAL1_YEAS7 RecName: Full=ATP-dependent RNA helicase FAL1;       
   33::385     5e-55  40%  735 aa  DBP4_SCHPO RecName: Full=ATP-dependent RNA helicase dbp4;       
   69::472     5e-55  36%  848 aa  DBP10_SCHPO RecName: Full=ATP-dependent RNA helicase dbp10;        
  384::714     6e-55  40% 1012 aa  PRP5_MAGGR RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  599::951     6e-55  38% 1227 aa  PRP5_GIBZE RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   25::388     6e-55  33%  398 aa  IF4A_NEOFI RecName: Full=ATP-dependent RNA helicase eIF4A;       
   23::386     6e-55  33%  396 aa  IF4A_MAGGR RecName: Full=ATP-dependent RNA helicase eIF4A;       
   44::405     6e-55  34%  415 aa  I4A3A_XENLA RecName: Full=Eukaryotic initiation factor 4A-III-A;   
    2::369     6e-55  35%  508 aa  DDX49_DICDI RecName: Full=Probable ATP-dependent RNA helicase
  107::523     6e-55  37%  973 aa  DBP10_KLULA RecName: Full=ATP-dependent RNA helicase DBP10;        
   21::382     8e-55  34%  392 aa  IF4A_SCHPO RecName: Full=ATP-dependent RNA helicase eIF4A;       
   24::387     8e-55  33%  397 aa  IF4A_NEUCR RecName: Full=ATP-dependent RNA helicase eIF4A;       
   25::388     8e-55  33%  406 aa  IF4A_ASPFU RecName: Full=ATP-dependent RNA helicase eIF4A;       
   35::396     8e-55  34%  406 aa  IF4A3_DANRE RecName: Full=Eukaryotic initiation factor 4A-III;     
   41::393     8e-55  37%  804 aa  DBP4_ASPTN RecName: Full=ATP-dependent RNA helicase dbp4;       
  110::443     8e-55  40%  504 aa  DBP3_KLULA RecName: Full=ATP-dependent RNA helicase DBP3;       
   51::397     1e-54  35%  485 aa  DHH1_SCHPO RecName: Full=Putative ATP-dependent RNA helicase ste13;
    3::377     1e-54  38%  445 aa  DBP8_PICST RecName: Full=ATP-dependent RNA helicase DBP8;       
   24::387     1e-54  33%  397 aa  IF4A_CHAGB RecName: Full=ATP-dependent RNA helicase eIF4A;       
   23::386     1e-54  33%  396 aa  IF4A_ASPTN RecName: Full=ATP-dependent RNA helicase eIF4A;       
    3::377     1e-54  39%  433 aa  DBP8_PICGU RecName: Full=ATP-dependent RNA helicase DBP8;       
   49::394     1e-54  39%  802 aa  DBP4_ASPNC RecName: Full=ATP-dependent RNA helicase dbp4;       
  124::478     2e-54  34%  498 aa  RH12_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 12;   
   28::388     2e-54  33%  399 aa  FAL1_LODEL RecName: Full=ATP-dependent RNA helicase FAL1;       
   30::396     2e-54  36%  823 aa  DBP4_ASPCL RecName: Full=ATP-dependent RNA helicase dbp4;       
  115::424     2e-54  42%  441 aa  DBP2_VANPO RecName: Full=ATP-dependent RNA helicase DBP2;       
   28::394     2e-54  36%  810 aa  DBP4_NEOFI RecName: Full=ATP-dependent RNA helicase dbp4;       
  132::460     3e-54  41%  685 aa  RH7_SPIOL RecName: Full=DEAD-box ATP-dependent RNA helicase 7;     
   38::401     3e-54  33%  411 aa  IF4A_USTMA RecName: Full=ATP-dependent RNA helicase eIF4A;       
   48::411     3e-54  33%  421 aa  IF4A_EMENI RecName: Full=ATP-dependent RNA helicase eIF4A;       
   25::388     3e-54  32%  398 aa  IF4A_ASPCL RecName: Full=ATP-dependent RNA helicase eIF4A;       
   28::388     3e-54  34%  399 aa  FAL1_DEBHA RecName: Full=ATP-dependent RNA helicase FAL1;       
  300::635     3e-54  36%  821 aa  DRS1_ASPTN RecName: Full=ATP-dependent RNA helicase drs1;       
   38::390     3e-54  35%  625 aa  DHH1_CRYNE RecName: Full=ATP-dependent RNA helicase DHH1;       
   40::392     3e-54  37%  796 aa  DBP4_ASPOR RecName: Full=ATP-dependent RNA helicase dbp4;       
   19::386     4e-54  32%  396 aa  IF4A_PHANO RecName: Full=ATP-dependent RNA helicase eIF4A;       
   24::385     4e-54  34%  396 aa  IF4A_ASHGO RecName: Full=ATP-dependent RNA helicase eIF4A;       
   25::388     4e-54  33%  399 aa  FAL1_VANPO RecName: Full=ATP-dependent RNA helicase FAL1;       
   25::386     4e-54  33%  396 aa  FAL1_CRYNE RecName: Full=ATP-dependent RNA helicase FAL1;       
   38::390     4e-54  35%  616 aa  DHH1_CRYNV RecName: Full=ATP-dependent RNA helicase VAD1;       
    3::377     4e-54  39%  441 aa  DBP8_DEBHA RecName: Full=ATP-dependent RNA helicase DBP8;       
   49::394     4e-54  38%  787 aa  DBP4_ASPFU RecName: Full=ATP-dependent RNA helicase dbp4;       
    7::341     5e-54  38%  425 aa  RHLB_IDILO RecName: Full=ATP-dependent RNA helicase rhlB;       
   26::386     5e-54  34%  397 aa  FAL1_PICGU RecName: Full=ATP-dependent RNA helicase FAL1;       
  107::434     7e-54  37%  616 aa  RH53_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 53;   
   77::437     7e-54  39%  482 aa  PRP28_PICST RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
   28::391     7e-54  35%  403 aa  IF4A_LEIMA RecName: Full=Probable eukaryotic initiation factor 4A; 
   28::391     7e-54  35%  403 aa  IF4A_LEIIN RecName: Full=Probable eukaryotic initiation factor 4A; 
   28::391     7e-54  35%  403 aa  IF4A_LEIBR RecName: Full=Probable eukaryotic initiation factor 4A; 
   19::399     7e-54  34%  413 aa  IF415_TOBAC RecName: Full=Eukaryotic initiation factor 4A-15;      
    1::355     7e-54  36%  367 aa  H669_METJA RecName: Full=Probable ATP-dependent RNA helicase
   28::388     7e-54  33%  399 aa  FAL1_PICST RecName: Full=ATP-dependent RNA helicase FAL1;       
    3::373     8e-54  38%  442 aa  DBP8_YARLI RecName: Full=ATP-dependent RNA helicase DBP8;       
    3::377     1e-53  37%  440 aa  DBP8_CANAL RecName: Full=ATP-dependent RNA helicase DBP8;       
   89::495     1e-53  37%  932 aa  DBP10_DEBHA RecName: Full=ATP-dependent RNA helicase DBP10;        
  139::499     1e-53  34%  536 aa  RH41_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 41;   
  127::446     2e-53  40%  610 aa  RH9_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 9;     
   25::385     2e-53  34%  397 aa  IF4A_LODEL RecName: Full=ATP-dependent RNA helicase eIF4A;       
   25::388     2e-53  33%  398 aa  IF4A_COCIM RecName: Full=ATP-dependent RNA helicase eIF4A;       
   43::421     2e-53  36%  812 aa  DBP4_EMENI RecName: Full=ATP-dependent RNA helicase dbp4;       
  101::498     2e-53  39%  931 aa  DBP10_PICST RecName: Full=ATP-dependent RNA helicase DBP10;        
    3::362     2e-53  35%  438 aa  CSHB_BACSU RecName: Full=DEAD-box ATP-dependent RNA helicase cshB; 
   25::386     3e-53  34%  397 aa  IF4A_CANAL RecName: Full=ATP-dependent RNA helicase eIF4A;       
   41::400     3e-53  34%  414 aa  IF4A3_ARATH RecName: Full=Eukaryotic initiation factor 4A-3;       
   44::396     3e-53  36%  798 aa  DBP4_MAGGR RecName: Full=ATP-dependent RNA helicase DBP4;       
  112::482     4e-53  37%  696 aa  RH7_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 7;     
  511::842     4e-53  38% 1151 aa  DDX46_DICDI RecName: Full=ATP-dependent RNA helicase ddx46;        
   98::501     4e-53  37%  545 aa  DBP8_BOTFB RecName: Full=ATP-dependent RNA helicase dbp8;       
   19::408     6e-53  33%  410 aa  IF4A_MAIZE RecName: Full=Eukaryotic initiation factor 4A;       
   12::398     6e-53  39%  443 aa  DBP8_ASPOR RecName: Full=ATP-dependent RNA helicase dbp8;       
  268::609     7e-53  39%  862 aa  PRP5_PICGU RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   25::386     7e-53  34%  397 aa  IF4A_PICST RecName: Full=ATP-dependent RNA helicase eIF4A;       
   25::385     7e-53  32%  396 aa  IF4A_CANGA RecName: Full=ATP-dependent RNA helicase eIF4A;       
  270::599     7e-53  36%  801 aa  DRS1_SCLS1 RecName: Full=ATP-dependent RNA helicase drs1;       
   96::481     7e-53  39%  526 aa  DBP8_NEOFI RecName: Full=ATP-dependent RNA helicase dbp8;       
  197::558     7e-53  40%  614 aa  DBP3_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-3;       
   19::399     9e-53  34%  413 aa  IF4A8_TOBAC RecName: Full=Eukaryotic initiation factor 4A-8;       
  270::599     9e-53  36%  801 aa  DRS1_BOTFB RecName: Full=ATP-dependent RNA helicase drs1;       
   29::391     9e-53  34%  484 aa  DHH1_ASHGO RecName: Full=ATP-dependent RNA helicase DHH1;       
   77::453     1e-52  38%  547 aa  RH31_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 31;   
   43::400     1e-52  35%  414 aa  IF4A1_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-1;       
   41::398     1e-52  35%  412 aa  IF4A1_ARATH RecName: Full=Eukaryotic initiation factor 4A-1;       
   25::381     2e-52  33%  385 aa  IF4A_AJECN RecName: Full=ATP-dependent RNA helicase eIF4A;       
   19::399     2e-52  34%  413 aa  IF4A9_TOBAC RecName: Full=Eukaryotic initiation factor 4A-9;       
   40::399     2e-52  34%  413 aa  IF410_TOBAC RecName: Full=Eukaryotic initiation factor 4A-10;      
    7::354     2e-52  38%  521 aa  DDX49_DROME RecName: Full=Probable ATP-dependent RNA helicase
   91::482     2e-52  36%  932 aa  DBP10_ASPNC RecName: Full=ATP-dependent RNA helicase dbp10;        
   25::386     2e-52  33%  397 aa  IF4A_DEBHA RecName: Full=ATP-dependent RNA helicase eIF4A;       
   40::399     2e-52  35%  413 aa  IF4A7_TOBAC RecName: Full=Eukaryotic initiation factor 4A-7;       
   25::373     2e-52  34%  399 aa  FAL1_CANGA RecName: Full=ATP-dependent RNA helicase FAL1;       
  303::637     2e-52  36%  824 aa  DRS1_ASPNC RecName: Full=ATP-dependent RNA helicase drs1;       
   96::441     2e-52  35%  874 aa  DDX54_MOUSE RecName: Full=ATP-dependent RNA helicase DDX54;        
   65::420     2e-52  37%  875 aa  DDX10_CHICK RecName: Full=Probable ATP-dependent RNA helicase
  109::428     3e-52  38%  628 aa  RH9_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 9;     
  189::542     3e-52  38%  588 aa  PRP28_YEAST RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
   28::392     3e-52  35%  404 aa  IF4A_TRYCR RecName: Full=Probable eukaryotic initiation factor 4A; 
   93::457     3e-52  39%  523 aa  DBP8_ASPCL RecName: Full=ATP-dependent RNA helicase dbp8;       
  100::458     4e-52  37%  504 aa  RRP3_LODEL RecName: Full=ATP-dependent rRNA helicase RRP3;       
  274::637     4e-52  36%  875 aa  PRP5_PICST RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   43::404     4e-52  35%  414 aa  IF4A3_ORYSJ RecName: Full=Eukaryotic initiation factor 4A-3;       
   40::399     4e-52  34%  413 aa  IF4A2_NICPL RecName: Full=Eukaryotic initiation factor 4A-2;       
   40::399     4e-52  34%  413 aa  IF414_TOBAC RecName: Full=Eukaryotic initiation factor 4A-14;      
  536::922     4e-52  35%  974 aa  GLH2_CAEEL RecName: Full=ATP-dependent RNA helicase glh-2;       
  316::650     5e-52  36%  840 aa  DRS1_COCIM RecName: Full=ATP-dependent RNA helicase DRS1;       
   19::386     5e-52  37%  740 aa  DBP4_YARLI RecName: Full=ATP-dependent RNA helicase DBP4;       
  563::897     6e-52  37% 1194 aa  PRP5_NEUCR RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  561::897     6e-52  39% 1197 aa  PRP5_COCIM RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   24::385     6e-52  34%  396 aa  IF4A_PICGU RecName: Full=ATP-dependent RNA helicase eIF4A;       
  577::913     8e-52  39% 1211 aa  PRP5_ASPFU RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   98::444     8e-52  36%  498 aa  DBP3_ASPOR RecName: Full=ATP-dependent RNA helicase dbp3;       
  551::887     1e-51  39% 1181 aa  PRP5_ASPTN RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  556::892     1e-51  39% 1186 aa  PRP5_ASPOR RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  343::711     1e-51  37%  763 aa  GLH1_CAEEL RecName: Full=ATP-dependent RNA helicase glh-1;       
  238::599     1e-51  35%  816 aa  PRP5_ASHGO RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   28::392     1e-51  34%  404 aa  IF4A_TRYBB RecName: Full=Probable eukaryotic initiation factor 4A; 
   41::398     1e-51  34%  412 aa  IF4A2_ARATH RecName: Full=Eukaryotic initiation factor 4A-2;       
   59::410     2e-51  34%  441 aa  SUB2_ASPCL RecName: Full=ATP-dependent RNA helicase sub2;       
  559::895     2e-51  39% 1193 aa  PRP5_NEOFI RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  559::895     2e-51  39% 1192 aa  PRP5_ASPCL RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   43::400     2e-51  35%  414 aa  IF4A_WHEAT RecName: Full=Eukaryotic initiation factor 4A;       
   99::496     2e-51  38%  540 aa  DBP8_SCLS1 RecName: Full=ATP-dependent RNA helicase dbp8;       
   39::396     2e-51  36%  808 aa  DBP4_SCLS1 RecName: Full=ATP-dependent RNA helicase dbp4;       
  119::454     2e-51  39%  530 aa  DBP3_VANPO RecName: Full=ATP-dependent RNA helicase DBP3;       
  231::602     2e-51  38% 1091 aa  DDX54_DICDI RecName: Full=ATP-dependent RNA helicase ddx54;        
   53::398     2e-51  37%  793 aa  DBP4_GIBZE RecName: Full=ATP-dependent RNA helicase DBP4;       
  181::532     3e-51  39%  582 aa  PRP28_CANGA RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  257::612     3e-51  35%  754 aa  DRS1_SCHPO RecName: Full=ATP-dependent RNA helicase drs1;       
    5::386     3e-51  37%  444 aa  DBP8_LODEL RecName: Full=ATP-dependent RNA helicase DBP8;       
   93::434     3e-51  38%  498 aa  DBP3_EMENI RecName: Full=ATP-dependent RNA helicase dbp3;       
   59::407     4e-51  34%  441 aa  SUB2_NEOFI RecName: Full=ATP-dependent RNA helicase sub2;       
  344::704     4e-51  39%  811 aa  RH48_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 48;   
   25::395     4e-51  33%  396 aa  IF4A_VANPO RecName: Full=ATP-dependent RNA helicase eIF4A;       
   42::399     4e-51  34%  413 aa  IF411_TOBAC RecName: Full=Eukaryotic initiation factor 4A-11;      
  287::616     4e-51  35%  808 aa  DRS1_PHANO RecName: Full=ATP-dependent RNA helicase DRS1;       
   43::394     4e-51  37%  770 aa  DBP4_YEAST RecName: Full=ATP-dependent RNA helicase DBP4;       
   43::394     4e-51  37%  770 aa  DBP4_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP4;       
   57::404     4e-51  37%  823 aa  DBP4_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-4;       
   49::395     5e-51  36%  803 aa  DBP4_PHANO RecName: Full=ATP-dependent RNA helicase DBP4;       
   38::392     5e-51  37%  770 aa  DBP4_KLULA RecName: Full=ATP-dependent RNA helicase DBP4;       
  127::459     5e-51  38%  535 aa  DBP3_ASHGO RecName: Full=ATP-dependent RNA helicase DBP3;       
   60::408     7e-51  34%  442 aa  SUB2_AJECN RecName: Full=ATP-dependent RNA helicase SUB2;       
  549::885     7e-51  39% 1180 aa  PRP5_ASPNC RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   25::387     7e-51  32%  398 aa  FAL1_ASHGO RecName: Full=ATP-dependent RNA helicase FAL1;       
   55::400     7e-51  37%  825 aa  DBP4_CHAGB RecName: Full=ATP-dependent RNA helicase DBP4;       
   58::409     9e-51  34%  440 aa  SUB2_ASPNC RecName: Full=ATP-dependent RNA helicase sub2;       
   55::406     9e-51  34%  438 aa  SUB2_ASHGO RecName: Full=ATP-dependent RNA helicase SUB2;       
   59::407     9e-51  34%  442 aa  SUB22_VANPO RecName: Full=ATP-dependent RNA helicase SUB2-2;       
  402::722     9e-51  39%  989 aa  RH45_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 45;   
  546::904     1e-50  37% 1184 aa  PRP5_PHANO RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  177::550     1e-50  35%  782 aa  DDX21_RAT RecName: Full=Nucleolar RNA helicase 2;       
   54::431     1e-50  33%  437 aa  SUB2_KLULA RecName: Full=ATP-dependent RNA helicase SUB2;       
   55::412     1e-50  33%  443 aa  SUB2_COCIM RecName: Full=ATP-dependent RNA helicase SUB2;       
   59::408     1e-50  34%  441 aa  SUB2_ASPOR RecName: Full=ATP-dependent RNA helicase sub2;       
  431::765     1e-50  37% 1064 aa  PRP5_CHAGB RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  199::538     2e-50  41%  566 aa  DBP3_CHAGB RecName: Full=ATP-dependent RNA helicase DBP3;       
   58::406     3e-50  34%  441 aa  SUB21_VANPO RecName: Full=ATP-dependent RNA helicase SUB2-1;       
  105::460     3e-50  35%  537 aa  ROK1_PICGU RecName: Full=ATP-dependent RNA helicase ROK1;       
   53::412     3e-50  39%  536 aa  RH26_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 26;   
   24::396     3e-50  32%  396 aa  IF4A_KLULA RecName: Full=ATP-dependent RNA helicase eIF4A;       
   97::442     3e-50  34%  881 aa  DDX54_HUMAN RecName: Full=ATP-dependent RNA helicase DDX54;        
  197::580     3e-50  36%  626 aa  DBP8_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-8;       
   86::491     3e-50  38%  536 aa  DBP8_COCIM RecName: Full=ATP-dependent RNA helicase DBP8;       
  103::449     3e-50  37%  503 aa  DBP3_NEOFI RecName: Full=ATP-dependent RNA helicase dbp3;       
  127::513     3e-50  37%  960 aa  DBP10_ASHGO RecName: Full=ATP-dependent RNA helicase DBP10;        
   59::414     4e-50  34%  448 aa  SUB2_ASPFU RecName: Full=ATP-dependent RNA helicase sub2;       
  293::630     4e-50  36%  819 aa  DRS1_NEOFI RecName: Full=ATP-dependent RNA helicase drs1;       
   60::409     4e-50  36%  869 aa  DBP4_USTMA RecName: Full=ATP-dependent RNA helicase DBP4;       
   51::398     6e-50  34%  432 aa  RH56_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 56;   
   51::398     6e-50  34%  432 aa  RH15_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 15;   
  133::470     6e-50  36%  610 aa  HAS1_PHANO RecName: Full=ATP-dependent RNA helicase HAS1;       
  118::501     6e-50  36%  547 aa  DBP8_GIBZE RecName: Full=ATP-dependent RNA helicase DBP8;       
  130::447     6e-50  40%  523 aa  DBP3_YEAST RecName: Full=ATP-dependent RNA helicase DBP3;       
   32::396     7e-50  33%  406 aa  IF4A1_MACFA RecName: Full=Eukaryotic initiation factor 4A-I;       
  304::641     7e-50  36%  830 aa  DRS1_ASPFU RecName: Full=ATP-dependent RNA helicase drs1;       
  253::626     7e-50  35%  851 aa  DDX21_MOUSE RecName: Full=Nucleolar RNA helicase 2;       
   39::416     7e-50  35%  765 aa  DBP4_PICST RecName: Full=ATP-dependent RNA helicase DBP4;       
  130::447     7e-50  40%  523 aa  DBP3_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP3;       
   56::386     1e-49  38%  491 aa  RH36_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 36;   
  485::819     1e-49  37% 1114 aa  PRP5_SCLS1 RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  556::890     1e-49  37% 1151 aa  PRP5_BOTFB RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   71::440     1e-49  38%  508 aa  DBP8_PHANO RecName: Full=ATP-dependent RNA helicase DBP8;       
   43::387     1e-49  37%  765 aa  DBP4_CANGA RecName: Full=ATP-dependent RNA helicase DBP4;       
  178::517     1e-49  37%  575 aa  PRP28_YARLI RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  181::554     1e-49  33%  783 aa  DDX21_HUMAN RecName: Full=Nucleolar RNA helicase 2;       
   56::433     2e-49  34%  439 aa  SUB2_CANGA RecName: Full=ATP-dependent RNA helicase SUB2;       
  543::879     2e-49  38% 1173 aa  PRP5_EMENI RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  314::688     2e-49  35%  884 aa  PRP5_CANAL RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   25::380     2e-49  33%  398 aa  FAL1_KLULA RecName: Full=ATP-dependent RNA helicase FAL1;       
  304::637     2e-49  35%  826 aa  DRS1_ASPCL RecName: Full=ATP-dependent RNA helicase drs1;       
   62::423     2e-49  34%  456 aa  DBP5_USTMA RecName: Full=ATP-dependent RNA helicase DBP5;       
   23::379     2e-49  37%  593 aa  RH18_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 18;   
   33::397     2e-49  33%  407 aa  IF4A2_RAT RecName: Full=Eukaryotic initiation factor 4A-II;        
   33::397     2e-49  33%  407 aa  IF4A2_PONAB RecName: Full=Eukaryotic initiation factor 4A-II;      
   33::397     2e-49  33%  407 aa  IF4A2_MOUSE RecName: Full=Eukaryotic initiation factor 4A-II;      
   33::397     2e-49  33%  407 aa  IF4A2_HUMAN RecName: Full=Eukaryotic initiation factor 4A-II;      
   33::397     2e-49  33%  407 aa  IF4A2_BOVIN RecName: Full=Eukaryotic initiation factor 4A-II;      
   24::388     2e-49  33%  398 aa  IF4A1_RABIT RecName: Full=Eukaryotic initiation factor 4A-I;       
   32::396     2e-49  33%  406 aa  IF4A1_MOUSE RecName: Full=Eukaryotic initiation factor 4A-I;       
   32::396     2e-49  33%  406 aa  IF4A1_HUMAN RecName: Full=Eukaryotic initiation factor 4A-I;       
   32::396     2e-49  33%  406 aa  IF4A1_BOVIN RecName: Full=Eukaryotic initiation factor 4A-I;       
   71::416     2e-49  39%  875 aa  DDX10_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
   52::403     3e-49  33%  435 aa  SUB2_DEBHA RecName: Full=ATP-dependent RNA helicase SUB2;       
  111::541     3e-49  38%  602 aa  DBP8_USTMA RecName: Full=ATP-dependent RNA helicase DBP8;       
   63::411     4e-49  34%  446 aa  SUB2_YEAST RecName: Full=ATP-dependent RNA helicase SUB2;       
   63::411     4e-49  34%  446 aa  SUB2_YEAS7 RecName: Full=ATP-dependent RNA helicase SUB2;       
   34::398     4e-49  33%  408 aa  IF4A2_MACFA RecName: Full=Eukaryotic initiation factor 4A-II;      
   37::396     4e-49  33%  406 aa  IF4A1_PONAB RecName: Full=Eukaryotic initiation factor 4A-I;       
   71::416     4e-49  38%  875 aa  DDX10_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
   58::429     5e-49  33%  441 aa  SUB2_YARLI RecName: Full=ATP-dependent RNA helicase SUB2;       
   50::397     5e-49  34%  433 aa  SUB2_PICST RecName: Full=ATP-dependent RNA helicase SUB2;       
   51::399     5e-49  34%  434 aa  SUB2_CHAGB RecName: Full=ATP-dependent RNA helicase SUB2;       
  168::510     5e-49  36%  619 aa  RH35B_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 35B; 
  108::450     5e-49  34%  587 aa  HAS1_MAGGR RecName: Full=ATP-dependent RNA helicase HAS1;       
   97::439     5e-49  36%  493 aa  DBP3_ASPTN RecName: Full=ATP-dependent RNA helicase dbp3;       
   48::411     6e-49  31%  421 aa  IF4A_ASPOR RecName: Full=ATP-dependent RNA helicase eIF4A;       
   32::396     6e-49  33%  406 aa  IF4A1_PANTR RecName: Full=Eukaryotic initiation factor 4A-I;       
    3::367     6e-49  38%  453 aa  DBP8_SCHPO RecName: Full=ATP-dependent RNA helicase dbp8;       
   72::456     6e-49  38%  522 aa  DBP8_ASPNC RecName: Full=ATP-dependent RNA helicase dbp8;       
  300::674     1e-48  35%  720 aa  GLH3_CAEEL RecName: Full=ATP-dependent RNA helicase glh-3;       
   53::406     1e-48  32%  438 aa  SUB2_PHANO RecName: Full=ATP-dependent RNA helicase SUB2;       
  101::472     1e-48  33%  547 aa  ROK1_YARLI RecName: Full=ATP-dependent RNA helicase ROK1;       
   30::380     1e-48  33%  845 aa  RH29_ARATH RecName: Full=Putative DEAD-box ATP-dependent RNA
   33::397     1e-48  32%  407 aa  IF4A2_CHICK RecName: Full=Eukaryotic initiation factor 4A-II;      
  130::487     1e-48  35%  625 aa  HAS1_ASPCL RecName: Full=ATP-dependent RNA helicase has1;       
    4::377     1e-48  38%  431 aa  DBP8_YEAST RecName: Full=ATP-dependent RNA helicase DBP8;       
    4::377     1e-48  38%  431 aa  DBP8_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP8;       
   41::388     2e-48  32%  425 aa  UAP56_CAEEL RecName: Full=Spliceosome RNA helicase BAT1 homolog;   
   49::396     2e-48  34%  432 aa  SUB2_PICGU RecName: Full=ATP-dependent RNA helicase SUB2;       
  185::544     2e-48  34%  783 aa  DDX27_DICDI RecName: Full=Probable ATP-dependent RNA helicase
   90::446     2e-48  34%  482 aa  DBP5_YEAST RecName: Full=ATP-dependent RNA helicase DBP5;       
   90::446     2e-48  34%  482 aa  DBP5_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP5;       
   44::396     2e-48  36%  765 aa  DBP4_CANAL RecName: Full=ATP-dependent RNA helicase DBP4;       
   27::400     2e-48  36%  606 aa  SPB4_YEAST RecName: Full=ATP-dependent rRNA helicase SPB4;       
   27::400     2e-48  36%  606 aa  SPB4_YEAS7 RecName: Full=ATP-dependent rRNA helicase SPB4;       
  276::623     2e-48  35%  795 aa  DRS1_CHAGB RecName: Full=ATP-dependent RNA helicase DRS1;       
    8::384     2e-48  37%  437 aa  DBP8_CANGA RecName: Full=ATP-dependent RNA helicase DBP8;       
  157::486     2e-48  38%  564 aa  DBP3_CANAL RecName: Full=ATP-dependent RNA helicase DBP3;       
   79::419     2e-48  41%  878 aa  DBP10_PHANO RecName: Full=ATP-dependent RNA helicase DBP10;        
   46::392     3e-48  33%  427 aa  RH56_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 56;   
  239::580     3e-48  39%  622 aa  RH44_ARATH RecName: Full=Putative DEAD-box ATP-dependent RNA
   27::363     3e-48  34%  374 aa  FAL1_PHANO RecName: Full=ATP-dependent RNA helicase FAL1;       
   58::433     3e-48  33%  483 aa  DBP5_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-5;       
   46::392     4e-48  33%  427 aa  RH15_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 15;   
  109::449     4e-48  32%  489 aa  DHH1_ENCCU RecName: Full=ATP-dependent RNA helicase DHH1;       
   24::384     5e-48  32%  395 aa  IF4A_YEAST RecName: Full=ATP-dependent RNA helicase eIF4A;       
   24::384     5e-48  32%  395 aa  IF4A_YEAS7 RecName: Full=ATP-dependent RNA helicase eIF4A;       
  138::500     5e-48  37%  567 aa  DBP8_MAGGR RecName: Full=ATP-dependent RNA helicase DBP8;       
   59::407     7e-48  33%  438 aa  SUB2_ASPTN RecName: Full=ATP-dependent RNA helicase sub2;       
  380::728     7e-48  37%  850 aa  RH26_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 26;   
  155::476     7e-48  37%  539 aa  PRP28_KLULA RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
   42::394     9e-48  35%  754 aa  DBP4_PICGU RecName: Full=ATP-dependent RNA helicase DBP4;       
  136::450     9e-48  39%  526 aa  DBP3_PICST RecName: Full=ATP-dependent RNA helicase DBP3;       
   23::388     1e-47  36%  558 aa  RH49_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 49;   
  291::618     1e-47  37%  947 aa  RH45_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 45;   
  260::594     1e-47  38%  716 aa  RH31_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 31;   
   28::384     1e-47  34%  761 aa  DDX20_DANRE RecName: Full=Probable ATP-dependent RNA helicase
   59::424     1e-47  35%  479 aa  DBP5_CHAGB RecName: Full=ATP-dependent RNA helicase DBP5;       
  148::499     1e-47  34%  540 aa  DBP5_CANAL RecName: Full=ATP-dependent RNA helicase DBP5;       
  126::484     2e-47  35%  622 aa  HAS1_NEOFI RecName: Full=ATP-dependent RNA helicase has1;       
  108::458     2e-47  35%  590 aa  HAS1_GIBZE RecName: Full=ATP-dependent RNA helicase HAS1;       
   22::370     2e-47  32%  376 aa  YFML_BACSU RecName: Full=Putative ATP-dependent RNA helicase yfmL; 
  112::466     3e-47  33%  505 aa  RH41_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 41;   
  257::634     3e-47  33%  849 aa  PRP5_YEAST RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  257::634     3e-47  33%  849 aa  PRP5_YEAS7 RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  120::447     3e-47  36%  565 aa  HAS1_CANAL RecName: Full=ATP-dependent RNA helicase HAS1;       
  133::480     3e-47  35%  622 aa  HAS1_ASPFU RecName: Full=ATP-dependent RNA helicase has1;       
   30::393     5e-47  31%  403 aa  IF4A_DROME RecName: Full=Eukaryotic initiation factor 4A;       
  210::548     5e-47  34%  668 aa  DDX52_DICDI RecName: Full=Probable ATP-dependent RNA helicase
   44::396     5e-47  36%  775 aa  DBP4_LODEL RecName: Full=ATP-dependent RNA helicase DBP4;       
   50::398     6e-47  32%  433 aa  SUB2_LODEL RecName: Full=ATP-dependent RNA helicase SUB2;       
  112::474     8e-47  35%  604 aa  HAS1_COCIM RecName: Full=ATP-dependent RNA helicase HAS1;       
  170::518     8e-47  36%  596 aa  DDX52_BOVIN RecName: Full=Probable ATP-dependent RNA helicase
  278::650     1e-46  35%  872 aa  PRP5_VANPO RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  108::458     1e-46  34%  500 aa  DBP5_PICST RecName: Full=ATP-dependent RNA helicase DBP5;       
   14::400     1e-46  35%  637 aa  SPB4_LODEL RecName: Full=ATP-dependent rRNA helicase SPB4;       
   80::433     1e-46  36%  559 aa  HAS1_LODEL RecName: Full=ATP-dependent RNA helicase HAS1;       
   97::453     1e-46  35%  488 aa  DBP5_YARLI RecName: Full=ATP-dependent RNA helicase DBP5;       
  112::465     2e-46  35%  606 aa  HAS1_ASPNC RecName: Full=ATP-dependent RNA helicase has1;       
  205::521     2e-46  38%  589 aa  DDX59_RAT RecName: Full=Probable ATP-dependent RNA helicase DDX59; 
  211::591     2e-46  32%  796 aa  DDX27_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
   75::445     2e-46  36%  460 aa  DDX19_DROME RecName: Full=DEAD-box helicase Dbp80;       
  130::471     2e-46  33%  734 aa  DDX50_MOUSE RecName: Full=ATP-dependent RNA helicase DDX50;        
  118::468     2e-46  36%  484 aa  DDX25_MOUSE RecName: Full=ATP-dependent RNA helicase DDX25;        
   90::434     2e-46  40%  525 aa  DBP8_EMENI RecName: Full=ATP-dependent RNA helicase dbp8;       
   52::396     3e-46  32%  434 aa  SUB2_SCHPO RecName: Full=ATP-dependent RNA helicase uap56;       
  127::454     3e-46  35%  558 aa  ROK1_PICST RecName: Full=ATP-dependent RNA helicase ROK1;       
  127::452     3e-46  34%  553 aa  ROK1_LODEL RecName: Full=ATP-dependent RNA helicase ROK1;       
  112::460     3e-46  33%  569 aa  ROK1_ASHGO RecName: Full=ATP-dependent RNA helicase ROK1;       
  318::711     3e-46  34%  913 aa  PRP5_DEBHA RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   99::450     3e-46  33%  578 aa  HAS1_NEUCR RecName: Full=ATP-dependent RNA helicase has-1;       
    5::369     3e-46  35%  591 aa  DDX55_CHICK RecName: Full=ATP-dependent RNA helicase DDX55;        
  180::560     3e-46  32%  765 aa  DDX27_BOVIN RecName: Full=Probable ATP-dependent RNA helicase
  117::467     3e-46  36%  483 aa  DDX25_HUMAN RecName: Full=ATP-dependent RNA helicase DDX25;        
   91::436     4e-46  33%  568 aa  RH51_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 51;   
  156::502     4e-46  34%  633 aa  RH27_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 27;   
   78::426     4e-46  36%  563 aa  RH25_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 25;   
  117::467     4e-46  36%  483 aa  DDX25_RAT RecName: Full=ATP-dependent RNA helicase DDX25;       
   43::430     4e-46  34%  763 aa  DBP4_ASHGO RecName: Full=ATP-dependent RNA helicase DBP4;       
   39::391     5e-46  31%  427 aa  DDX39_RAT RecName: Full=ATP-dependent RNA helicase DDX39;       
   39::391     5e-46  31%  427 aa  DDX39_MOUSE RecName: Full=ATP-dependent RNA helicase DDX39;        
  117::467     5e-46  36%  483 aa  DDX25_BOVIN RecName: Full=ATP-dependent RNA helicase DDX25;        
  140::524     5e-46  38%  619 aa  DBP8_CRYNE RecName: Full=ATP-dependent RNA helicase DBP8;       
   30::393     5e-46  36%  768 aa  DBP4_VANPO RecName: Full=ATP-dependent RNA helicase DBP4;       
  113::449     7e-46  36%  550 aa  ROK1_DEBHA RecName: Full=ATP-dependent RNA helicase ROK1;       
  110::485     7e-46  36%  625 aa  RH39_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 39;   
   52::395     7e-46  36%  517 aa  HAS1_USTMA RecName: Full=ATP-dependent RNA helicase HAS1;       
  172::520     7e-46  36%  599 aa  DDX52_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
  133::474     7e-46  33%  737 aa  DDX50_HUMAN RecName: Full=ATP-dependent RNA helicase DDX50;        
  107::454     7e-46  34%  504 aa  DBP5_MAGGR RecName: Full=ATP-dependent RNA helicase DBP5;       
   60::424     9e-46  32%  442 aa  SUB2_CRYNE RecName: Full=ATP-dependent RNA helicase SUB2;       
  123::460     9e-46  35%  565 aa  ROK1_CANGA RecName: Full=ATP-dependent RNA helicase ROK1;       
  125::486     9e-46  33%  605 aa  HAS1_YARLI RecName: Full=ATP-dependent RNA helicase HAS1;       
  113::474     9e-46  33%  607 aa  HAS1_CRYNE RecName: Full=ATP-dependent RNA helicase HAS1;       
   61::396     1e-45  35%  481 aa  ROK1_SCHPO RecName: Full=ATP-dependent RNA helicase rok1;       
  114::492     1e-45  37%  621 aa  RH39_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 39;   
  232::629     1e-45  40%  851 aa  DDX31_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
   16::392     2e-45  31%  428 aa  UAP56_RAT RecName: Full=Spliceosome RNA helicase Bat1;       
   16::392     2e-45  31%  428 aa  UAP56_MOUSE RecName: Full=Spliceosome RNA helicase Bat1;       
   21::393     2e-45  34%  617 aa  SPB4_PICST RecName: Full=ATP-dependent rRNA helicase SPB4;       
   98::441     2e-45  34%  590 aa  RH27_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 27;   
   29::379     2e-45  34%  494 aa  HAS1_CANGA RecName: Full=ATP-dependent RNA helicase HAS1;       
   72::453     2e-45  33%  482 aa  DBP5_ASPNC RecName: Full=ATP-dependent RNA helicase dbp5;       
    2::350     2e-45  35%  450 aa  Y623_MYCPN RecName: Full=Probable ATP-dependent RNA helicase MG425
    2::372     2e-45  33%  449 aa  Y425_MYCGE RecName: Full=Probable ATP-dependent RNA helicase MG425;
   40::392     2e-45  31%  428 aa  UAP56_PONAB RecName: Full=Spliceosome RNA helicase BAT1;       
   40::392     2e-45  31%  428 aa  UAP56_PIG RecName: Full=Spliceosome RNA helicase BAT1;       
   40::392     2e-45  31%  428 aa  UAP56_PANTR RecName: Full=Spliceosome RNA helicase BAT1;       
   40::392     2e-45  31%  428 aa  UAP56_MACMU RecName: Full=Spliceosome RNA helicase BAT1;       
   40::392     2e-45  31%  428 aa  UAP56_HUMAN RecName: Full=Spliceosome RNA helicase BAT1;       
   40::392     2e-45  31%  428 aa  UAP56_CANFA RecName: Full=Spliceosome RNA helicase BAT1;       
  138::466     2e-45  34%  578 aa  ROK1_CANAL RecName: Full=ATP-dependent RNA helicase CHR1;       
   26::381     2e-45  35%  766 aa  DBP4_DEBHA RecName: Full=ATP-dependent RNA helicase DBP4;       
  108::424     2e-45  38%  503 aa  DBP3_ASPCL RecName: Full=ATP-dependent RNA helicase dbp3;       
   40::392     3e-45  31%  428 aa  UAP56_CHICK RecName: Full=Spliceosome RNA helicase BAT1;       
   40::392     3e-45  31%  428 aa  UAP56_BOVIN RecName: Full=Spliceosome RNA helicase BAT1;       
   39::391     3e-45  31%  427 aa  DDX39_HUMAN RecName: Full=ATP-dependent RNA helicase DDX39;        
  139::491     3e-45  36%  878 aa  DDX10_DICDI RecName: Full=Probable ATP-dependent RNA helicase
   60::417     4e-45  33%  451 aa  SUB2_EMENI RecName: Full=ATP-dependent RNA helicase sub2;       
   67::420     4e-45  35%  470 aa  DBP5_SCLS1 RecName: Full=ATP-dependent RNA helicase dbp5;       
   53::402     6e-45  32%  436 aa  SUB2_MAGGR RecName: Full=ATP-dependent RNA helicase SUB2;       
   89::463     6e-45  35%  478 aa  DD19A_MOUSE RecName: Full=ATP-dependent RNA helicase DDX19A;       
   89::463     7e-45  34%  478 aa  DD19A_HUMAN RecName: Full=ATP-dependent RNA helicase DDX19A;       
   90::441     7e-45  33%  482 aa  DBP5_PICGU RecName: Full=ATP-dependent RNA helicase DBP5;       
   19::389     9e-45  35%  647 aa  RH18_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 18;   
  247::586     9e-45  33%  812 aa  PRP5_KLULA RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   95::467     9e-45  34%  483 aa  DDX25_XENLA RecName: Full=ATP-dependent RNA helicase DDX25;        
   89::463     9e-45  35%  478 aa  DD19A_BOVIN RecName: Full=ATP-dependent RNA helicase DDX19A;       
   98::427     1e-44  36%  488 aa  DBP5_GIBZE RecName: Full=ATP-dependent RNA helicase DBP5;       
  104::454     2e-44  35%  568 aa  HAS1_DEBHA RecName: Full=ATP-dependent RNA helicase HAS1;       
  177::521     2e-44  36%  598 aa  DDX52_RAT RecName: Full=Probable ATP-dependent RNA helicase DDX52; 
   49::473     2e-44  33%  849 aa  DDX20_DICDI RecName: Full=Probable ATP-dependent RNA helicase
   71::420     2e-44  35%  470 aa  DBP5_BOTFB RecName: Full=ATP-dependent RNA helicase dbp5;       
   35::421     3e-44  31%  444 aa  SUB2_SCLS1 RecName: Full=ATP-dependent RNA helicase sub2;       
   18::379     3e-44  34%  617 aa  SPB4_CANGA RecName: Full=ATP-dependent rRNA helicase SPB4;       
  121::466     3e-44  34%  602 aa  DDX18_DICDI RecName: Full=Probable ATP-dependent RNA helicase
    4::378     3e-44  35%  431 aa  DBP8_VANPO RecName: Full=ATP-dependent RNA helicase DBP8;       
  121::469     4e-44  34%  596 aa  HAS1_ASPOR RecName: Full=ATP-dependent RNA helicase has1;       
  173::521     4e-44  35%  598 aa  DDX52_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
   90::464     4e-44  34%  479 aa  DD19B_HUMAN RecName: Full=ATP-dependent RNA helicase DDX19B;       
   67::448     4e-44  33%  477 aa  DBP5_EMENI RecName: Full=ATP-dependent RNA helicase dbp5;       
   99::453     5e-44  36%  567 aa  HAS1_PICST RecName: Full=ATP-dependent RNA helicase HAS1;       
  105::455     1e-43  32%  586 aa  HAS1_CHAGB RecName: Full=ATP-dependent RNA helicase HAS1;       
   17::395     1e-43  34%  631 aa  SPB41_CANAL RecName: Full=ATP-dependent rRNA helicase SPB41;       
   82::409     1e-43  37%  501 aa  RH36_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 36;   
  136::471     1e-43  35%  511 aa  DBP5_LODEL RecName: Full=ATP-dependent RNA helicase DBP5;       
   21::395     2e-43  34%  631 aa  SPB42_CANAL RecName: Full=ATP-dependent rRNA helicase SPB42;       
  144::466     2e-43  35%  541 aa  RH57_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 57;   
  108::524     3e-43  30%  551 aa  RH47_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 47;   
   14::368     3e-43  36%  613 aa  DDX55_DROME RecName: Full=Probable ATP-dependent RNA helicase DDX55
   16::381     4e-43  33%  601 aa  SPB4_PICGU RecName: Full=ATP-dependent rRNA helicase SPB4;       
   41::374     4e-43  35%  504 aa  HAS1_ASHGO RecName: Full=ATP-dependent RNA helicase HAS1;       
   16::369     4e-43  35%  601 aa  DDX55_BOVIN RecName: Full=ATP-dependent RNA helicase DDX55;        
    5::340     5e-43  36%  463 aa  SPB4_ENCCU RecName: Full=ATP-dependent rRNA helicase SPB4;       
  115::461     5e-43  35%  609 aa  HAS1_EMENI RecName: Full=ATP-dependent RNA helicase has1;       
   16::369     5e-43  35%  600 aa  DDX55_HUMAN RecName: Full=ATP-dependent RNA helicase DDX55;        
  134::471     5e-43  33%  503 aa  DBP5_SCHPO RecName: Full=ATP-dependent RNA helicase dbp5;       
  253::590     7e-43  32%  816 aa  PRP5_CANGA RecName: Full=Pre-mRNA-processing ATP-dependent RNA
   94::456     7e-43  32%  576 aa  HAS1_ASPTN RecName: Full=ATP-dependent RNA helicase has1;       
   76::481     7e-43  33%  487 aa  DBP5_ASPTN RecName: Full=ATP-dependent RNA helicase dbp5;       
  114::489     9e-43  36%  658 aa  MS116_ASHGO RecName: Full=ATP-dependent RNA helicase MSS116,
   20::377     9e-43  33%  505 aa  HAS1_YEAST RecName: Full=ATP-dependent RNA helicase HAS1;       
   20::369     9e-43  35%  593 aa  DDX55_DANRE RecName: Full=ATP-dependent RNA helicase DDX55;        
   33::369     1e-42  34%  497 aa  HAS1_KLULA RecName: Full=ATP-dependent RNA helicase HAS1;       
   96::435     1e-42  38%  526 aa  DBP8_ASPFU RecName: Full=ATP-dependent RNA helicase dbp8;       
   75::447     1e-42  33%  489 aa  DBP5_ASPFU RecName: Full=ATP-dependent RNA helicase dbp5;       
   88::434     2e-42  35%  590 aa  RH51_ORYSJ RecName: Full=Putative DEAD-box ATP-dependent RNA
   90::470     2e-42  31%  495 aa  DBP5_COCIM RecName: Full=ATP-dependent RNA helicase DBP5;       
   16::369     2e-42  36%  594 aa  DDX55_XENLA RecName: Full=ATP-dependent RNA helicase DDX55;        
   29::447     2e-42  35%  605 aa  DBP9_ASPOR RecName: Full=ATP-dependent RNA helicase dbp9;       
   75::447     2e-42  33%  489 aa  DBP5_NEOFI RecName: Full=ATP-dependent RNA helicase dbp5;       
  186::618     3e-42  34%  832 aa  RH13_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 13;   
  186::618     3e-42  34%  832 aa  RH13_ORYSI RecName: Full=DEAD-box ATP-dependent RNA helicase 13;   
  137::515     3e-42  35%  692 aa  MS116_LODEL RecName: Full=ATP-dependent RNA helicase MSS116,
  107::440     3e-42  35%  569 aa  HAS1_PICGU RecName: Full=ATP-dependent RNA helicase HAS1;       
   36::389     6e-42  30%  424 aa  UAP56_DROME RecName: Full=ATP-dependent RNA helicase WM6;       
  121::458     6e-42  33%  564 aa  ROK1_YEAS7 RecName: Full=ATP-dependent RNA helicase ROK1;       
  204::591     6e-42  35%  782 aa  MAK5_CANAL RecName: Full=ATP-dependent RNA helicase MAK5;       
  121::458     7e-42  33%  564 aa  ROK1_YEAST RecName: Full=ATP-dependent RNA helicase ROK1;       
  123::458     7e-42  34%  493 aa  DBP5_DEBHA RecName: Full=ATP-dependent RNA helicase DBP5;       
  127::471     1e-41  34%  540 aa  RH57_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 57;   
   16::369     1e-41  35%  600 aa  DDX55_MOUSE RecName: Full=ATP-dependent RNA helicase DDX55;        
   58::418     1e-41  32%  825 aa  DDX20_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
   75::456     1e-41  33%  487 aa  DBP5_ASPCL RecName: Full=ATP-dependent RNA helicase dbp5;       
   73::419     1e-41  35%  739 aa  RH32_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 32;   
  204::599     1e-41  38%  790 aa  MAK5_DEBHA RecName: Full=ATP-dependent RNA helicase MAK5;       
   76::448     1e-41  33%  487 aa  DBP5_ASPOR RecName: Full=ATP-dependent RNA helicase dbp5;       
  129::548     2e-41  30%  573 aa  RH47A_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 47A; 
  735::1109    2e-41  34% 1156 aa  GLH4_CAEEL RecName: Full=ATP-dependent RNA helicase glh-4;       
   64::417     2e-41  32%  824 aa  DDX20_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
    8::436     2e-41  31%  546 aa  DDX56_BOVIN RecName: Full=Probable ATP-dependent RNA helicase
  132::469     3e-41  32%  579 aa  ROK1_KLULA RecName: Full=ATP-dependent RNA helicase ROK1;       
   31::450     3e-41  37%  609 aa  RH17_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 17;   
  186::557     4e-41  30%  760 aa  DDX27_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
   14::390     5e-41  34%  614 aa  SPB4_DEBHA RecName: Full=ATP-dependent rRNA helicase SPB4;       
  214::631     6e-41  37%  805 aa  MAK5_NEUCR RecName: Full=ATP-dependent RNA helicase mak-5;       
  226::629     6e-41  36%  855 aa  MAK5_LODEL RecName: Full=ATP-dependent RNA helicase MAK5;       
   82::428     8e-41  34%  773 aa  RH32_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 32;   
  148::582     8e-41  37%  769 aa  DBP7_COCIM RecName: Full=ATP-dependent RNA helicase DBP7;       
  130::467     1e-40  32%  570 aa  ROK1_VANPO RecName: Full=ATP-dependent RNA helicase ROK1;       
  123::528     1e-40  39%  593 aa  DBP6_ASPNC RecName: Full=ATP-dependent RNA helicase dbp6;       
  217::614     1e-40  37%  779 aa  MAK5_MAGGR RecName: Full=ATP-dependent RNA helicase MAK5;       
  112::469     1e-40  32%  504 aa  DBP5_CANGA RecName: Full=ATP-dependent RNA helicase DBP5;       
  129::548     2e-40  30%  573 aa  RH47B_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 47B; 
   25::441     2e-40  36%  591 aa  RH17_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 17;   
   44::415     2e-40  33%  425 aa  IF4A_ENCCU RecName: Full=ATP-dependent RNA helicase eIF4A;       
  116::505     2e-40  36%  546 aa  DDX28_MACFA RecName: Full=Probable ATP-dependent RNA helicase
  181::538     2e-40  31%  680 aa  DDX18_DROME RecName: Full=Probable ATP-dependent RNA helicase
   77::427     2e-40  34%  467 aa  DBP5_ASHGO RecName: Full=ATP-dependent RNA helicase DBP5;       
    6::354     2e-40  33%  452 aa  DBP4_ENCCU RecName: Full=ATP-dependent RNA helicase DBP4;       
   80::424     4e-40  34%  578 aa  HAS1_SCHPO RecName: Full=ATP-dependent RNA helicase has1;       
   49::449     4e-40  33%  597 aa  DBP9_PHANO RecName: Full=ATP-dependent RNA helicase DBP9;       
  171::576     7e-40  38%  754 aa  MAK5_PICGU RecName: Full=ATP-dependent RNA helicase MAK5;       
  166::508     7e-40  34%  660 aa  DDX18_MOUSE RecName: Full=ATP-dependent RNA helicase DDX18;        
  129::565     7e-40  38%  755 aa  DBP7_ASPCL RecName: Full=ATP-dependent RNA helicase dbp7;       
   18::377     9e-40  34%  607 aa  SPB4_VANPO RecName: Full=ATP-dependent rRNA helicase SPB4;       
  190::606     9e-40  33%  832 aa  RH13_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 13;   
   82::436     1e-39  37%  527 aa  DBP8_ASPTN RecName: Full=ATP-dependent RNA helicase dbp8;       
    2::240     2e-39  36%  253 aa  IF4A6_TOBAC RecName: Full=Eukaryotic initiation factor 4A-6;       
  138::556     2e-39  36%  733 aa  DBP7_PICST RecName: Full=ATP-dependent RNA helicase DBP7;       
  146::497     2e-39  33%  546 aa  DBP5_CRYNE RecName: Full=ATP-dependent RNA helicase DBP5;       
  202::591     2e-39  36%  780 aa  MAK5_SCLS1 RecName: Full=ATP-dependent RNA helicase mak5;       
   18::377     3e-39  33%  596 aa  SPB4_KLULA RecName: Full=ATP-dependent rRNA helicase SPB4;       
   89::451     3e-39  31%  496 aa  RH38_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 38;   
  122::531     3e-39  33%  648 aa  MAK5_SCHPO RecName: Full=ATP-dependent RNA helicase mak5;       
   90::418     3e-39  34%  465 aa  DDX19_DICDI RecName: Full=ATP-dependent RNA helicase ddx19;        
    4::382     3e-39  34%  435 aa  DBP8_ASHGO RecName: Full=ATP-dependent RNA helicase DBP8;       
  235::642     3e-39  37%  799 aa  DBP7_YARLI RecName: Full=ATP-dependent RNA helicase DBP7;       
   87::466     3e-39  31%  497 aa  DBP5_AJECN RecName: Full=ATP-dependent RNA helicase DBP5;       
  116::505     3e-39  35%  540 aa  DDX28_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
  135::586     3e-39  35%  769 aa  DBP7_ASPTN RecName: Full=ATP-dependent RNA helicase dbp7;       
   25::406     5e-39  32%  638 aa  SPB4_ASPOR RecName: Full=ATP-dependent rRNA helicase spb4;       
  249::665     5e-39  36%  817 aa  MAK5_PHANO RecName: Full=ATP-dependent RNA helicase MAK5;       
   40::355     5e-39  32%  355 aa  IF413_TOBAC RecName: Full=Eukaryotic initiation factor 4A-13;      
  131::575     5e-39  35%  758 aa  DBP7_NEOFI RecName: Full=ATP-dependent RNA helicase dbp7;       
   18::405     6e-39  32%  599 aa  SPB4_ASHGO RecName: Full=ATP-dependent rRNA helicase SPB4;       
  113::512     8e-39  31%  664 aa  MS116_YEAST RecName: Full=ATP-dependent RNA helicase MSS116,
  131::575     8e-39  36%  758 aa  DBP7_ASPFU RecName: Full=ATP-dependent RNA helicase dbp7;       
   62::423     8e-39  33%  859 aa  DBP4_CRYNE RecName: Full=ATP-dependent RNA helicase DBP4;       
   45::449     1e-38  37%  550 aa  MS116_PHANO RecName: Full=ATP-dependent RNA helicase MSS116,
   25::406     2e-38  33%  638 aa  SPB4_EMENI RecName: Full=ATP-dependent rRNA helicase spb4;       
  191::518     2e-38  33%  670 aa  DDX18_HUMAN RecName: Full=ATP-dependent RNA helicase DDX18;        
  199::614     3e-38  38%  763 aa  MAK5_VANPO RecName: Full=ATP-dependent RNA helicase MAK5;       
   99::434     3e-38  32%  469 aa  DBP5_KLULA RecName: Full=ATP-dependent RNA helicase DBP5;       
   19::449     5e-38  33%  607 aa  DBP9_COCIM RecName: Full=ATP-dependent RNA helicase DBP9;       
  340::673     7e-38  34%  798 aa  RH48_ARATH RecName: Full=Probable DEAD-box ATP-dependent RNA
  140::547     7e-38  33%  709 aa  DBP7_SCHPO RecName: Full=ATP-dependent RNA helicase dbp7;       
   51::469     9e-38  31%  626 aa  RH16_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 16;   
  187::596     9e-38  37%  772 aa  MAK5_AJECN RecName: Full=ATP-dependent RNA helicase MAK5;       
   25::406     1e-37  34%  639 aa  SPB4_ASPTN RecName: Full=ATP-dependent rRNA helicase spb4;       
  139::581     1e-37  37%  771 aa  DBP7_ASPNC RecName: Full=ATP-dependent RNA helicase dbp7;       
    2::380     1e-37  32%  435 aa  DBP8_KLULA RecName: Full=ATP-dependent RNA helicase DBP8;       
  387::720     2e-37  34%  845 aa  RH33_ARATH RecName: Full=Putative DEAD-box ATP-dependent RNA
  173::535     3e-37  31%  666 aa  MS116_CANGA RecName: Full=ATP-dependent RNA helicase MSS116,
  152::568     3e-37  33%  744 aa  DBP7_GIBZE RecName: Full=ATP-dependent RNA helicase DBP7;       
   25::380     6e-37  33%  625 aa  SPB4_SCLS1 RecName: Full=ATP-dependent rRNA helicase spb4;       
   99::462     6e-37  33%  633 aa  MS116_ASPOR RecName: Full=ATP-dependent RNA helicase mss116,
  145::506     9e-37  32%  685 aa  MS116_KLULA RecName: Full=ATP-dependent RNA helicase MSS116,
   91::476     1e-36  32%  655 aa  MS116_ASPFU RecName: Full=ATP-dependent RNA helicase mss116,
  221::622     2e-36  33%  836 aa  MAK5_PICST RecName: Full=ATP-dependent RNA helicase MAK5;       
  116::505     2e-36  35%  540 aa  DDX28_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
   25::406     2e-36  32%  640 aa  SPB4_NEOFI RecName: Full=ATP-dependent rRNA helicase spb4;       
   45::393     2e-36  36%  535 aa  MS116_SCHPO RecName: Full=ATP-dependent RNA helicase mss116,
  181::598     2e-36  33%  757 aa  MAK5_ASPOR RecName: Full=ATP-dependent RNA helicase mak5;       
   14::374     4e-36  33%  626 aa  SPB4_YARLI RecName: Full=ATP-dependent rRNA helicase SPB4;       
   25::406     4e-36  32%  640 aa  SPB4_ASPFU RecName: Full=ATP-dependent rRNA helicase spb4;       
  192::599     4e-36  34%  766 aa  MAK5_ASPNC RecName: Full=ATP-dependent RNA helicase mak5;       
    4::66      4e-36  39%  740 aa  DDX1_CHICK RecName: Full=ATP-dependent RNA helicase DDX1;       
  230::568     4e-36  33%  637 aa  DBP6_VANPO RecName: Full=ATP-dependent RNA helicase DBP6;       
   95::482     5e-36  31%  505 aa  RH38_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 38;   
  195::641     5e-36  33%  783 aa  MAK5_COCIM RecName: Full=ATP-dependent RNA helicase MAK5;       
    5::333     5e-36  35%  610 aa  DBP9_EMENI RecName: Full=ATP-dependent RNA helicase dbp9;       
    4::66      6e-36  38%  740 aa  DDX1_BOVIN RecName: Full=ATP-dependent RNA helicase DDX1;       
  352::740     8e-36  42%  975 aa  Y8611_DROME RecName: Full=Probable ATP-dependent RNA helicase
    8::413     8e-36  30%  546 aa  DDX56_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
  195::595     8e-36  35%  652 aa  DDX51_DANRE RecName: Full=ATP-dependent RNA helicase DDX51;        
   22::414     1e-35  33%  633 aa  SPB4_PHANO RecName: Full=ATP-dependent rRNA helicase SPB4;       
   28::385     1e-35  34%  637 aa  SPB4_GIBZE RecName: Full=ATP-dependent rRNA helicase SPB4;       
  178::579     1e-35  35%  773 aa  MAK5_YEAST RecName: Full=ATP-dependent RNA helicase MAK5;       
  174::575     1e-35  35%  769 aa  MAK5_YEAS7 RecName: Full=ATP-dependent RNA helicase MAK5;       
    4::66      1e-35  38%  740 aa  DDX1_RAT RecName: Full=ATP-dependent RNA helicase DDX1;       
    4::66      1e-35  39%  740 aa  DDX1_PONAB RecName: Full=ATP-dependent RNA helicase DDX1;       
    4::66      1e-35  39%  740 aa  DDX1_MACFA RecName: Full=ATP-dependent RNA helicase DDX1;       
    4::66      1e-35  39%  740 aa  DDX1_HUMAN RecName: Full=ATP-dependent RNA helicase DDX1;       
    5::445     1e-35  35%  625 aa  DBP9_AJECN RecName: Full=ATP-dependent RNA helicase DBP9;       
   25::386     1e-35  33%  642 aa  SPB4_ASPNC RecName: Full=ATP-dependent rRNA helicase spb4;       
   25::386     1e-35  34%  639 aa  SPB4_ASPCL RecName: Full=ATP-dependent rRNA helicase spb4;       
    4::66      1e-35  39%  740 aa  DDX1_MOUSE RecName: Full=ATP-dependent RNA helicase DDX1;       
  110::499     1e-35  40%  908 aa  DBP10_CANAL RecName: Full=ATP-dependent RNA helicase DBP10;        
   26::363     2e-35  33%  577 aa  DDX55_CAEBR RecName: Full=Probable ATP-dependent RNA helicase DDX55
  120::541     2e-35  38%  977 aa  DBP10_VANPO RecName: Full=ATP-dependent RNA helicase DBP10;        
   24::314     3e-35  36%  465 aa  RH55_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 55;   
  174::620     3e-35  33%  772 aa  MAK5_CRYNE RecName: Full=ATP-dependent RNA helicase MAK5;       
   26::399     4e-35  30%  578 aa  DDX55_CAEEL RecName: Full=Probable ATP-dependent RNA helicase DDX55
  144::591     4e-35  33%  778 aa  DBP7_EMENI RecName: Full=ATP-dependent RNA helicase dbp7;       
  217::621     5e-35  34%  783 aa  MAK5_GIBZE RecName: Full=ATP-dependent RNA helicase MAK5;       
  132::357     7e-35  37%  948 aa  DBP10_LODEL RecName: Full=ATP-dependent RNA helicase DBP10;        
   16::472     9e-35  34%  621 aa  DBP9_ASPCL RecName: Full=ATP-dependent RNA helicase dbp9;       
  123::554     9e-35  34%  710 aa  DBP7_ASHGO RecName: Full=ATP-dependent RNA helicase DBP7;       
    8::401     1e-34  29%  547 aa  DDX56_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
  198::618     2e-34  35%  777 aa  MAK5_ASPFU RecName: Full=ATP-dependent RNA helicase mak5;       
  238::606     2e-34  33%  641 aa  RH50_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 50;   
   16::462     2e-34  35%  619 aa  DBP9_NEOFI RecName: Full=ATP-dependent RNA helicase dbp9;       
  142::535     2e-34  33%  591 aa  DBP6_PICST RecName: Full=ATP-dependent RNA helicase DBP6;       
   53::492     3e-34  35%  649 aa  DBP9_ASPFU RecName: Full=ATP-dependent RNA helicase dbp9;       
   94::487     3e-34  32%  670 aa  RH16_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 16;   
  167::576     3e-34  35%  752 aa  MAK5_ASHGO RecName: Full=ATP-dependent RNA helicase MAK5;       
    4::66      4e-34  38%  727 aa  DDX1_DROME RecName: Full=ATP-dependent RNA helicase Ddx1;       
    5::470     4e-34  35%  619 aa  DBP9_ASPTN RecName: Full=ATP-dependent RNA helicase dbp9;       
  118::536     4e-34  35%  995 aa  DBP10_YEAST RecName: Full=ATP-dependent RNA helicase DBP10;        
  118::536     4e-34  35%  995 aa  DBP10_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP10;        
  189::607     6e-34  32%  774 aa  MAK5_ASPTN RecName: Full=ATP-dependent RNA helicase mak5;       
    4::66      6e-34  37%  740 aa  DDX1_XENLA RecName: Full=ATP-dependent RNA helicase DDX1;       
    3::389     7e-34  31%  606 aa  SPB4_SCHPO RecName: Full=ATP-dependent rRNA helicase spb4;       
    4::66      7e-34  38%  740 aa  DDX1_XENTR RecName: Full=ATP-dependent RNA helicase DDX1;       
  193::574     1e-33  32%  631 aa  DBP6_PICGU RecName: Full=ATP-dependent RNA helicase DBP6;       
  138::556     1e-33  34%  806 aa  DBP7_CHAGB RecName: Full=ATP-dependent RNA helicase DBP7;       
   26::407     2e-33  32%  646 aa  SPB4_CHAGB RecName: Full=ATP-dependent rRNA helicase SPB4;       
   25::381     2e-33  31%  626 aa  SPB4_BOTFB RecName: Full=ATP-dependent rRNA helicase spb4;       
  202::611     2e-33  34%  770 aa  MAK5_EMENI RecName: Full=ATP-dependent RNA helicase mak5;       
  301::702     2e-33  36%  859 aa  DDX24_PONAB RecName: Full=ATP-dependent RNA helicase DDX24;        
   28::389     3e-33  33%  654 aa  SPB4_NEUCR RecName: Full=ATP-dependent rRNA helicase spb-4;        
  195::582     3e-33  38%  639 aa  DDX51_MOUSE RecName: Full=ATP-dependent RNA helicase DDX51;        
  168::541     3e-33  37%  604 aa  DBP6_SCHPO RecName: Full=ATP-dependent RNA helicase dbp6;       
  189::276     4e-33  38%  857 aa  DDX24_MOUSE RecName: Full=ATP-dependent RNA helicase DDX24;        
   77::423     4e-33  30%  471 aa  DBP5_PHANO RecName: Full=ATP-dependent RNA helicase DBP5;       
  134::530     5e-33  34%  620 aa  ROK1_CRYNE RecName: Full=ATP-dependent RNA helicase ROK1;       
   32::398     6e-33  33%  676 aa  SPB4_AJECN RecName: Full=ATP-dependent rRNA helicase SPB4;       
  223::609     6e-33  37%  666 aa  DDX51_HUMAN RecName: Full=ATP-dependent RNA helicase DDX51;        
  315::702     6e-33  36%  859 aa  DDX24_HUMAN RecName: Full=ATP-dependent RNA helicase DDX24;        
  138::567     6e-33  35%  814 aa  DBP7_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-7;       
   16::332     8e-33  33%  616 aa  DBP9_ASPNC RecName: Full=ATP-dependent RNA helicase dbp9;       
  182::591     1e-32  34%  630 aa  DBP6_KLULA RecName: Full=ATP-dependent RNA helicase DBP6;       
   19::428     1e-32  31%  597 aa  DBP9_VANPO RecName: Full=ATP-dependent RNA helicase DBP9;       
  198::618     2e-32  33%  777 aa  MAK5_NEOFI RecName: Full=ATP-dependent RNA helicase mak5;       
   97::472     2e-32  33%  676 aa  DBP9_NEUCR RecName: Full=ATP-dependent RNA helicase dbp-9;       
  179::588     2e-32  34%  607 aa  DBP6_YARLI RecName: Full=ATP-dependent RNA helicase DBP6;       
   36::449     2e-32  37%  615 aa  DBP9_GIBZE RecName: Full=ATP-dependent RNA helicase DBP9;       
   27::421     2e-32  31%  586 aa  DBP9_DEBHA RecName: Full=ATP-dependent RNA helicase DBP9;       
   87::460     3e-32  32%  472 aa  RH58_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 58,
  211::619     3e-32  36%  796 aa  MAK5_KLULA RecName: Full=ATP-dependent RNA helicase MAK5;       
    2::62      3e-32  38%  765 aa  DDX1_DICDI RecName: Full=Probable ATP-dependent RNA helicase ddx1; 
   28::367     4e-32  36%  626 aa  SPB4_COCIM RecName: Full=ATP-dependent rRNA helicase SPB4;       
   52::418     4e-32  35%  438 aa  RH58_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 58,
    5::453     4e-32  36%  607 aa  DBP9_BOTFB RecName: Full=ATP-dependent RNA helicase dbp9;       
  186::548     1e-31  32%  606 aa  DBP6_CANAL RecName: Full=ATP-dependent RNA helicase DBP6;       
  146::577     1e-31  37% 1154 aa  DBP10_USTMA RecName: Full=ATP-dependent RNA helicase DBP10;        
   82::443     2e-31  38%  714 aa  MS116_PICGU RecName: Full=ATP-dependent RNA helicase MSS116,
    5::406     2e-31  28%  544 aa  DBP9_YARLI RecName: Full=ATP-dependent RNA helicase DBP9;       
  185::615     3e-31  32%  774 aa  MAK5_ASPCL RecName: Full=ATP-dependent RNA helicase mak5;       
    4::453     3e-31  38%  607 aa  DBP9_SCLS1 RecName: Full=ATP-dependent RNA helicase dbp9;       
   10::335     3e-31  29%  595 aa  DBP9_SCHPO RecName: Full=ATP-dependent RNA helicase dbp9;       
  162::548     6e-31  32%  733 aa  MAK5_CANGA RecName: Full=ATP-dependent RNA helicase MAK5;       
   42::421     8e-31  32%  586 aa  DBP9_PICGU RecName: Full=ATP-dependent RNA helicase DBP9;       
   25::473     1e-30  38%  685 aa  DDX56_DICDI RecName: Full=Probable ATP-dependent RNA helicase
  123::552     1e-30  34%  715 aa  DBP7_CANGA RecName: Full=ATP-dependent RNA helicase DBP7;       
  180::517     1e-30  33%  576 aa  DBP6_DEBHA RecName: Full=ATP-dependent RNA helicase DBP6;       
  193::610     4e-30  34%  738 aa  ROK1_ASPCL RecName: Full=ATP-dependent RNA helicase rok1;       
  372::728     4e-30  31%  781 aa  RH50_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 50;   
  248::588     5e-30  30%  651 aa  DBP6_CANGA RecName: Full=ATP-dependent RNA helicase DBP6;       
  216::556     5e-30  31%  607 aa  DBP6_ASHGO RecName: Full=ATP-dependent RNA helicase DBP6;       
   97::442     9e-30  35%  668 aa  MS116_CANAL RecName: Full=ATP-dependent RNA helicase MSS116,
  272::609     1e-29  34%  663 aa  DBP6_LODEL RecName: Full=ATP-dependent RNA helicase DBP6;       
  134::573     1e-29  32%  732 aa  DBP7_VANPO RecName: Full=ATP-dependent RNA helicase DBP7;       
    1::409     2e-29  29%  574 aa  DBP9_CANAL RecName: Full=ATP-dependent RNA helicase DBP9;       
  223::563     3e-29  28%  697 aa  DDX5_DICDI RecName: Full=Probable ATP-dependent RNA helicase ddx5; 
    1::415     4e-29  29%  581 aa  DBP9_PICST RecName: Full=ATP-dependent RNA helicase DBP9;       
  145::571     1e-28  34%  742 aa  DBP7_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP7;       
   48::461     4e-28  32%  636 aa  DBP9_MAGGR RecName: Full=ATP-dependent RNA helicase DBP9;       
  177::609     5e-28  35%  725 aa  ROK1_ASPOR RecName: Full=ATP-dependent RNA helicase rok1;       
  118::406     6e-28  29%  416 aa  IF4A2_ORYSJ RecName: Full=Putative eukaryotic initiation factor
   28::425     6e-28  31%  594 aa  DBP9_KLULA RecName: Full=ATP-dependent RNA helicase DBP9;       
  137::573     8e-28  40%  747 aa  DBP7_PICGU RecName: Full=ATP-dependent RNA helicase DBP7;       
  229::572     8e-28  32%  629 aa  DBP6_YEAST RecName: Full=ATP-dependent RNA helicase DBP6;       
  229::572     8e-28  32%  629 aa  DBP6_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP6;       
   79::476     1e-27  33%  686 aa  DBP9_USTMA RecName: Full=ATP-dependent RNA helicase DBP9;       
  192::621     1e-27  34%  742 aa  ROK1_EMENI RecName: Full=ATP-dependent RNA helicase rok1;       
  135::502     2e-27  31%  593 aa  YO12_CAEEL RecName: Full=Putative ATP-dependent RNA helicase
  167::571     2e-27  35%  742 aa  DBP7_YEAST RecName: Full=ATP-dependent RNA helicase DBP7;       
  158::573     2e-27  31%  740 aa  DBP7_KLULA RecName: Full=ATP-dependent RNA helicase DBP7;       
  130::427     3e-27  33%  760 aa  DBP7_ASPOR RecName: Full=ATP-dependent RNA helicase dbp7;       
   17::113     5e-27  32%  663 aa  DDX55_DICDI RecName: Full=Probable ATP-dependent RNA helicase
  205::680     5e-27  37%  908 aa  DDX31_DICDI RecName: Full=Probable ATP-dependent RNA helicase
  129::560     7e-27  40%  727 aa  DBP7_CANAL RecName: Full=ATP-dependent RNA helicase DBP7;       
  257::669     7e-27  33%  877 aa  DBP7_BOTFB RecName: Full=ATP-dependent RNA helicase dbp7;       
  144::563     2e-26  32%  687 aa  DDX51_DROME RecName: Full=Probable ATP-dependent RNA helicase
  236::617     4e-26  34%  730 aa  ROK1_COCIM RecName: Full=ATP-dependent RNA helicase ROK1;       
   44::441     4e-26  32%  521 aa  RH1_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 1;     
  133::596     6e-26  39%  825 aa  DBP7_MAGGR RecName: Full=ATP-dependent RNA helicase DBP7;       
  155::619     6e-26  39%  798 aa  DBP7_DEBHA RecName: Full=ATP-dependent RNA helicase DBP7;       
    6::407     1e-25  34%  748 aa  SPB4_CRYNE RecName: Full=ATP-dependent rRNA helicase SPB4;       
   63::414     1e-25  35%  512 aa  RH1_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 1;     
  187::618     1e-25  37%  831 aa  DBP7_PHANO RecName: Full=ATP-dependent RNA helicase DBP7;       
  172::584     2e-25  34%  625 aa  MRH4_NEUCR RecName: Full=ATP-dependent RNA helicase mrh-4,
  206::611     3e-25  34%  738 aa  ROK1_NEOFI RecName: Full=ATP-dependent RNA helicase rok1;       
   10::452     1e-24  39%  627 aa  DBP9_CRYNE RecName: Full=ATP-dependent RNA helicase DBP9;       
  207::612     1e-24  34%  739 aa  ROK1_ASPFU RecName: Full=ATP-dependent RNA helicase rok1;       
   16::428     2e-24  32%  595 aa  DBP9_CANGA RecName: Full=ATP-dependent RNA helicase DBP9;       
  301::767     2e-24  40%  940 aa  DDX24_DICDI RecName: Full=ATP-dependent RNA helicase ddx24;        
   34::372     4e-24  28%  438 aa  Y4443_DROME RecName: Full=Putative ATP-dependent RNA helicase
  180::610     2e-23  33%  651 aa  MRH4_MAGGR RecName: Full=ATP-dependent RNA helicase MRH4,
  187::293     3e-23  35%  729 aa  ROK1_ASPNC RecName: Full=ATP-dependent RNA helicase rok1;       
  157::496     3e-23  31%  514 aa  MRH4_YARLI RecName: Full=ATP-dependent RNA helicase MRH4,
   19::411     3e-23  38%  594 aa  DBP9_YEAST RecName: Full=ATP-dependent RNA helicase DBP9;       
   19::411     3e-23  38%  594 aa  DBP9_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP9;       
  200::306     1e-22  36%  749 aa  ROK1_ASPTN RecName: Full=ATP-dependent RNA helicase rok1;       
   19::442     2e-22  32%  606 aa  DBP9_LODEL RecName: Full=ATP-dependent RNA helicase DBP9;       
  152::574     2e-22  30%  615 aa  MRH4_SCLS1 RecName: Full=ATP-dependent RNA helicase mrh4,
   18::430     2e-22  32%  595 aa  DBP9_ASHGO RecName: Full=ATP-dependent RNA helicase DBP9;       
  105::489     2e-21  28%  524 aa  YR458_MIMIV RecName: Full=Putative ATP-dependent RNA helicase R458;
  165::565     2e-21  32%  693 aa  ROK1_GIBZE RecName: Full=ATP-dependent RNA helicase ROK1;       
  193::617     4e-21  30%  658 aa  MRH4_PHANO RecName: Full=ATP-dependent RNA helicase MRH4,
  164::604     6e-21  31%  628 aa  MRH4_ASPOR RecName: Full=ATP-dependent RNA helicase mrh4,
  195::681     4e-20  41%  974 aa  DBP7_USTMA RecName: Full=ATP-dependent RNA helicase DBP7;       
  202::721     5e-20  43%  948 aa  DBP7_CRYNE RecName: Full=ATP-dependent RNA helicase DBP7;       
   77::511     6e-20  31%  539 aa  MRH4_VANPO RecName: Full=ATP-dependent RNA helicase MRH4,
  170::607     8e-20  31%  631 aa  MRH4_ASPTN RecName: Full=ATP-dependent RNA helicase mrh4,
    2::263     1e-19  38%  400 aa  DDX1_DROVI RecName: Full=ATP-dependent RNA helicase Ddx1;       
  165::556     2e-19  32%  584 aa  MRH4_KLULA RecName: Full=ATP-dependent RNA helicase MRH4,
   85::526     3e-19  33%  581 aa  RH22_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 22;   
  257::669     4e-19  34%  877 aa  DBP7_SCLS1 RecName: Full=ATP-dependent RNA helicase dbp7;       
  136::526     6e-18  28%  554 aa  MRH4_ASHGO RecName: Full=ATP-dependent RNA helicase MRH4,
  190::532     8e-18  34%  667 aa  ROK1_CHAGB RecName: Full=ATP-dependent RNA helicase ROK1;       
  168::592     8e-18  29%  631 aa  MRH4_NEOFI RecName: Full=ATP-dependent RNA helicase mrh4,
    7::350     1e-17  31%  609 aa  RECQ_ECOLI RecName: Full=ATP-dependent DNA helicase recQ;       
   39::309     1e-17  30%  409 aa  Y443_MYCPN RecName: Full=Probable ATP-dependent RNA helicase MG308
  168::592     1e-17  28%  631 aa  MRH4_ASPFU RecName: Full=ATP-dependent RNA helicase mrh4,
  168::558     2e-17  28%  573 aa  MRH4_PICGU RecName: Full=ATP-dependent RNA helicase MRH4,
  204::588     2e-17  28%  603 aa  MRH4_LODEL RecName: Full=ATP-dependent RNA helicase MRH4,
    7::350     8e-17  30%  609 aa  RECQ_SALTY RecName: Full=ATP-dependent DNA helicase recQ;       
  167::535     1e-16  33%  576 aa  MRH4_CHAGB RecName: Full=ATP-dependent RNA helicase MRH4,
  146::547     3e-16  30%  568 aa  MRH4_CANGA RecName: Full=ATP-dependent RNA helicase MRH4,
  176::615     4e-16  30%  656 aa  MRH4_COCIM RecName: Full=ATP-dependent RNA helicase MRH4,
  188::578     5e-16  28%  593 aa  MRH4_DEBHA RecName: Full=ATP-dependent RNA helicase MRH4,
   24::314     7e-16  26%  410 aa  Y308_MYCGE RecName: Full=Probable ATP-dependent RNA helicase MG308;
   87::267     7e-16  37%  577 aa  RH22_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 22;   
  168::593     9e-16  29%  632 aa  MRH4_ASPCL RecName: Full=ATP-dependent RNA helicase mrh4,
  180::302     2e-15  35%  781 aa  ROK1_NEUCR RecName: Full=ATP-dependent RNA helicase rok-1;       
  178::583     2e-15  30%  624 aa  MRH4_AJECN RecName: Full=ATP-dependent RNA helicase MRH4,
  160::592     2e-15  29%  633 aa  MRH4_ASPNC RecName: Full=ATP-dependent RNA helicase mrh4,
  216::343     5e-15  31%  591 aa  RECQ_BACSU RecName: Full=Probable ATP-dependent DNA helicase recQ; 
  740::1073    5e-15  26% 1487 aa  BLM_DROME RecName: Full=Bloom syndrome protein homolog;       
  170::591     3e-14  30%  630 aa  MRH4_EMENI RecName: Full=ATP-dependent RNA helicase mrh4,
  155::540     4e-14  27%  555 aa  MRH4_CANAL RecName: Full=ATP-dependent RNA helicase MRH4,
  313::578     5e-14  30%  593 aa  MRH4_PICST RecName: Full=ATP-dependent RNA helicase MRH4,
  484::832     9e-14  27% 1216 aa  RECQ4_MOUSE RecName: Full=ATP-dependent DNA helicase Q4;       
  259::328     3e-13  36%  775 aa  ROK1_MAGGR RecName: Full=ATP-dependent RNA helicase ROK1;       
   15::203     6e-13  25%  248 aa  IF4AX_DICDI RecName: Full=Putative eukaryotic initiation factor
   39::117     7e-13  33%  767 aa  SPB4_USTMA RecName: Full=ATP-dependent rRNA helicase SPB4;       
  680::1012    1e-12  24% 1416 aa  BLM_MOUSE RecName: Full=Bloom syndrome protein homolog;       
    5::342     2e-12  26%  632 aa  RECQ_PASMU RecName: Full=ATP-dependent DNA helicase recQ;       
  491::822     2e-12  25%  892 aa  RECQ1_CAEEL RecName: Full=Putative ATP-dependent DNA helicase Q1;  
 1195::1521    2e-12  29% 1919 aa  TLH2_SCHPO RecName: Full=ATP-dependent DNA helicase tlh2;       
 1376::1702    2e-12  29% 2100 aa  TLH1_SCHPO RecName: Full=ATP-dependent DNA helicase tlh1;       
  240::332     4e-12  34%  619 aa  RECQ_HAEIN RecName: Full=ATP-dependent DNA helicase recQ;       
  384::545     6e-12  28% 1056 aa  WRN_CAEEL RecName: Full=Probable Werner syndrome ATP-dependent
  232::337     1e-11  36%  496 aa  RECS_BACSU RecName: Full=Probable ATP-dependent DNA helicase recS; 
  242::362     1e-11  27%  548 aa  YR290_MIMIV RecName: Full=Putative ATP-dependent RNA helicase R290;
  470::584     2e-11  28%  988 aa  BLM_CAEEL RecName: Full=Bloom syndrome protein homolog;       
   94::425     2e-11  25%  648 aa  RECQ1_MOUSE RecName: Full=ATP-dependent DNA helicase Q1;       
  892::1004    2e-11  29% 1417 aa  BLM_HUMAN RecName: Full=Bloom syndrome protein;       
  622::734     2e-11  29% 1142 aa  BLM_CHICK RecName: Full=Bloom syndrome protein homolog;       
  315::425     3e-11  30%  621 aa  RECQ1_RAT RecName: Full=ATP-dependent DNA helicase Q1;       
  524::858     4e-11  25% 1328 aa  HUS2_SCHPO RecName: Full=ATP-dependent DNA helicase hus2/rqh1;     
   21::441     5e-11  31%  563 aa  DDX51_DICDI RecName: Full=Probable ATP-dependent RNA helicase
   32::371     7e-11  23%  841 aa  HELX_METJA RecName: Full=Uncharacterized ATP-dependent helicase
  180::344     9e-11  27%  478 aa  RECQ_SYNY3 RecName: Full=ATP-dependent DNA helicase recQ;       
   27::417     9e-11  30% 1538 aa  LHR_ECOLI RecName: Full=Probable ATP-dependent helicase lhr;       
   28::379     2e-10  25%  875 aa  HELX_SULSO RecName: Full=Uncharacterized ATP-dependent helicase
  450::547     3e-10  34%  677 aa  UVRB_TROW8 RecName: Full=UvrABC system protein B;       
  315::425     4e-10  26%  649 aa  RECQ1_HUMAN RecName: Full=ATP-dependent DNA helicase Q1;       
  711::816     6e-10  30% 1436 aa  WRN_XENLA RecName: Full=Werner syndrome ATP-dependent helicase
  315::425     6e-10  26%  649 aa  RECQ1_PONAB RecName: Full=ATP-dependent DNA helicase Q1;       
  740::810     8e-10  41% 1208 aa  RECQ4_HUMAN RecName: Full=ATP-dependent DNA helicase Q4;       
  319::542     1e-09  28%  671 aa  UVRB_PSESM RecName: Full=UvrABC system protein B;       
  443::546     2e-09  37%  682 aa  UVRB_DESDG RecName: Full=UvrABC system protein B;       
  137::533     2e-09  34%  561 aa  MRH4_YEAST RecName: Full=ATP-dependent RNA helicase MRH4,
  137::533     2e-09  34%  561 aa  MRH4_YEAS7 RecName: Full=ATP-dependent RNA helicase MRH4,
  451::550     3e-09  37%  677 aa  UVRB_DESVV RecName: Full=UvrABC system protein B;       
  442::545     3e-09  34%  680 aa  UVRB_DESVM RecName: Full=UvrABC system protein B;       
  451::550     3e-09  37%  677 aa  UVRB_DESVH RecName: Full=UvrABC system protein B;       
  439::548     3e-09  31%  668 aa  UVRB_CHLTR RecName: Full=UvrABC system protein B;       
  439::548     3e-09  31%  668 aa  UVRB_CHLTA RecName: Full=UvrABC system protein B;       
  445::542     4e-09  32%  666 aa  UVRB_SYNP6 RecName: Full=UvrABC system protein B;       
  445::542     4e-09  32%  666 aa  UVRB_SYNE7 RecName: Full=UvrABC system protein B;       
  450::562     4e-09  34%  695 aa  UVRB_RALEJ RecName: Full=UvrABC system protein B;       
  369::542     4e-09  28%  671 aa  UVRB_PSEU2 RecName: Full=UvrABC system protein B;       
  319::542     4e-09  27%  671 aa  UVRB_PSE14 RecName: Full=UvrABC system protein B;       
  454::562     6e-09  32%  680 aa  UVRB_GLOVI RecName: Full=UvrABC system protein B;       
  383::597     6e-09  30%  685 aa  UVRB_AZOSE RecName: Full=UvrABC system protein B;       
  430::542     6e-09  33%  661 aa  UVRB_ANATD RecName: Full=UvrABC system protein B;       
  430::542     8e-09  32%  661 aa  UVRB_CALS8 RecName: Full=UvrABC system protein B;       
  447::562     1e-08  29%  669 aa  UVRB_SYNY3 RecName: Full=UvrABC system protein B;       
  466::563     1e-08  33%  696 aa  UVRB_RALSO RecName: Full=UvrABC system protein B;       
  452::556     1e-08  36%  675 aa  UVRB_NEIMB RecName: Full=UvrABC system protein B;       
  452::556     1e-08  36%  675 aa  UVRB_NEIMA RecName: Full=UvrABC system protein B;       
  452::556     1e-08  36%  675 aa  UVRB_NEIGO RecName: Full=UvrABC system protein B;       
  452::556     1e-08  36%  675 aa  UVRB_NEIG1 RecName: Full=UvrABC system protein B;       
  451::554     1e-08  31%  668 aa  UVRB_LACBA RecName: Full=UvrABC system protein B;       
  375::549     1e-08  30%  683 aa  UVRB_LACAC RecName: Full=UvrABC system protein B;       
  420::545     1e-08  26%  663 aa  UVRB_FUSNN RecName: Full=UvrABC system protein B;       
  441::522     1e-08  32%  656 aa  UVRB_CHLAB RecName: Full=UvrABC system protein B;       
  449::552     1e-08  32%  675 aa  UVRB_BORPD RecName: Full=UvrABC system protein B;       
  471::576     1e-08  33%  695 aa  UVRB_SYNJB RecName: Full=UvrABC system protein B;       
  385::542     1e-08  28%  671 aa  UVRB_PSEPF RecName: Full=UvrABC system protein B;       
  448::569     1e-08  30%  662 aa  UVRB_CLOBM RecName: Full=UvrABC system protein B;       
  441::522     1e-08  32%  656 aa  UVRB_CHLCV RecName: Full=UvrABC system protein B;       
  412::563     1e-08  32%  696 aa  UVRB_BURPS RecName: Full=UvrABC system protein B;       
  412::563     1e-08  32%  696 aa  UVRB_BURMA RecName: Full=UvrABC system protein B;       
  376::542     1e-08  30%  664 aa  UVRB_BORAP RecName: Full=UvrABC system protein B;       
  451::547     1e-08  31%  663 aa  UVRB_AQUAE RecName: Full=UvrABC system protein B;       
  440::543     2e-08  31%  668 aa  UVRB_THEEB RecName: Full=UvrABC system protein B;       
  385::542     2e-08  28%  671 aa  UVRB_PSEF5 RecName: Full=UvrABC system protein B;       
  432::554     2e-08  36%  667 aa  UVRB_PELCD RecName: Full=UvrABC system protein B;       
  445::548     2e-08  32%  695 aa  UVRB_NITEU RecName: Full=UvrABC system protein B;       
  365::538     2e-08  30%  664 aa  UVRB_METCA RecName: Full=UvrABC system protein B;       
  370::543     2e-08  32%  663 aa  UVRB_LEGPL RecName: Full=UvrABC system protein B;       
  370::543     2e-08  32%  663 aa  UVRB_LEGPH RecName: Full=UvrABC system protein B;       
  370::543     2e-08  32%  663 aa  UVRB_LEGPC RecName: Full=UvrABC system protein B;       
  370::543     2e-08  32%  663 aa  UVRB_LEGPA RecName: Full=UvrABC system protein B;       
  441::544     2e-08  33%  673 aa  UVRB_KLEP7 RecName: Full=UvrABC system protein B;       
  441::544     2e-08  33%  673 aa  UVRB_KLEP3 RecName: Full=UvrABC system protein B;       
  329::544     2e-08  29%  673 aa  UVRB_CITK8 RecName: Full=UvrABC system protein B;       
  904::1009    2e-08  25% 1447 aa  SGS1_YEAST RecName: Full=ATP-dependent helicase SGS1;       
  441::544     2e-08  32%  671 aa  UVRB_YERPY RecName: Full=UvrABC system protein B;       
  441::544     2e-08  32%  671 aa  UVRB_YERPS RecName: Full=UvrABC system protein B;       
  441::544     2e-08  32%  671 aa  UVRB_YERPP RecName: Full=UvrABC system protein B;       
  441::544     2e-08  32%  671 aa  UVRB_YERPN RecName: Full=UvrABC system protein B;       
  441::544     2e-08  32%  671 aa  UVRB_YERPG RecName: Full=UvrABC system protein B;       
  441::544     2e-08  32%  671 aa  UVRB_YERPE RecName: Full=UvrABC system protein B;       
  441::544     2e-08  32%  671 aa  UVRB_YERPB RecName: Full=UvrABC system protein B;       
  441::544     2e-08  32%  671 aa  UVRB_YERPA RecName: Full=UvrABC system protein B;       
  441::544     2e-08  32%  671 aa  UVRB_YERP3 RecName: Full=UvrABC system protein B;       
  448::594     2e-08  28%  669 aa  UVRB_XYLFT RecName: Full=UvrABC system protein B;       
  448::594     2e-08  28%  669 aa  UVRB_XYLFM RecName: Full=UvrABC system protein B;       
  448::594     2e-08  28%  669 aa  UVRB_XYLFA RecName: Full=UvrABC system protein B;       
  448::594     2e-08  28%  669 aa  UVRB_XYLF2 RecName: Full=UvrABC system protein B;       
  346::549     2e-08  27%  666 aa  UVRB_LEPBL RecName: Full=UvrABC system protein B;       
  346::549     2e-08  27%  666 aa  UVRB_LEPBJ RecName: Full=UvrABC system protein B;       
  432::544     2e-08  34%  672 aa  UVRB_EDWI9 RecName: Full=UvrABC system protein B;       
  448::554     2e-08  30%  662 aa  UVRB_CLOBL RecName: Full=UvrABC system protein B;       
  448::554     2e-08  30%  662 aa  UVRB_CLOBK RecName: Full=UvrABC system protein B;       
  448::554     2e-08  30%  662 aa  UVRB_CLOBJ RecName: Full=UvrABC system protein B;       
  448::554     2e-08  30%  662 aa  UVRB_CLOB6 RecName: Full=UvrABC system protein B;       
  448::554     2e-08  30%  662 aa  UVRB_CLOB1 RecName: Full=UvrABC system protein B;       
  450::596     2e-08  26%  675 aa  UVRB_ACIAD RecName: Full=UvrABC system protein B;       
  442::545     3e-08  31%  676 aa  UVRB_VIBF1 RecName: Full=UvrABC system protein B;       
  440::590     3e-08  27%  678 aa  UVRB_THICR RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALTY RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALTI RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALSV RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALPK RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALPC RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALPB RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALPA RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALNS RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALG2 RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALEP RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALDC RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALCH RecName: Full=UvrABC system protein B;       
  329::544     3e-08  28%  673 aa  UVRB_SALA4 RecName: Full=UvrABC system protein B;       
  441::544     3e-08  32%  669 aa  UVRB_PROMH RecName: Full=UvrABC system protein B;       
  329::544     3e-08  29%  670 aa  UVRB_PECCP RecName: Full=UvrABC system protein B;       
  444::562     3e-08  26%  683 aa  UVRB_NATPD RecName: Full=UvrABC system protein B;       
  453::550     3e-08  30%  671 aa  UVRB_LACCB RecName: Full=UvrABC system protein B;       
  453::550     3e-08  30%  671 aa  UVRB_LACC3 RecName: Full=UvrABC system protein B;       
  441::544     3e-08  33%  670 aa  UVRB_ERWCT RecName: Full=UvrABC system protein B;       
  459::556     3e-08  31%  690 aa  UVRB_DECAR RecName: Full=UvrABC system protein B;       
  438::551     3e-08  32%  684 aa  UVRB_CHLTE RecName: Full=UvrABC system protein B;       
  445::542     3e-08  31%  665 aa  UVRB_ANASP RecName: Full=UvrABC system protein B;       
  441::544     4e-08  32%  670 aa  UVRB_YERE8 RecName: Full=UvrABC system protein B;       
  334::594     4e-08  24%  673 aa  UVRB_XANCP RecName: Full=UvrABC system protein B;       
  334::594     4e-08  24%  673 aa  UVRB_XANCB RecName: Full=UvrABC system protein B;       
  334::594     4e-08  24%  673 aa  UVRB_XANC8 RecName: Full=UvrABC system protein B;       
  423::549     4e-08  28%  671 aa  UVRB_THEYD RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_SHISS RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_SHIFL RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_SHIF8 RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_SHIDS RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_SHIBS RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_SHIB3 RecName: Full=UvrABC system protein B;       
  444::547     4e-08  27%  658 aa  UVRB_HELHP RecName: Full=UvrABC system protein B;       
  431::556     4e-08  28%  689 aa  UVRB_HALSA RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ESCF3 RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECOUT RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECOSM RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECOSE RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECOLU RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECOLI RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECOLC RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECOL6 RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECOL5 RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECOK1 RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECOHS RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECODH RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECOBW RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECO8A RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECO81 RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECO7I RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECO5E RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECO57 RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECO55 RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECO45 RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECO27 RecName: Full=UvrABC system protein B;       
  329::544     4e-08  28%  673 aa  UVRB_ECO24 RecName: Full=UvrABC system protein B;       
  446::548     4e-08  30%  659 aa  UVRB_CLOPS RecName: Full=UvrABC system protein B;       
  446::548     4e-08  30%  659 aa  UVRB_CLOPE RecName: Full=UvrABC system protein B;       
  446::548     4e-08  30%  659 aa  UVRB_CLOP1 RecName: Full=UvrABC system protein B;       
  443::552     4e-08  33%  678 aa  UVRB_BORPE RecName: Full=UvrABC system protein B;       
  443::552     4e-08  33%  675 aa  UVRB_BORBR RecName: Full=UvrABC system protein B;       
  442::517     5e-08  33%  661 aa  UVRB_THEAB RecName: Full=UvrABC system protein B;       
  329::544     5e-08  29%  670 aa  UVRB_SERP5 RecName: Full=UvrABC system protein B;       
  329::544     5e-08  28%  673 aa  UVRB_SALHS RecName: Full=UvrABC system protein B;       
  370::544     5e-08  28%  670 aa  UVRB_PSYIN RecName: Full=UvrABC system protein B;       
  328::542     5e-08  28%  670 aa  UVRB_PSEAE RecName: Full=UvrABC system protein B;       
  451::548     5e-08  31%  667 aa  UVRB_LACPL RecName: Full=UvrABC system protein B;       
  442::549     5e-08  31%  668 aa  UVRB_FRATT RecName: Full=UvrABC system protein B;       
  448::548     5e-08  30%  666 aa  UVRB_CLOAB RecName: Full=UvrABC system protein B;       
  443::552     5e-08  33%  675 aa  UVRB_BORPA RecName: Full=UvrABC system protein B;       
  468::630     5e-08  27%  993 aa  MPH1_YEAS7 RecName: Full=ATP-dependent DNA helicase MPH1;       
  366::555     5e-08  31% 1522 aa  DCL1_PHANO RecName: Full=Dicer-like protein 1;Includes:  RecName:
  334::544     7e-08  27%  673 aa  UVRB_XANOM RecName: Full=UvrABC system protein B;       
  448::592     7e-08  25%  673 aa  UVRB_XANAC RecName: Full=UvrABC system protein B;       
  394::547     7e-08  28%  658 aa  UVRB_WOLSU RecName: Full=UvrABC system protein B;       
  451::548     7e-08  31%  675 aa  UVRB_THIDA RecName: Full=UvrABC system protein B;       
  423::548     7e-08  28%  663 aa  UVRB_STRA5 RecName: Full=UvrABC system protein B;       
  423::548     7e-08  28%  663 aa  UVRB_STRA3 RecName: Full=UvrABC system protein B;       
  423::548     7e-08  28%  663 aa  UVRB_STRA1 RecName: Full=UvrABC system protein B;       
  442::545     7e-08  30%  674 aa  UVRB_PHOPR RecName: Full=UvrABC system protein B;       
  437::549     7e-08  32%  678 aa  UVRB_MANSM RecName: Full=UvrABC system protein B;       
  432::543     7e-08  32%  664 aa  UVRB_GEOSL RecName: Full=UvrABC system protein B;       
  430::545     7e-08  30%  677 aa  UVRB_BACTN RecName: Full=UvrABC system protein B;       
  423::543     7e-08  30%  658 aa  UVRB_BACHK RecName: Full=UvrABC system protein B;       
  441::543     7e-08  30%  660 aa  UVRB_BACHD RecName: Full=UvrABC system protein B;       
  423::543     7e-08  30%  658 aa  UVRB_BACCZ RecName: Full=UvrABC system protein B;       
  423::543     7e-08  30%  658 aa  UVRB_BACC1 RecName: Full=UvrABC system protein B;       
  423::543     7e-08  30%  658 aa  UVRB_BACAN RecName: Full=UvrABC system protein B;       
  371::545     7e-08  27%  676 aa  UVRB_ALISL RecName: Full=UvrABC system protein B;       
  468::630     7e-08  27%  993 aa  MPH1_YEAST RecName: Full=ATP-dependent DNA helicase MPH1;       
  371::545     9e-08  28%  676 aa  UVRB_VIBPA RecName: Full=UvrABC system protein B;       
  329::544     9e-08  28%  673 aa  UVRB_SALAR RecName: Full=UvrABC system protein B;       
  441::544     9e-08  31%  669 aa  UVRB_PHOLL RecName: Full=UvrABC system protein B;       
  447::544     9e-08  32%  671 aa  UVRB_HAMD5 RecName: Full=UvrABC system protein B;       
  375::549     9e-08  28%  679 aa  UVRB_HAEI8 RecName: Full=UvrABC system protein B;       
  466::576     9e-08  28% 1540 aa  DCL2_NEUCR RecName: Full=Dicer-like protein 2;Includes:  RecName:
  470::592     9e-08  27% 1548 aa  DCL1_CRYPA RecName: Full=Dicer-like protein 1;Includes:  RecName:
  463::559     1e-07  33%  688 aa  UVRB_XANOR RecName: Full=UvrABC system protein B;       
  448::544     1e-07  33%  673 aa  UVRB_XANOP RecName: Full=UvrABC system protein B;       
  447::544     1e-07  31%  659 aa  UVRB_SYMTH RecName: Full=UvrABC system protein B;       
  447::550     1e-07  30%  660 aa  UVRB_STAS1 RecName: Full=UvrABC system protein B;       
  430::541     1e-07  26%  657 aa  UVRB_MYCPU RecName: Full=UvrABC system protein B;       
  447::544     1e-07  32%  673 aa  UVRB_ENT38 RecName: Full=UvrABC system protein B;       
  376::542     1e-07  29%  664 aa  UVRB_BORGA RecName: Full=UvrABC system protein B;       
  391::542     1e-07  29%  668 aa  UVRB_BORBZ RecName: Full=UvrABC system protein B;       
  379::552     1e-07  30%  676 aa  UVRB_BORA1 RecName: Full=UvrABC system protein B;       
  423::543     1e-07  30%  658 aa  UVRB_BACCR RecName: Full=UvrABC system protein B;       
  436::554     2e-07  29%  663 aa  UVRB_STRU0 RecName: Full=UvrABC system protein B;       
  385::542     2e-07  29%  671 aa  UVRB_PSEPK RecName: Full=UvrABC system protein B;       
  437::549     2e-07  31%  678 aa  UVRB_PASMU RecName: Full=UvrABC system protein B;       
  433::545     2e-07  30%  660 aa  UVRB_MYCA5 RecName: Full=UvrABC system protein B;       
  444::549     2e-07  30%  646 aa  UVRB_METMP RecName: Full=UvrABC system protein B;       
  448::544     2e-07  30%  660 aa  UVRB_METBU RecName: Full=UvrABC system protein B;       
  437::549     2e-07  31%  679 aa  UVRB_HAEIN RecName: Full=UvrABC system protein B;       
  448::542     2e-07  31%  665 aa  UVRB_CYAP4 RecName: Full=UvrABC system protein B;       
  448::548     2e-07  30%  657 aa  UVRB_CLOBB RecName: Full=UvrABC system protein B;       
  448::548     2e-07  30%  657 aa  UVRB_CLOBA RecName: Full=UvrABC system protein B;       
  446::548     2e-07  31%  670 aa  UVRB_CHRVO RecName: Full=UvrABC system protein B;       
  368::545     2e-07  28%  677 aa  UVRB_BACFN RecName: Full=UvrABC system protein B;       
  433::545     2e-07  30%  660 aa  UVB2_MYCPU RecName: Full=UvrABC system protein B;       
  414::556     2e-07  23%  834 aa  MFH1_SCHPO RecName: Full=ATP-dependent DNA helicase mfh1;       
  624::956     2e-07  22% 1364 aa  BLM_XENLA RecName: Full=Bloom syndrome protein homolog;       
  273::467     2e-07  24%  557 aa  YQHH_BACSU RecName: Full=Uncharacterized ATP-dependent helicase
  768::859     2e-07  27% 1432 aa  WRN_HUMAN RecName: Full=Werner syndrome ATP-dependent helicase;    
  444::549     2e-07  28%  668 aa  UVRB_TREPS RecName: Full=UvrABC system protein B;       
  444::549     2e-07  28%  668 aa  UVRB_TREPA RecName: Full=UvrABC system protein B;       
  436::548     2e-07  30%  663 aa  UVRB_STRS7 RecName: Full=UvrABC system protein B;       
  436::548     2e-07  30%  663 aa  UVRB_STREM RecName: Full=UvrABC system protein B;       
  436::548     2e-07  30%  663 aa  UVRB_STRE4 RecName: Full=UvrABC system protein B;       
  449::551     2e-07  32%  662 aa  UVRB_RICTY RecName: Full=UvrABC system protein B;       
  451::548     2e-07  29%  667 aa  UVRB_LACSS RecName: Full=UvrABC system protein B;       
  446::543     2e-07  31%  673 aa  UVRB_COLP3 RecName: Full=UvrABC system protein B;       
  452::530     2e-07  30%  684 aa  UVRB_CHLL2 RecName: Full=UvrABC system protein B;       
  436::547     2e-07  27%  673 aa  UVRB_BORBU RecName: Full=UvrABC system protein B;       
  368::545     2e-07  28%  677 aa  UVRB_BACFR RecName: Full=UvrABC system protein B;       
   37::173     2e-07  36% 1637 aa  DCL3B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog
  371::545     3e-07  28%  676 aa  UVRB_VIBVY RecName: Full=UvrABC system protein B;       
  371::545     3e-07  28%  676 aa  UVRB_VIBVU RecName: Full=UvrABC system protein B;       
  425::588     3e-07  25%  661 aa  UVRB_STAES RecName: Full=UvrABC system protein B;       
  425::588     3e-07  25%  661 aa  UVRB_STAEQ RecName: Full=UvrABC system protein B;       
  432::553     3e-07  28%  663 aa  UVRB_STAAW RecName: Full=UvrABC system protein B;       
  432::553     3e-07  28%  663 aa  UVRB_STAAS RecName: Full=UvrABC system protein B;       
  432::553     3e-07  28%  663 aa  UVRB_STAAR RecName: Full=UvrABC system protein B;       
  432::553     3e-07  28%  663 aa  UVRB_STAAN RecName: Full=UvrABC system protein B;       
  432::553     3e-07  28%  663 aa  UVRB_STAAM RecName: Full=UvrABC system protein B;       
  432::553     3e-07  28%  663 aa  UVRB_STAAC RecName: Full=UvrABC system protein B;       
  445::586     3e-07  28%  658 aa  UVRB_NATTJ RecName: Full=UvrABC system protein B;       
  346::549     3e-07  27%  666 aa  UVRB_LEPIN RecName: Full=UvrABC system protein B;       
  346::549     3e-07  27%  666 aa  UVRB_LEPIC RecName: Full=UvrABC system protein B;       
  446::543     3e-07  29%  658 aa  UVRB_GEOKA RecName: Full=UvrABC system protein B;       
  435::544     3e-07  30%  674 aa  UVRB_ERWT9 RecName: Full=UvrABC system protein B;       
  451::591     3e-07  26%  665 aa  UVRB_ENTFA RecName: Full=UvrABC system protein B;       
  427::522     3e-07  31%  657 aa  UVRB_CHLPN RecName: Full=UvrABC system protein B;       
  431::540     3e-07  34%  664 aa  UVRB_CHLAD RecName: Full=UvrABC system protein B;       
  446::543     3e-07  29%  658 aa  UVRB_BACCA RecName: Full=UvrABC system protein B;       
  446::542     3e-07  29%  653 aa  UVRB_ANAPZ RecName: Full=UvrABC system protein B;       
  459::515     3e-07  40% 1651 aa  DCL3A_ORYSJ RecName: Full=Endoribonuclease Dicer homolog
  423::548     3e-07  27%  663 aa  UVRB_STRPZ RecName: Full=UvrABC system protein B;       
  423::548     3e-07  27%  663 aa  UVRB_STRPF RecName: Full=UvrABC system protein B;       
  423::548     3e-07  27%  663 aa  UVRB_STRP1 RecName: Full=UvrABC system protein B;       
  444::541     3e-07  29%  667 aa  UVRB_KOSOT RecName: Full=UvrABC system protein B;       
  442::545     3e-07  29%  677 aa  UVRB_IDILO RecName: Full=UvrABC system protein B;       
  465::556     3e-07  30%  686 aa  UVRB_HALMA RecName: Full=UvrABC system protein B;       
  432::543     3e-07  29%  700 aa  UVRB_GEMAT RecName: Full=UvrABC system protein B;       
  446::548     3e-07  30%  661 aa  UVRB_CLOTE RecName: Full=UvrABC system protein B;       
  452::530     3e-07  30%  685 aa  UVRB_CHLPD RecName: Full=UvrABC system protein B;       
  452::549     3e-07  29%  690 aa  UVRB_CHLPB RecName: Full=UvrABC system protein B;       
  449::547     3e-07  27%  658 aa  UVRB_CAMFF RecName: Full=UvrABC system protein B;       
  447::593     3e-07  28%  703 aa  UVRB_BIFLI RecName: Full=UvrABC system protein B;       
  446::542     5e-07  29%  662 aa  UVRB_THETN RecName: Full=UvrABC system protein B;       
  456::553     5e-07  30%  668 aa  UVRB_STRTD RecName: Full=UvrABC system protein B;       
  456::553     5e-07  30%  668 aa  UVRB_STRT2 RecName: Full=UvrABC system protein B;       
  456::553     5e-07  30%  668 aa  UVRB_STRT1 RecName: Full=UvrABC system protein B;       
  446::548     5e-07  30%  663 aa  UVRB_STRPM RecName: Full=UvrABC system protein B;       
  446::548     5e-07  30%  663 aa  UVRB_STRPG RecName: Full=UvrABC system protein B;       
  446::548     5e-07  30%  663 aa  UVRB_STRPD RecName: Full=UvrABC system protein B;       
  446::548     5e-07  30%  663 aa  UVRB_STRPC RecName: Full=UvrABC system protein B;       
  446::548     5e-07  30%  663 aa  UVRB_STRPB RecName: Full=UvrABC system protein B;       
  446::548     5e-07  30%  663 aa  UVRB_STRP8 RecName: Full=UvrABC system protein B;       
  446::548     5e-07  30%  663 aa  UVRB_STRP6 RecName: Full=UvrABC system protein B;       
  446::548     5e-07  30%  663 aa  UVRB_STRP3 RecName: Full=UvrABC system protein B;       
  451::554     5e-07  28%  663 aa  UVRB_STRMU RecName: Full=UvrABC system protein B;       
  457::595     5e-07  28%  701 aa  UVRB_PROAC RecName: Full=UvrABC system protein B;       
  443::588     5e-07  29%  661 aa  UVRB_FERNB RecName: Full=UvrABC system protein B;       
  446::548     5e-07  30%  657 aa  UVRB_CLONN RecName: Full=UvrABC system protein B;       
  440::542     5e-07  32%  662 aa  UVRB_CARHZ RecName: Full=UvrABC system protein B;       
  445::560     5e-07  27%  668 aa  UVRB_ACAM1 RecName: Full=UvrABC system protein B;       
   31::355     5e-07  27%  991 aa  RECQ5_HUMAN RecName: Full=ATP-dependent DNA helicase Q5;       
  451::595     5e-07  27%  783 aa  MFH2_SCHPO RecName: Full=Putative ATP-dependent RNA helicase mfh2; 
  602::918     5e-07  28% 1148 aa  MFD_ECOLI RecName: Full=Transcription-repair-coupling factor;      
  442::539     6e-07  28%  656 aa  UVRB_THELT RecName: Full=UvrABC system protein B;       
  471::576     6e-07  31%  695 aa  UVRB_SYNJA RecName: Full=UvrABC system protein B;       
  451::548     6e-07  29%  661 aa  UVRB_STRS2 RecName: Full=UvrABC system protein B;       
  448::564     6e-07  26%  661 aa  UVRB_STAHJ RecName: Full=UvrABC system protein B;       
  447::544     6e-07  30%  664 aa  UVRB_PSEHT RecName: Full=UvrABC system protein B;       
  448::548     6e-07  29%  657 aa  UVRB_CLOB8 RecName: Full=UvrABC system protein B;       
  450::547     6e-07  30%  688 aa  UVRB_CLAMS RecName: Full=UvrABC system protein B;       
  450::547     6e-07  30%  688 aa  UVRB_CLAM3 RecName: Full=UvrABC system protein B;       
  373::547     6e-07  26%  673 aa  UVRB_ACTP2 RecName: Full=UvrABC system protein B;       
  545::629     6e-07  28% 1077 aa  MPH1_ASHGO RecName: Full=ATP-dependent DNA helicase MPH1;       
  436::536     8e-07  30%  559 aa  Y022_SIFV RecName: Full=Putative helicase 22;         EC=3.6.1.-;
  449::551     8e-07  31%  662 aa  UVRB_RICPR RecName: Full=UvrABC system protein B;       
  451::559     8e-07  30%  656 aa  UVRB_MYCGE RecName: Full=UvrABC system protein B;       
  373::547     8e-07  26%  675 aa  UVRB_HAEDU RecName: Full=UvrABC system protein B;       
  452::530     8e-07  30%  681 aa  UVRB_CHLCH RecName: Full=UvrABC system protein B;       
  447::593     8e-07  27%  703 aa  UVRB_BIFLO RecName: Full=UvrABC system protein B;       
  446::543     8e-07  28%  661 aa  UVRB_BACSU RecName: Full=UvrABC system protein B;       
  446::542     8e-07  29%  651 aa  UVRB_ANAMM RecName: Full=UvrABC system protein B;       
  446::542     8e-07  29%  651 aa  UVRB_ANAMF RecName: Full=UvrABC system protein B;       
  641::758     8e-07  31% 1229 aa  MPH1_BOTFB RecName: Full=ATP-dependent DNA helicase mph1;       
  733::824     1e-06  26% 1401 aa  WRN_MOUSE RecName: Full=Werner syndrome ATP-dependent helicase
  375::541     1e-06  28%  662 aa  UVRB_TREDE RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRZT RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRZP RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRZJ RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRR6 RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRPS RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRPN RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRPJ RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRPI RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRP7 RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRP4 RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRP2 RecName: Full=UvrABC system protein B;       
  439::557     1e-06  29%  708 aa  UVRB_RHOBA RecName: Full=UvrABC system protein B;       
  452::548     1e-06  30%  657 aa  UVRB_MYCPN RecName: Full=UvrABC system protein B;       
  371::545     1e-06  24%  659 aa  UVRB_MYCMO RecName: Full=UvrABC system protein B;       
  441::541     1e-06  30%  660 aa  UVRB_EUBR3 RecName: Full=UvrABC system protein B;       
  441::543     1e-06  30%  672 aa  UVRB_COXBU RecName: Full=UvrABC system protein B;       
  441::543     1e-06  30%  672 aa  UVRB_COXBR RecName: Full=UvrABC system protein B;       
  441::543     1e-06  30%  672 aa  UVRB_COXBN RecName: Full=UvrABC system protein B;       
  441::543     1e-06  30%  672 aa  UVRB_COXB2 RecName: Full=UvrABC system protein B;       
  635::752     1e-06  31% 1235 aa  MPH1_SCLS1 RecName: Full=ATP-dependent DNA helicase mph1;       
  554::644     1e-06  27% 1002 aa  MPH1_KLULA RecName: Full=ATP-dependent DNA helicase MPH1;       
  442::568     1e-06  39% 1534 aa  DCL1_ASPCL RecName: Full=Dicer-like protein 1;Includes:  RecName:
  448::546     1e-06  29%  645 aa  UVRB_WOLTR RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRSV RecName: Full=UvrABC system protein B;       
  451::548     1e-06  29%  662 aa  UVRB_STRGC RecName: Full=UvrABC system protein B;       
  428::543     1e-06  25%  660 aa  UVRB_OCEIH RecName: Full=UvrABC system protein B;       
  448::551     1e-06  28%  709 aa  UVRB_MICLC RecName: Full=UvrABC system protein B;       
  351::548     1e-06  28%  671 aa  UVRB_LACGA RecName: Full=UvrABC system protein B;       
  846::935     1e-06  28% 1177 aa  MFD_BACSU RecName: Full=Transcription-repair-coupling factor;      
  478::589     1e-06  28% 2048 aa  FANCM_HUMAN RecName: Full=Fanconi anemia group M protein;       
  376::533     1e-06  32% 1451 aa  DCL2_CRYPA RecName: Full=Dicer-like protein 2;Includes:  RecName:
  417::517     1e-06  35% 1377 aa  DCL2_ASPOR RecName: Full=Dicer-like protein 2;Includes:  RecName:
  459::582     2e-06  29%  740 aa  UVRB_ZYMMO RecName: Full=UvrABC system protein B;       
  434::549     2e-06  29%  666 aa  UVRB_UREPA RecName: Full=UvrABC system protein B;       
  434::549     2e-06  29%  666 aa  UVRB_UREP2 RecName: Full=UvrABC system protein B;       
  447::544     2e-06  29%  661 aa  UVRB_RICCK RecName: Full=UvrABC system protein B;       
  441::543     2e-06  30%  687 aa  UVRB_NITOC RecName: Full=UvrABC system protein B;       
  351::548     2e-06  28%  671 aa  UVRB_LACJO RecName: Full=UvrABC system protein B;       
  445::541     2e-06  34%  698 aa  UVRB_HERA2 RecName: Full=UvrABC system protein B;       
  446::547     2e-06  25%  657 aa  UVRB_CAMHC RecName: Full=UvrABC system protein B;       
  446::543     2e-06  27%  661 aa  UVRB_BACA2 RecName: Full=UvrABC system protein B;       
  421::547     2e-06  23%  658 aa  UVRB_HELPY RecName: Full=UvrABC system protein B;       
  445::542     2e-06  28%  665 aa  UVRB_CYAP7 RecName: Full=UvrABC system protein B;       
  441::543     2e-06  29%  672 aa  UVRB_COXB1 RecName: Full=UvrABC system protein B;       
  446::543     2e-06  28%  661 aa  UVRB_BACLD RecName: Full=UvrABC system protein B;       
  651::732     2e-06  30%  831 aa  RECG_SYNY3 RecName: Full=ATP-dependent DNA helicase recG;       
  306::577     2e-06  24%  671 aa  RECG_STRPN RecName: Full=ATP-dependent DNA helicase recG;       
  705::822     2e-06  29% 1025 aa  IFIH1_HUMAN RecName: Full=Interferon-induced helicase C
  447::544     3e-06  30%  661 aa  UVRB_RICRS RecName: Full=UvrABC system protein B;       
  447::544     3e-06  30%  661 aa  UVRB_RICRO RecName: Full=UvrABC system protein B;       
  447::544     3e-06  30%  661 aa  UVRB_RICPU RecName: Full=UvrABC system protein B;       
  447::544     3e-06  30%  661 aa  UVRB_RICCN RecName: Full=UvrABC system protein B;       
  452::557     3e-06  28%  692 aa  UVRB_LACLS RecName: Full=UvrABC system protein B;       
  452::557     3e-06  28%  692 aa  UVRB_LACLM RecName: Full=UvrABC system protein B;       
  452::557     3e-06  28%  692 aa  UVRB_LACLA RecName: Full=UvrABC system protein B;       
  417::542     3e-06  28%  673 aa  UVRB_CYTH3 RecName: Full=UvrABC system protein B;       
  536::663     3e-06  26% 1134 aa  MPH1_CHAGB RecName: Full=ATP-dependent DNA helicase MPH1;       
  477::537     3e-06  38% 1485 aa  DCL2_MAGGR RecName: Full=Dicer-like protein 2;Includes:  RecName:
  434::545     3e-06  36% 1464 aa  DCL1_COCIM RecName: Full=Dicer-like protein 1;Includes:  RecName:
  260::381     4e-06  27%  684 aa  Y1574_METJA RecName: Full=Uncharacterized ATP-dependent helicase
  447::544     4e-06  29%  661 aa  UVRB_RICFE RecName: Full=UvrABC system protein B;       
  449::544     4e-06  30%  661 aa  UVRB_RICBR RecName: Full=UvrABC system protein B;       
  449::544     4e-06  30%  661 aa  UVRB_RICB8 RecName: Full=UvrABC system protein B;       
  447::544     4e-06  29%  661 aa  UVRB_RICAH RecName: Full=UvrABC system protein B;       
  450::554     4e-06  27%  671 aa  UVRB_MYCMS RecName: Full=UvrABC system protein B;       
  450::585     4e-06  29%  646 aa  UVRB_METTH RecName: Full=UvrABC system protein B;       
  444::541     4e-06  28%  655 aa  UVRB_METS3 RecName: Full=UvrABC system protein B;       
   91::368     4e-06  24%  689 aa  IRC3_YEAST RecName: Full=Putative ATP-dependent helicase IRC3;     
  355::477     4e-06  34%  678 aa  DHX58_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
  454::558     4e-06  38% 1519 aa  DCL1_ASPTN RecName: Full=Dicer-like protein 1;Includes:  RecName:
  441::552     5e-06  28%  701 aa  UVRB_THEFY RecName: Full=UvrABC system protein B;       
  431::542     5e-06  30%  677 aa  UVRB_PROMA RecName: Full=UvrABC system protein B;       
  445::542     5e-06  28%  667 aa  UVRB_MICAN RecName: Full=UvrABC system protein B;       
  421::547     5e-06  23%  658 aa  UVRB_HELAH RecName: Full=UvrABC system protein B;       
  518::600     5e-06  35%  732 aa  PRIA_ECOLI RecName: Full=Primosomal protein N';       
  463::574     5e-06  25% 2021 aa  FANCM_MOUSE RecName: Full=Fanconi anemia group M protein homolog;  
  424::498     5e-06  38% 1845 aa  DCR1_CAEEL RecName: Full=Endoribonuclease dcr-1;       
  382::599     5e-06  31% 1584 aa  DCL1_NEUCR RecName: Full=Dicer-like protein 1;Includes:  RecName:
  447::544     7e-06  29%  661 aa  UVRB_RICM5 RecName: Full=UvrABC system protein B;       
  449::547     7e-06  25%  658 aa  UVRB_HELPJ RecName: Full=UvrABC system protein B;       
  421::547     7e-06  23%  658 aa  UVRB_HELPH RecName: Full=UvrABC system protein B;       
  705::822     7e-06  28% 1025 aa  IFIH1_MOUSE RecName: Full=Interferon-induced helicase C
  104::220     7e-06  35% 1478 aa  DCL2_COCIM RecName: Full=Dicer-like protein 2;Includes:  RecName:
  403::473     7e-06  34% 1362 aa  DCL22_ASPNC RecName: Full=Dicer-like protein 2-2;Includes:
  272::560     7e-06  28% 1523 aa  DCL1_ASPOR RecName: Full=Dicer-like protein 1;Includes:  RecName:
  448::562     7e-06  37% 1525 aa  DCL1_ASPNC RecName: Full=Dicer-like protein 1;Includes:  RecName:
  444::565     9e-06  30%  665 aa  UVRB_THET8 RecName: Full=UvrABC system protein B;       
  447::544     9e-06  29%  661 aa  UVRB_RICAE RecName: Full=UvrABC system protein B;       
  444::541     9e-06  27%  649 aa  UVRB_METST RecName: Full=UvrABC system protein B;       
  438::592     9e-06  25%  681 aa  UVRB_CORDI RecName: Full=UvrABC system protein B;       
  419::545     9e-06  23%  657 aa  UVRB_CAMJR RecName: Full=UvrABC system protein B;       
  419::545     9e-06  23%  657 aa  UVRB_CAMJE RecName: Full=UvrABC system protein B;       
  511::605     9e-06  27% 1052 aa  MPH1_CANGA RecName: Full=ATP-dependent DNA helicase MPH1;       
  333::477     9e-06  36%  678 aa  DHX58_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
  432::523     9e-06  30% 1410 aa  DCL2A_ORYSJ RecName: Full=Endoribonuclease Dicer homolog
  467::572     9e-06  39% 1538 aa  DCL1_NEOFI RecName: Full=Dicer-like protein 1;Includes:  RecName:
  448::548     1e-05  27%  662 aa  UVRB_MYCPE RecName: Full=UvrABC system protein B;       
  440::543     1e-05  26%  660 aa  UVRB_BACSK RecName: Full=UvrABC system protein B;       
  509::610     1e-05  24% 1012 aa  MPH1_VANPO RecName: Full=ATP-dependent DNA helicase MPH1;       
  407::484     1e-05  35% 1429 aa  DCL2_EMENI RecName: Full=Dicer-like protein 2;Includes:  RecName:
  466::571     1e-05  38% 1537 aa  DCL1_ASPFU RecName: Full=Dicer-like protein 1;Includes:  RecName:
  519::595     1e-05  30%  693 aa  RECG_ECOLI RecName: Full=ATP-dependent DNA helicase recG;       
  519::595     1e-05  30%  693 aa  RECG_ECO57 RecName: Full=ATP-dependent DNA helicase recG;       
  495::632     1e-05  27%  968 aa  RAPA_SHEFN RecName: Full=RNA polymerase-associated protein rapA;   
  504::631     1e-05  26% 1168 aa  MPH1_NEUCR RecName: Full=ATP-dependent DNA helicase mph-1;       
  436::520     1e-05  34% 1389 aa  DCL2_ASPCL RecName: Full=Dicer-like protein 2;Includes:  RecName:
  419::521     1e-05  33% 1387 aa  DCL21_ASPNC RecName: Full=Dicer-like protein 2-1;Includes:
  431::543     2e-05  25%  664 aa  UVRB_LEPBP RecName: Full=UvrABC system protein B;       
  431::543     2e-05  25%  664 aa  UVRB_LEPBA RecName: Full=UvrABC system protein B;       
  544::628     2e-05  32%  743 aa  RECG_MYCLE RecName: Full=ATP-dependent DNA helicase recG;       
  706::768     2e-05  33% 1909 aa  DICER_ARATH RecName: Full=Endoribonuclease Dicer homolog;       
  342::463     2e-05  32% 1374 aa  DCR1_SCHPO RecName: Full=Protein Dicer;AltName: Full=Cell cycle
  419::493     2e-05  34% 1377 aa  DCL2_ASPTN RecName: Full=Dicer-like protein 2;Includes:  RecName:
  454::551     3e-05  30%  693 aa  UVRB_RENSM RecName: Full=UvrABC system protein B;       
  448::545     3e-05  27%  698 aa  UVRB_MYCLE RecName: Full=UvrABC system protein B;       
  446::543     3e-05  26%  658 aa  UVRB_LISMO RecName: Full=UvrABC system protein B;       
  446::543     3e-05  26%  658 aa  UVRB_LISMF RecName: Full=UvrABC system protein B;       
  446::543     3e-05  26%  658 aa  UVRB_LISIN RecName: Full=UvrABC system protein B;       
  448::541     3e-05  28%  668 aa  UVRB_DEHE1 RecName: Full=UvrABC system protein B;       
  563::635     3e-05  31%  737 aa  RECG_MYCTU RecName: Full=ATP-dependent DNA helicase recG;       
  563::635     3e-05  31%  737 aa  RECG_MYCBO RecName: Full=ATP-dependent DNA helicase recG;       
  448::611     3e-05  29%  968 aa  RAPA_SHEPW RecName: Full=RNA polymerase-associated protein rapA;   
 1653::1768    3e-05  30% 3344 aa  POLG_PRSVH RecName: Full=Genome polyprotein;Contains:  RecName:
  501::597     3e-05  28% 1923 aa  DICER_BOVIN RecName: Full=Endoribonuclease Dicer;       
  432::523     3e-05  29% 1377 aa  DCL2B_ORYSJ RecName: Full=Endoribonuclease Dicer homolog
  692::745     3e-05  37% 1883 aa  DCL1_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 1;AltName:
  440::551     3e-05  27%  712 aa  UVRB_STRCO RecName: Full=UvrABC system protein B;       
  440::551     3e-05  27%  713 aa  UVRB_STRAW RecName: Full=UvrABC system protein B;       
  433::542     3e-05  32%  678 aa  UVRB_PROMT RecName: Full=UvrABC system protein B;       
  433::542     3e-05  29%  679 aa  UVRB_PROM4 RecName: Full=UvrABC system protein B;       
  433::542     3e-05  32%  678 aa  UVRB_PROM1 RecName: Full=UvrABC system protein B;       
  448::545     3e-05  27%  701 aa  UVRB_MYCUA RecName: Full=UvrABC system protein B;       
  449::551     3e-05  29%  693 aa  UVRB_ARTS2 RecName: Full=UvrABC system protein B;       
   39::275     3e-05  27%  551 aa  MRH4_CRYNE RecName: Full=ATP-dependent RNA helicase MRH4,
  501::597     3e-05  33% 1922 aa  DICER_HUMAN RecName: Full=Endoribonuclease Dicer;       
  424::520     3e-05  32% 1388 aa  DCL2_NEOFI RecName: Full=Dicer-like protein 2;Includes:  RecName:
  537::590     3e-05  31% 1607 aa  DCL1_CHAGB RecName: Full=Dicer-like protein 1;Includes:  RecName:
  178::258     4e-05  23%  452 aa  V51K_BPL79 RecName: Full=51.5 kDa protein;
  453::547     4e-05  28%  688 aa  UVRB_LEIXX RecName: Full=UvrABC system protein B;       
  522::604     4e-05  29%  686 aa  RECG_TREPA RecName: Full=ATP-dependent DNA helicase recG;       
  487::617     4e-05  26% 1102 aa  MPH1_MAGGR RecName: Full=ATP-dependent DNA helicase MPH1;       
  422::549     6e-05  30%  679 aa  UVRB_PROMP RecName: Full=UvrABC system protein B;       
  448::545     6e-05  26%  698 aa  UVRB_MYCTU RecName: Full=UvrABC system protein B;       
  448::545     6e-05  26%  698 aa  UVRB_MYCBO RecName: Full=UvrABC system protein B;       
  447::556     6e-05  27%  676 aa  UVRB_CHLMU RecName: Full=UvrABC system protein B;       
  454::551     6e-05  28%  704 aa  UVRB_ARTCA RecName: Full=UvrABC system protein B;       
  495::624     6e-05  27%  968 aa  RAPA_SHEB9 RecName: Full=RNA polymerase-associated protein rapA;   
  495::624     6e-05  27%  968 aa  RAPA_SHEB5 RecName: Full=RNA polymerase-associated protein rapA;   
  495::624     6e-05  27%  968 aa  RAPA_SHEB2 RecName: Full=RNA polymerase-associated protein rapA;   
  888::954     6e-05  30% 1199 aa  MFD_SYNY3 RecName: Full=Transcription-repair-coupling factor;      
  492::543     6e-05  35% 1893 aa  DICER_XENTR RecName: Full=Endoribonuclease Dicer;       
  501::552     6e-05  37% 1916 aa  DICER_MOUSE RecName: Full=Endoribonuclease Dicer;       
  501::552     6e-05  37% 1917 aa  DICER_CRIGR RecName: Full=Endoribonuclease Dicer;       
  501::594     6e-05  33% 1921 aa  DICER_CHICK RecName: Full=Endoribonuclease Dicer;       
  384::542     7e-05  28%  679 aa  UVRB_PROM3 RecName: Full=UvrABC system protein B;       
  448::545     7e-05  27%  667 aa  UVRB_AYWBP RecName: Full=UvrABC system protein B;       
  499::624     7e-05  27%  968 aa  RAPA_SHESW RecName: Full=RNA polymerase-associated protein rapA;   
  499::624     7e-05  27%  968 aa  RAPA_SHEPC RecName: Full=RNA polymerase-associated protein rapA;   
  495::604     7e-05  29%  968 aa  RAPA_SHELP RecName: Full=RNA polymerase-associated protein rapA;   
  495::621     7e-05  28%  968 aa  RAPA_SHEB8 RecName: Full=RNA polymerase-associated protein rapA;   
  526::599     7e-05  26% 1050 aa  MPH1_PICST RecName: Full=ATP-dependent DNA helicase MPH1;       
  487::538     7e-05  35% 1865 aa  DICER_DANRE RecName: Full=Endoribonuclease Dicer;       
  441::489     7e-05  43% 1399 aa  DCL2_PHANO RecName: Full=Dicer-like protein 2;Includes:  RecName:
  437::549     1e-04  32%  677 aa  UVRB_SYNPX RecName: Full=UvrABC system protein B;       
  437::549     1e-04  32%  678 aa  UVRB_SYNPW RecName: Full=UvrABC system protein B;       
  495::624     1e-04  27%  968 aa  RAPA_SHEON RecName: Full=RNA polymerase-associated protein rapA;   
  696::908     1e-04  26% 1146 aa  MFD_HAEIN RecName: Full=Transcription-repair-coupling factor;      
  443::520     1e-04  33% 1388 aa  DCL2_ASPFU RecName: Full=Dicer-like protein 2;Includes:  RecName:
  433::530     1e-04  29%  808 aa  Y1401_METJA RecName: Full=Probable ATP-dependent helicase MJ1401;  
  439::542     1e-04  26%  679 aa  UVRB_PROMM RecName: Full=UvrABC system protein B;       
  431::549     1e-04  31%  679 aa  UVRB_PROM0 RecName: Full=UvrABC system protein B;       
  454::551     1e-04  28%  699 aa  UVRB_ARTAT RecName: Full=UvrABC system protein B;       
  861::931     1e-04  29% 1169 aa  MFD_STAHJ RecName: Full=Transcription-repair-coupling factor;      
  386::561     1e-04  32% 1591 aa  DCL1_MAGGR RecName: Full=Dicer-like protein 1;Includes:  RecName:
  442::587     2e-04  27%  664 aa  UVRB_THENN RecName: Full=UvrABC system protein B;       
  433::542     2e-04  30%  679 aa  UVRB_SYNS3 RecName: Full=UvrABC system protein B;       
  495::621     2e-04  28%  968 aa  RAPA_SHESM RecName: Full=RNA polymerase-associated protein rapA;   
  495::621     2e-04  28%  968 aa  RAPA_SHESA RecName: Full=RNA polymerase-associated protein rapA;   
  442::538     2e-04  27%  870 aa  UVRB_RHILO RecName: Full=UvrABC system protein B;       
  495::603     2e-04  27%  968 aa  RAPA_SHESR RecName: Full=RNA polymerase-associated protein rapA;   
  442::587     3e-04  27%  664 aa  UVRB_THESQ RecName: Full=UvrABC system protein B;       
  442::587     3e-04  27%  664 aa  UVRB_THEP1 RecName: Full=UvrABC system protein B;       
  495::611     3e-04  29%  968 aa  RAPA_SHEPA RecName: Full=RNA polymerase-associated protein rapA;   
  860::930     3e-04  29% 1168 aa  MFD_STAAW RecName: Full=Transcription-repair-coupling factor;      
  860::930     3e-04  29% 1168 aa  MFD_STAAS RecName: Full=Transcription-repair-coupling factor;      
  860::930     3e-04  29% 1168 aa  MFD_STAAR RecName: Full=Transcription-repair-coupling factor;      
  860::930     3e-04  29% 1168 aa  MFD_STAAN RecName: Full=Transcription-repair-coupling factor;      
  860::930     3e-04  29% 1168 aa  MFD_STAAM RecName: Full=Transcription-repair-coupling factor;      
  860::930     3e-04  29% 1168 aa  MFD_STAAC RecName: Full=Transcription-repair-coupling factor;      
  860::930     3e-04  29% 1168 aa  MFD_STAAB RecName: Full=Transcription-repair-coupling factor;      
  860::930     3e-04  29% 1168 aa  MFD_STAA8 RecName: Full=Transcription-repair-coupling factor;      
  860::930     3e-04  29% 1168 aa  MFD_STAA3 RecName: Full=Transcription-repair-coupling factor;      
  442::587     4e-04  27%  664 aa  UVRB_THEMA RecName: Full=UvrABC system protein B;       
  439::541     4e-04  23%  664 aa  UVRB_DEHSC RecName: Full=UvrABC system protein B;       
  432::603     4e-04  29%  968 aa  RAPA_SHISS RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_SHIFL RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_SHIF8 RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_SHIDS RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_SHIBS RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_SHIB3 RecName: Full=RNA polymerase-associated protein rapA;   
  495::611     4e-04  29%  968 aa  RAPA_SHEHH RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ESCF3 RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECOUT RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECOSM RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECOSE RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECOLU RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECOLI RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECOLC RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECOL6 RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECOL5 RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECOK1 RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECOHS RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECOBW RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECO8A RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECO81 RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECO7I RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECO57 RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECO55 RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECO45 RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECO27 RecName: Full=RNA polymerase-associated protein rapA;   
  432::603     4e-04  29%  968 aa  RAPA_ECO24 RecName: Full=RNA polymerase-associated protein rapA;   
 1416::1535    4e-04  30% 3066 aa  POLG_SBMVN RecName: Full=Genome polyprotein;Contains:  RecName:
 1420::1535    4e-04  30% 3140 aa  POLG_PPVSK RecName: Full=Genome polyprotein;Contains:  RecName:
 1394::1500    4e-04  32% 3056 aa  POLG_BYMV RecName: Full=Genome polyprotein;Contains:  RecName:
  721::793     4e-04  27% 1119 aa  MPH1_ASPCL RecName: Full=ATP-dependent DNA helicase mph1;       
  500::606     4e-04  33% 2249 aa  DCR1_DROME RecName: Full=Endoribonuclease Dcr-1;       
  502::595     4e-04  31% 1589 aa  DCL4_ARATH RecName: Full=Dicer-like protein 4;         EC=3.1.26.-;
  480::619     5e-04  22%  955 aa  RAPA_AERHH RecName: Full=RNA polymerase-associated protein rapA;   
 1420::1535    5e-04  30% 3125 aa  POLG_PPVNA RecName: Full=Genome polyprotein;Contains:  RecName:
  714::786     5e-04  27% 1111 aa  MPH1_NEOFI RecName: Full=ATP-dependent DNA helicase MPH1;       
  725::797     5e-04  27% 1100 aa  MPH1_ASPTN RecName: Full=ATP-dependent DNA helicase mph1;       
  704::776     5e-04  27% 1101 aa  MPH1_ASPFU RecName: Full=ATP-dependent DNA helicase mph1;       
  704::776     5e-04  27% 1101 aa  MPH1_ASPFC RecName: Full=ATP-dependent DNA helicase mph1;       
  455::517     5e-04  33% 1657 aa  DCL4_ORYSJ RecName: Full=Endoribonuclease Dicer homolog 4;       
  468::547     6e-04  31%  673 aa  UVRB_PARUW RecName: Full=UvrABC system protein B;       
  454::551     6e-04  25%  698 aa  UVRB_BEUC1 RecName: Full=UvrABC system protein B;       
  425::587     6e-04  25%  693 aa  RECG_PASMU RecName: Full=ATP-dependent DNA helicase recG;       
  512::637     6e-04  30%  950 aa  RAPA_PSEAE RecName: Full=RNA polymerase-associated protein rapA;   
  512::637     6e-04  30%  950 aa  RAPA_PSEA8 RecName: Full=RNA polymerase-associated protein rapA;   
 1419::1534    6e-04  32% 3083 aa  POLG_ZYMVR RecName: Full=Genome polyprotein;Contains:  RecName:
 1420::1535    6e-04  30% 3140 aa  POLG_PPVRA RecName: Full=Genome polyprotein;Contains:  RecName:
 1421::1536    6e-04  30% 3141 aa  POLG_PPVD RecName: Full=Genome polyprotein;Contains:  RecName:
  469::562     8e-04  27% 1277 aa  YE077_YEAST RecName: Full=Y' element ATP-dependent helicase
  448::545     8e-04  26%  672 aa  UVRB_ONYPE RecName: Full=UvrABC system protein B;       
  510::635     8e-04  30%  948 aa  RAPA_PSEPW RecName: Full=RNA polymerase-associated protein rapA;   
  457::589     8e-04  30%  949 aa  RAPA_PSEF5 RecName: Full=RNA polymerase-associated protein rapA;   
 1419::1534    8e-04  32% 3083 aa  POLG_ZYMVS RecName: Full=Genome polyprotein;Contains:  RecName:
 1416::1531    8e-04  31% 3080 aa  POLG_ZYMVC RecName: Full=Genome polyprotein;Contains:  RecName:
  551::595     8e-04  33% 1105 aa  MPH1_DEBHA RecName: Full=ATP-dependent DNA helicase MPH1;       
  740::812     8e-04  27% 1110 aa  MPH1_COCIM RecName: Full=ATP-dependent DNA helicase MPH1;       
  752::811     8e-04  30% 1129 aa  MPH1_ASPOR RecName: Full=ATP-dependent DNA helicase mph1;       
  749::808     8e-04  32% 1124 aa  MPH1_ASPNC RecName: Full=ATP-dependent DNA helicase mph1;       
    1::634

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxLDKLDAMLNADAAPAVEASENGFAKLGLDAAILRALAEANYN
RHLE_ECOLI      --------------------------------------------------FDSLGLSPDILRAVAEQGYR
SRMB_HAEIN      --------------------------------------------------FEQFDLSPELLKALEKKGYS
CSHA_BACHK      --------------------------------------------------FRELGLSDSLLQSVESMGFE
CSHA_BACCZ      --------------------------------------------------FRELGLSDSLLQSVESMGFE
CSHA_BACCR      --------------------------------------------------FRELGLSDSLLQSVESMGFE
CSHA_BACC1      --------------------------------------------------FRELGLSDSLLQSVESMGFE
CSHA_BACAN      --------------------------------------------------FRELGLSDSLLQSVESMGFE
CSHA_BACAH      --------------------------------------------------FRELGLSDSLLQSVESMGFE
SRMB_ECOLI      --------------------------------------------------------------ALQDKGFT
CSHA_GEOKA      --------------------------------------------------FQELGLSQEVMKAIERMGFE
CSHA_BACSU      --------------------------------------------------FQDFNLSSDLMKAINRMGFE
DED1_PHANO      -------------------------------------------VEASGQGFTNPPLDDHLLSNIELSGYK
DED1_CHAGB      --------------------------------------------------FSNPPLDAHLLSNIELARYQ
DED1_ASPCL      ------------------------------------------------NAFTNPPLDDHLISNIKLARYQ
DED1_COCIM      --------------------------------------------------FTNPPLDDHLISNIKLATYK
DED1_ASPOR      ------------------------------------------------NAFTNPPLDDHLIANITLAHYQ
RH52C_ORYSJ     --------------------------------------------------FAEIDLGQALNDNIRRCKYV
CSHA_BACLD      --------------------------------------------------FQDFQLSSDLTKAIKRMGFE
RH52A_ORYSJ     ----------------------------LDKYDIPVEVSGED-VPPPADGFEAAGLVEAVLRNVARCGYE
DED1_NEOFI      ------------------------------------------------NAFTNPPLDDHLISNIKLARYQ
DED1_ASPTN      ------------------------------------------------NAFTNPPLDDHLISNIALARYL
DEAD_SHIFL      -----------------------------------------------ETTFADLGLKAPILEALNDLGYE
DEAD_ECOLI      -----------------------------------------------ETTFADLGLKAPILEALNDLGYE
DEAD_ECOL6      -----------------------------------------------ETTFADLGLKAPILEALNDLGYE
DEAD_ECO57      -----------------------------------------------ETTFADLGLKAPILEALNDLGYE
DEAD_KLEPN      -----------------------------------------------ETTFADLGLKAPILEALTDLGYE
DED1_SCLS1      --------------------------------------------------FTNPPLDDHLIKNIELAHYK
DED1_ASPFU      ------------------------------------------------NAFTNPPLDDHLISNIKLARYQ
RRP3_NEUCR      --------------------------------------DVAPEVETVKKTFKDLGIVDALCEACERLGYK
DED1_ASPNC      ------------------------------------------------NAFTNPPLDDHLIENIKLAHYQ
DEAD_MYCTU      ---------------------------------------------ASAATFADLQIHPRVLRAIGDVGYE
DED1_BOTFB      --------------------------------------------------FTNPPLDDHLIKNIELAHYK
DED1_YARLI      ------------------------------------------------NAFTSPPLEEHLLTNIKLARYN
DED1_GIBZE      -------------------------------------------------------LDEHLCRNIELAHYK
RRP3_SCLS1      --------------------------------------------------FKDLGIVDSLCEACDTLGYK
DED1_KLULA      ------------------------------------NYDDIP-VEASGNDFHSPPLDPLLLDNIKLARFT
DBPA_ECOLI      -------------------------------------------------------LPPAQLTNLNELGYL
EXP9_STRR6      --------------------------------------------------FNELNLSADLLAEIEKAGFV
EXP9_STRPN      --------------------------------------------------FNELNLSADLLAEIEKAGFV
RRP3_EMENI      ---------------------------------------------APAKSFKELGIIDQLCEACENMGYK
RH37_ARATH      ------------------------------------------------NTFAEIDLGEALNLNIRRCKYV
RRP3_AJECN      --------------------------------------DESPQVQREEKSFKDLGIIDSLCEACEALGYK
DRS1_ASHGO      ----------------------------------------APSNEGEESTFNSLSLSRPVLKGLAALGYT
RRP3_GIBZE      ------------------------------------------AVDAPKKTFKDLGVNDALCEACEKLNYK
RRP3_ASPCL      ------------------------------------NAEAQDGPESSETSFKDLGIIDQLCEACATMGYK
DED1_NEUCR      --------------------------------------------------FSNPPLDNHLISNIQLARYN
RRP3_BOTFB      --------------------------------------------------FKDLGIVDSLCEACDTLGYK
DBP1_YEAST      --------------------------------------------------FSSPPLDELLMENIKLASFT
DBP1_YEAS7      --------------------------------------------------FSSPPLDELLMENIKLASFT
RH52_ARATH      ------------------------------------------------NTFAEIDLGEALNLNIQRCKYV
DED1_SCHPO      ------------------------------------------------NEFTSPPLNSHLLQNIKLSGYT
RRP3_NEOFI      --------------------------------------------------FKDLGIIDQLCEACETMGYK
RRP3_ASPFU      --------------------------------DPLETQDEATATESAPKSFKDLGIIDQLCEACETMGYK
DED1_EMENI      ------------------------------------------------NTFTNPPLDDHLISNIALARYQ
RHLB_PSESM      --------------------------------------------------FHDFNLAPELMHAIQDLGFP
DED1_AJECN      -------------------------------------------VPESITAFTNPPLHEHLLSNIVLARYT
DED1_USTMA      --------------------------------------------------FTSPPIDAHLLENIKLARYT
DED1_LODEL      ------------------------------------------------NSFTAPPLDELLVENIKLSRFT
DBP1_CANGA      ------------------------------------NYDDIPVEASGDNEFKSPPLDELLLENVELANFS
RH11_ARATH      ------------------------------------------------NTFADIDLGDALNLNIRRCKYV
RH37_ORYSJ      ------------------------------------------------NTFAEIDLGDALNENIRRCKYV
DED1_PICGU      ------------------------------------NYDDIP-VEATGDGFTAPPLDPLIVENIKLSRFT
DED1_MAGGR      --------------------------------------------------FSNPPLDDHLISNIELARYK
RRP3_COCIM      --------------------------------------------------FKDLGIIDSLCEACDSLGYK
RHLB_PSEAE      --------------------------------------------------FHDFNLAPSLMHAIHDLGFP
RHLB_PSEAB      --------------------------------------------------FHDFNLAPSLMHAIHDLGFP
RHLB_PSEA8      --------------------------------------------------FHDFNLAPSLMHAIHDLGFP
RRP3_CRYNE      --------------------------------------------------FADLGISPELCRACASMGFK
DB10_NICSY      -------------------------------------------VPAPLTSFEATGFPSEIVREMHQAGFS
DED1_DEBHA      ------------------------------------NYDDIP-VEASGEGFTAPPLDPLLVENVKLSRFT
DED1_ASHGO      --------------------------------------------------FTSPPLDELLLENIKLARFT
RRP3_DEBHA      -----------------------------------------PTAELKFKSFNELKLIPELLEAIQQMKFT
DBPA_BACSU      -----------------------------------------------------------ILRALEGLGYT
DED1_VANPO      --------------------------------------------------FTSPPLDALLLENIILARFT
RRP3_CHAGB      ------------------------------------DASGEESEEPAPKTFQDLGIVDSLCDACKELGWK
RHLB_PSEPK      --------------------------------------------------FHDFKLSNELMHAIHDLGFP
DEAD_HAEIN      --------------------------------------------------FNDLGLPEFILKAVSDLGFE
RRP3_PICGU      --------------------------------------------------FSELNLVPELMEAIEKLKYT
RH52B_ORYSJ     ------------------------------------------------NTFAEIDLGDALNENIRRCKYV
DEAD_BUCAI      -----------------------------------------------ESTFSFLGLNPFIIQSLNEMGYV
RH30_ARATH      -----------------------------------------------------------ILEAIAKLGFT
DRS1_CANGA      --------------------------------------------------FNDLALSRPVMKGLSNLGYV
DEAD_BUCAP      ----------------------------------------------TESTFSFLGLNPFIIKSLSKMGYV
RHLB_XYLFT      --------------------------------------------------FSSFDLHPALLTGLTRAGFT
RHLB_TOLAT      ----------------------------------------------TEITFAELGLEPQVLAGVEAKGFH
DDX3Y_HUMAN     --------------------------------------------------FSDIDMGEIIMGNIELTRYT
RHLB_XYLFA      --------------------------------------------------FSSLDLHPALLTGLTRAGFT
RHLB_PECCP      ----------------------------------------------TEQKFSDFALHPQVIEALESKGFH
PRP28_SCHPO     ------------------------------------------------------GLPSEMLKVLKKVNYK
DBP2_CRYNE      --------------------------------------------------FEEAGFPDYIMSEIRRMGFT
DED1_CANGA      --------------------------------------------------FTSPPLDSLLLENIKLARFT
DDX3Y_PONAB     --------------------------------------------------FSDIDMGEIIMGNIELTRYT
RRP3_PICST      -----------------------------------------PDDEVKFSTFSELKLVPELLEAIQQMKFS
RHLB_XANOR      --------------------------------------------------FSSFDLHPALVAGLESAGFT
DDX3_DROME      --------------------------------------------------FDDVQLTEIIRNNVALARYD
DBP2_SCLS1      -----------------------------------------PNIPKPVETFDEAGFPAYVMTEVKAQGFP
RRP3_ASPNC      --------------------------------------------------FKELGIIEQLCEACETMGYK
DRS1_CANAL      -----------------------------DSAEAIADFYEESSPQQTHTSFQTLQLSRPVLKGIAELKFT
RHLB_XANC5      --------------------------------------------------FSSFDLHPALIAGLESAGFT
RHLB_XANAC      --------------------------------------------------FSSFDLHPALIAGLESAGFT
RHLB_SHESR      ----------------------------------------------SNQKFADLPLHPEVKQALAENGFE
RHLB_SHESM      ----------------------------------------------SNQKFADLPLHPEVKQALAENGFE
RHLB_XANCP      --------------------------------------------------FSSFDLHPALVAGLESAGFT
RHLB_XANCB      --------------------------------------------------FSSFDLHPALVAGLESAGFT
RHLB_XANC8      --------------------------------------------------FSSFDLHPALVAGLESAGFT
RH10_ARATH      --------------------------------------------------FAELGVREELVKACERLGWK
DDX3Y_PANTR     --------------------------------------------------FGDIDMGEIIMGNIQLTRYT
RRP3_ASPOR      --------------------------------------EPSEAPKQAPKSFKELGLIEQLCEACDSMGYK
RHLB_SHESW      ----------------------------------------------STQKFADLPLHPEVKQALAENGFE
RHLB_SHEPC      ----------------------------------------------STQKFADLPLHPEVKQALAENGFE
RHLB_SHEON      ----------------------------------------------SNQKFADLPLHPEVKQALAENGFE
RHLB_SHEDO      ----------------------------------------------STQRFADLPLHAEVIQALNENGFE
DDX47_BOVIN     -----------------------------DSLESMEAPQTAVEVEETKT-FKDLGVTDVLCEACDQLGWT
DBP2_BOTFB      -----------------------------------------PNIPKPVETFDEAGFPAYVMTEVKAQGFP
RHLB_SHESH      ----------------------------------------------SNQKFADFSLQTEIKTALNESGFE
DED1_CRYNE      --------------------------------------------------FTNPPINPVLLENVKYARYA
DDX17_DICDI     --------------------------------------------------FTQAPFPGYLMKEIIGAGFP
RHLB_SHESA      ----------------------------------------------SNQKFADLPLHPEVKQALAENGFE
RHLB_SHELP      --------------------------------------------------FADFSLHPEIQQALVESGFE
RHLB_ERWCT      ----------------------------------------------TEQKFSDFALHPQVIEALESKGFH
RRP3_PHANO      --------------------------------------------------FADLGVREELCDACENLGYK
RHLB_ENTS8      ----------------------------------------------TEQKFSDFALHPVVVQALEKKGFY
RHLB_ENT38      ----------------------------------------------TEQKFSDFALHAKVIEALENKGFH
DDX3L_MOUSE     --------------------------------------------------FSDVEMGEIIMGNIELTRYT
RHLB_SHEB9      ----------------------------------------------STQRFADLPLHPEVKQALAENGFE
RHLB_SHEB8      ----------------------------------------------STQRFADLPLHPEVKQALAENGFE
RHLB_SHEB5      ----------------------------------------------STQRFADLPLHPEVKQALAENGFE
RHLB_SHEB2      ----------------------------------------------STQRFADLPLHPEVKQALAENGFE
RRP3_CANAL      -----------------------------------------PDAELKFKTFKELNLVPDLLESIESMKFT
RHLB_SHEFN      ----------------------------------------------STKKFADFPLKPEILAALNENGFE
DED1_CANAL      -------------------------------------------------------LDELLVENIQLSRFT
RHLB_SHEWM      ----------------------------------------------SNQKFADFSLNKEIKTALNESGFE
PRP28_NEOFI     ------------------------------------------------------GLPKRLLELVDQVGYK
PRP28_ASPFU     ------------------------------------------------------GLPKRLLELVDQVGYK
DDX3_DICDI      --------------------------------DDDISIETSEHICAPLNSFADVDLGDVLLGNIKHAKYT
DDX3X_MOUSE     --------------------------------------------------FSDVEMGEIIMGNIELTRYT
RHLB_KLEP7      ----------------------------------------------TEQKFSDFALHPAVIEALEKKGFH
RHLB_ACTSZ      ----------------------------------------------SQQRFADLPLHPQILAALNDQNFE
DRS1_VANPO      --------------------------------------------------FNSLTLSRPVLKGLSDLGYT
DRS1_KLULA      ---------------------------------------SADAKKIVHKTFNSLSLSRPVLKGLGSLGYT
DDX3X_HUMAN     --------------------------------------------------FSDVEMGEIIMGNIELTRYT
RHLB_SHEPW      ----------------------------------------------STKKFADFPLHKEVQQALNEVGFE
RHLB_SERP5      ----------------------------------------------TEQKFSDFALHPLVLEALEKKGFQ
RHLB_KLEP3      ----------------------------------------------TEQKFSDFALHPAVIEALEKKGFH
DDX3_XENLA      --------------------------------------------------FHDVTMGEIIMGNIQLTRYT
RRP3_ASPTN      --------------------------------------------------FRELGVIDSLCEACEELGYT
RHLB_PROMH      ----------------------------------------------TEKKFSDFALHPKVIEALEKKGFS
RHLB_ALISL      ----------------------------------------------TEQKFADLGLEPQVLDGLNAKGFI
RHLB_SHISS      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_SHIFL      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ESCF3      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECOUT      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECOSE      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECOLU      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECOLI      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECOLC      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECOL6      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECOL5      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECOK1      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECOHS      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECODH      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECOBW      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECO8A      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECO81      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECO7I      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECO55      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECO45      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECO27      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECO24      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
DDX47_MOUSE     --------------------------------------------------FKDLGVTDVLCEACDQLGWA
DDX3Y_MOUSE     --------------------------------------------------------------------YT
RHLB_SHIDS      ----------------------------------------------TEQKFSDFSLHPKVVEALEKKGFH
RHLB_ECOSM      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_ECO5E      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
DDX23_HUMAN     -----------------------------------------------------------ILEVIDKCGYK
RHLB_SHIF8      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RHLB_CITK8      ----------------------------------------------TEQKFSDFALHPKVIEALENKGFH
DRS1_PICST      --------------------------------------------------FQTLQLSRPVLKGLSQLGYT
DDX47_HUMAN     -----------------------------------------PIVEEEETKFKDLGVTDVLCEACDQLGWT
RRP3_CANGA      --------------------------------------------------FAQLNLVPELIQACQNLNFT
DDX41_DROME     --------------------------------------------------FREMKFPKGILNGLAAKGIK
DDX17_TRYBB     -----------------------------------------------------------LLKKLTAQNFT
RHLB_SHIBS      ----------------------------------------------TEQKFSDFALHPKVVEVLEKKGFH
RHLB_SHIB3      ----------------------------------------------TEQKFSDFALHPKVVEVLEKKGFH
RHLB_SALAR      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_HAEIN      ----------------------------------------------SQQRFSALPLHPIVRGALAKKGFD
RHLB_ECO57      ----------------------------------------------TEQKFSDFALHPKVVEALEKKGFH
RH21_ORYSJ      ---------------------------------------------------SKLGTE--LLRAVEKAGYK
DDX42_DICDI     --------------------------------------------------FGHYGFDDILLQAIAKQSIE
RHLB_SALPK      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
DRS1_YEAST      ----------------------------------------APETEGDEENFNSLSLSRPVLKGLASLGYV
DRS1_YEAS7      ----------------------------------------APETEGDEENFNSLSLSRPVLKGLASLGYV
DDX47_CAEEL     --------------------------------------------------FAELGVSQPLCDACQRLGWM
DBP3_SCLS1      -------------------------------------------------------------------DFK
RHLB_SALTY      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_SALTI      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_SALSV      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_SALPC      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_SALPB      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_SALNS      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_SALHS      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_SALG2      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_SALEP      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_SALDC      ----------------------------------------------TEQKFSDFALHPQVVEALEKKRFY
RHLB_SALCH      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_SALA4      ----------------------------------------------TEQKFSDFALHPQVVEALEKKGFY
RHLB_HAEIG      ----------------------------------------------SQQRFSALPLHPIVRGALAKKGFD
PRP28_COCIM     ------------------------------------------------------GLPKRLLEIIDKVGYK
PRP28_ASPCL     ------------------------------------------------------GLPKRLLELVDRVGYK
DEAD_BUCBP      --------------------------------------------------FSSFGLNSCIITALNDIGYV
DDX42_PONAB     ------------------------------KLNLRVSGAAPPRPGSS---FAHFGFDEQLMHQIRKSEYT
DDX42_MOUSE     ------------------------------KLNLRVSGAAPPRPGSS---FAHFGFDEQLMHQIRKSEYT
DDX42_HUMAN     ------------------------------KLNLRVSGAAPPRPGSS---FAHFGFDEQLMHQIRKSEYT
DBP2_CANAL      --------------------------------------------------FDEAGFPDYVLQEVKDQGFP
RHLB_SODGM      ----------------------------------------------TEKKFSDFALYPPIVEVLDSKGFN
RRP3_YARLI      --------------------------------------------EEQTKTFKDLGVIDSICETCEELKFT
RHLB_HAES2      ----------------------------------------------SQQRFSDLALHRIVQQAIKEKGFE
RH28_ORYSJ      ------------------------------------------------NSFLELNLSRPLLRACEALGYQ
DDX23_PONAB     -----------------------------------------------------------ILEVIDKCGYK
RHLB_YERPY      ----------------------------------------------TEQKFSDFALHPLVVEALENKGFQ
RHLB_YERPS      ----------------------------------------------TEQKFSDFALHPLVVEALENKGFQ
RHLB_YERPP      ----------------------------------------------TEQKFSDFALHPLVVEALENKGFQ
RHLB_YERPN      ----------------------------------------------TEQKFSDFALHPLVVEALENKGFQ
RHLB_YERPE      ----------------------------------------------TEQKFSDFALHPLVVEALENKGFQ
RHLB_YERPB      ----------------------------------------------TEQKFSDFALHPLVVEALENKGFQ
RHLB_YERPA      ----------------------------------------------TEQKFSDFALHPLVVEALENKGFQ
RHLB_YERP3      ----------------------------------------------TEQKFSDFALHPLVVEALENKGFQ
PRP28_ASPOR     ------------------------------------------------------GLPKRLMELVNKVGYK
RRP3_YEAST      --------------------------------------------DESFESFSELNLVPELIQACKNLNYS
RRP3_YEAS7      --------------------------------------------DESFESFSELNLVPELIQACKNLNYS
RHLB_SHEAM      ----------------------------------------------TQQKFADLPLCDEVKQALNENGFE
RHLB_PHOLL      ----------------------------------------------TEKKFSDFALHPKVIEALDNKGFS
RHLB_HAES1      ----------------------------------------------SQQRFSDLALHRSVQQAIKEKGFE
RHLB_ERWT9      ----------------------------------------------TEQKFSDFALHPQVIEALETKGFH
RHLB_AERS4      --------------------------------------------------FAQMGLEPEVLAGLESKGFH
DBP10_NEUCR     -------------------------------------------------GFQAMGLNAHLLRAITRKGFS
RHLB_HAEIE      ----------------------------------------------SQQRFSDLSLHPIVRDTLAKKGFD
RHLB_AERHH      --------------------------------------------------FAQMGLEPEVLAGLESKGFH
PRP28_EMENI     ------------------------------------------------------GLPKRLLELVDRVGYK
DRS1_DEBHA      --------------------------------------EATTAKKQLHTTFQSLQLSRPVLKGLSQLGYT
DDX47_DICDI     --------------------------------------------------FESLGVHPQIIDACNKLGFN
RRP3_MAGGR      --------------------------------------------ETPTKSFRDLGIVEPLCEACEALKFK
RH21_ARATH      -------------------------------------------------------LTSELLKAVERAGYK
PRP28_ASPTN     --------------------------------------------------WAESGLPSRLLDLVHRVGYK
DRS1_CRYNE      -----------------------------------------------------MNLSRPLLRALTSLQFT
DED1_PICST      ------------------------------------NYDDIP-VEASGDGFTAPPLDELLVENITMSRFT
RHLB_VIBHB      ----------------------------------------------TEQKFADLGLKPQVTEGLEKKGFE
RH14_ARATH      --------------------------------------------------FEATGFPPELLREVLSAGFS
RHLB_VIBSL      ----------------------------------------------TEQKFADLDLLPQVIEGLEKKGFD
RHLB_HAMD5      ----------------------------------------------TDQKFSDFALHPLVIKAIENQGFY
PRP28_GIBZE     -------------------------------------------------------LPQRLLNIVDDVGYK
RHLB_VIBVU      ----------------------------------------------TEQKFADLGLNPQVVEGLEKKGFE
RHLB_PHOPR      ----------------------------------------------TEQKFADLGLEPTVLEGLDAQGFH
DED1_YEAST      --------------------------------------------------FTSPPLDGLLLENIKLARFT
DED1_YEAS7      --------------------------------------------------FTSPPLDGLLLENIKLARFT
RHLB_VIBPA      ----------------------------------------------TEQKFADLGLQPQVTEGLEKKGFE
PRP28_SCLS1     -------------------------------------------------------LPKRLLDVINQVGYD
DBP2_CANGA      --------------------------------------------------FDEAGFPDYVLKEVKAEGFD
PRP28_NEUCR     -------------------------------------------------------LPRRLLDIVKNVGYD
DBP3_SCHPO      --------------------------------------------------FDELDVSAKLREGLK--NYK
RHLB_SHEPA      ----------------------------------------------STQKFADFPLHKEVHQALNEAGFE
RH3_ARATH       -----------------------------DEYDLDGDNNNVEADDGEELAISKLSLPQRLEESLEKRGIT
PRP28_BOTFB     -------------------------------------------------------LPKRLLDVIHQVGYD
DDX42_CHICK     ------------------------------KLNLRVSGAAPPRPGSS---FARFGFDEQLMHQIRKSEYT
DDX17_DROME     --------------------------------------------------FSEVHLPDYVMKEIRRQGYK
RRP3_KLULA      -----------------------------------------------------LDLVPELIEACKNLNYN
RHLB_VIBVY      ----------------------------------------------TEQKFADLGLNPQVVEGLEKKGFE
RH46_ARATH      --------------------------------------------------FEATGLPNELLREVYSAGFS
DDX17_MOUSE     -----------------------------------------------------------VMDVLMDQHFT
DDX17_HUMAN     -----------------------------------------------------------VMDVLMDQHFT
RHLB_SHEHH      ----------------------------------------------STQKFADFPLHKEVHQALNEAGFE
DRS1_NEUCR      -----------------------------------------PKKKGEMSSFQEMSLSRPILRGLTSVGFT
DBP2_YARLI      --------------------------------------------------FDEAGFPPYVLKEVKQQGFE
DBP10_AJECN     -------------------------------------------------GFQSLGLNAALLKAITRKGFS
RHLB_VIBFM      ----------------------------------------------TEQNFADLGLQPQVIDGLNAKGFI
RHLB_VIBF1      ----------------------------------------------TEQNFADLGLQPQVIDGLNAKGFI
VASA_DROME      --------------------------------------------------FTSADLRDIIIDNVNKSGYK
DBP10_SCLS1     -------------------------------------------------GFQAMGLNSHLLKAISRKGFN
DDX46_DANRE     --------------------------------------------------WVQCGISMKVLNALKKHNYE
DDX42_XENLA     ------------------------------KLNLRVSGAAPPRLCSS---FAHFGFDEQLLHQIRKSEYT
RHLB_VIBCM      ----------------------------------------------TEHKFADFGLQPQVIDGLEKKGFV
RHLB_VIBCH      ----------------------------------------------TEHKFADFGLQPQVIDGLEKKGFV
RHLB_VIBC3      ----------------------------------------------TEHKFADFGLQPQVIDGLEKKGFV
FAL1_USTMA      --------------------------------------DSKLAFESSEHTFDAMGLKEDLLRGIYAYNFE
DDX5_PONAB      --------------------------------------------------FYEANFPANVMDVIARQNFT
DDX5_HUMAN      --------------------------------------------------FYEANFPANVMDVIARQNFT
DBP10_GIBZE     -------------------------------------------------GFQAMGLNNNLLKAITRKGFS
RH24_ORYSJ      --------------------------------------------------FADCGFPVQLMNAIAKQGYE
PRP28_PHANO     ------------------------------------------------------GLPDKVLRLVEHVGYA
PRP28_ASPNC     -------------------------------------------------------LPKRLMELINRVGYK
DDX5_MACFA      --------------------------------------------------FYEANFPANVMDVIARQNFT
DDX4_XENLA      -----------------------------DKYDEILGKDVPPAILT----FEEANLCETLRRNVARAGYV
RRP3_VANPO      -----------------------------------------------------LDLVPELIEACKNLNFA
DBP2_KLULA      --------------------------------------------------FDEAGFPSYVLDEVKQEGFA
RH40_ARATH      --------------------------------------------------FESSGLPPEILRELLSAGFP
RH14_ORYSJ      --------------------------------------------------FQSTGFPPEILREVQQAGFS
DDX5_MOUSE      --------------------------------------------------FYEANFPANVMDVIARHNFT
DDX4_RANLE      -----------------------------DKYDDIVGSDVPPAILT----FEEANLCDSLAKNVCKSGYV
DBP10_COCIM     -------------------------------------------------GFQAMGLNANLLKAITRKGFS
Y956_STAHJ      --------------------------------------------------FKELGISDKTVETLEAMGFK
Y1679_STAES     --------------------------------------------------FKELGISDKTVQTLEAMGFK
DBP3_GIBZE      ------------------------------------------------------------------ANYK
DBP2_SCHPO      --------------------------------------------------FEEAGFPNYVLKEVKQLGFE
RRP3_USTMA      --------------------------------------------------FSDLGVIPQIVEACTNMGFK
DDX4_HUMAN      -----------------------------DKYDTILGHDAPPAILT----FEEANLCQTLNNNIAKAGYT
DBP2_COCIM      --------------------------------------------------FDEAGFPQYVISEVKAQGFA
Y1688_STAEQ     --------------------------------------------------FKELGISDKTVQTLEAMGFK
PRP11_SCHPO     ----------------------------VDELRASLDGIKIRGIDCPKTSWSQCGLSAQTISVINSLGYE
DBP10_ASPOR     -------------------------------------------------GFQAMGLNAHLLKAITRKGFS
Y802_STAS1      --------------------------------------------------FKELGISDKMAETLQSMGFN
DDX5_PANTR      --------------------------------------------------FYEANFPANVMDVIARQNFT
DDX23_DICDI     -------------------------------------------------------LPREILEAIRQLGYE
DBP3_BOTFB      -------------------------------------------------------------------DFK
DDX4_PIG        -----------------------------DKYDTILGHDAPPAILT----FEEANLCQTLNNNIAKAGYT
DDX49_HUMAN     -------------------------------------------------GFAELGLSSWLVEQCRQLGLK
DBP2_ASPNC      --------------------------------------------------FDEAGFPQYVLSEVKAQGFD
DBP2_YEAST      --------------------------------------------------FDEAGFPDYVLNEVKAEGFD
DBP2_YEAS7      --------------------------------------------------FDEAGFPDYVLNEVKAEGFD
DDX4_MOUSE      -----------------------------DKYDTILGHDAPPAILT----FEEANLCQTLNNNIAKAGYT
DDX49_MOUSE     -------------------------------------------------GFAEIGLSSWLVEQCRQLGLK
DBP3_PHANO      ------------------------------------------------------------------AGFT
DBP2_ASPCL      --------------------------------------------------FDEAGFPQYVLSEVKSQGFE
FAL1_YARLI      --------------------------------------------------FESMDLKDDLLRGIYAYGFE
DBP2_ASPOR      --------------------------------------------------FDEAGFPQYVLSEVKAQGFE
DBP10_CHAGB     -------------------------------------------------GFQAMGLNSNLLRAISRKGFS
RH5_ORYSJ       ---------------------------------------SADAKYAPLSSFAATALPPQVLDCCK--GFE
DRS1_GIBZE      -----------------------------------------PDKKATASSFQTMSLSRPIMRGLASVGFT
DBP3_YARLI      --------------------------------------------------FSHVTLDPRITKVLTK--FP
DBP2_PICST      --------------------------------------------------FDEAGFPEYVLNEVKAQGFP
DDX4_MACFA      -----------------------------DKYDTILGHDAPPAILT----FEEANLCQTLNNNIAKAGYT
DBP2_USTMA      --------------------------------------------------FDEAGFPDYILSEIKKMGFS
DBP2_ASPFU      --------------------------------------------------FDEAGFPQYVLSEVKAQGFE
DBP10_NEOFI     -------------------------------------------------GFQAMGLSANLLKAIARKGFS
RRP3_ASHGO      ------------------------------------------------SSFRELDLVPELIEACDNLNFT
DHH1_VANPO      ------------------------------------------------NTFEDFYLKRELLMGIFEAGFE
RH24_ARATH      --------------------------------------------------FEDCGFSSQIMSAIKKQAYE
PRP28_CRYNE     -------------------------------------------------------IPSQILDIIEEIGYK
DBP2_EMENI      --------------------------------------------------FDEAGFPQYVLSEVKAQGFE
DBP2_DEBHA      --------------------------------------------------FDEAGFPDYVLKEVKQQGFP
RH10_ORYSJ      --------------------------------------------------FAELGVVPELVAACDAMGWK
DBP2_NEOFI      --------------------------------------------------FDEAGFPQYVLSEVKAQGFE
DBP10_ASPFU     -------------------------------------------------GFQAMGLSANLLKAIARKGFS
RHLB_PASMU      ----------------------------------------------SQLRFSDLPLHHQVLAALQEKGFD
DBP3_CRYNE      --------------------------------------------------------------------FE
DBP3_LODEL      ----------------------------------------------------------------------
DBP2_PICGU      --------------------------------------------------FDEAGFPDYVLNEVKQQGFP
RH29_ORYSJ      --------------------------------------EGASKRKAKSGGFESMGLCEEVYRGVRHKGYR
PRP28_MAGGR     ---------------------------------------------------------------IKQVGYT
DRS1_MAGGR      --------------------------------------------------FQSMSLSRPILRGLTSVGFA
DHH1_KLULA      --------------------------------------------------FEDFYLKRELLMGIFEAGFE
DHH1_DEBHA      --------------------------------------------------FEDFPLKRELLMGIFEAGFE
DHH1_YARLI      -------------------------------------------------GFEDFFLKRELLMGIFEAGFE
DHH1_CANGA      ------------------------------------------------NSFEDFYLKRELLMGIFEAGFE
RH42_ARATH      ------------------------------------------------------GLTSKILDTMKKLNYE
DHH1_YEAST      ------------------------------------------------NTFEDFYLKRELLMGIFEAGFE
DHH1_YEAS7      ------------------------------------------------NTFEDFYLKRELLMGIFEAGFE
DDX4_RAT        -----------------------------DKYDTILGHDAPPAILT----FEEANLCQTLNNNIAKAGYT
DBP2_GIBZE      --------------------------------------------------FDEAGFPRYVMDEVKAQGFP
DBP10_EMENI     -------------------------------------------------GFQAMGLNANLLKAIARKGFS
DBP2_AJECN      --------------------------------------------------FDEAGFPQYVMSEVKAQGFA
RH20_ORYSJ      --------------------------------------------------FRDVGFPEYVLQEITKAGFV
DDX4_BOVIN      -----------------------------DKYDTILGHDPPPAILT----FEEANLCQTLNNNIAKAGYT
DHH1_PICGU      --------------------------------------------------FEEFGLKRELLMGIFEAGFE
PRP28_DEBHA     --------------------------------------------------WAESKLPAKLLNILIKLGYD
DBP2_LODEL      --------------------------------------------------FDEAGFPDYVLNELKNQGFP
DBP2_ENCCU      --------------------------------------------------FEEAGFSSEVVSSLVEKGFS
RHLB_MANSM      ----------------------------------------------SQQRFADLPLNAKVLEALESNGFE
DHH1_CHAGB      --------------------------------------------------FEDFGLKRDLLMGIFEAGFE
DDX41_DICDI     --------------------------------------------------FKEMKIPKPVIDVLLEKGIK
DHH1_BOTFB      -----------------------------DNWKAGLNIPAKDTRQQTEDVTATKGLERELLMGIFEMGYE
DBP3_DEBHA      -------------------------------------------------GFDQIDLDSRIASVISK--FP
DBP10_ASPCL     -------------------------------------------------GFQAMGLSANLLKAIARKGFS
PRP5_USTMA      ------------------------------------------------------GLPASCLDVIKRLGYS
DHH1_PICST      --------------------------------------------------FEDFNLKRELLMGIFEAGFE
DDX6_DICDI      -------------------------------------------VTATENDFDDLHLKRDLLRGIFEKGYV
DBP3_USTMA      -------------------------------------------------------VDAAVKKTLDSQGFS
RH40_ORYSJ      -------------------------------------------VPAPITSFETGGFPPEILKEIQRAGFS
DHH1_MAGGR      --------------------------------------------------FENFGLKRDLLMGIFEAGFE
DBP3_COCIM      --------------------------------------------------------------------FS
RH43_ARATH      --------------------------------------------------FMDMKFPSPLLRMLKDKGIM
RH29_ORYSI      --------------------------------------------------FESMGLCEEVYRGVRHKGYR
DHH1_NEUCR      --------------------------------------------------------DRDLLMGIFEAGFE
RH30_ORYSJ      ------------------------------------------------------------MQAIAKSGFV
RH28_ARATH      --------------------------------------------------FMELNLSRPLLRACETLGYK
PRP28_CHAGB     ------------------------------------------AIPNPMRSWAESNLPRRLLEIVENVGYD
DRS1_LODEL      --------------------------------------------------FQELQLSRPILKSLQQLGFT
RH35_ARATH      --------------------------------------------------FKDMKFPRPVLDTLKEKGIV
IF4A_DICDI      --------------------------------------------------FESMGLREELLRGIFNYGFE
IF4A_CAEEL      --------------------------------------------------FDDMELKEELLRGIYGFGFE
DHH1_GIBZE      --------------------------------------------------FENFALKRDLLMGIFEAGFE
RHLB_PSEA6      ----------------------------------------------TETHFADLPINEQVVKALSAANFS
RH8_ORYSJ       ------------------------------------------------NEFEDYFLKRELLMGIYEKGFE
FAL1_NEUCR      --------------------------------------------------FESMSLKESLLRGIYAYGYE
DHH1_ASPCL      ------------------------------KWKEQLNVPAKDARPQTEDVTATKGLERELMMGIFEAGFE
DBP2_NEUCR      --------------------------------------------------FDEAGFPRYVMDEVKAQGFP
DBP10_ASPTN     -------------------------------------------------GFQAMGLNANLLKAITRKGFS
RH53_ORYSJ      ---------------------------------ASWSSPEAGAAVGGDDGLARLGISPWIVERLAARGIT
DHH1_NEOFI      -----------------------------------LNMPAKDARPQTEDVTATKGLERELMMGIFEAGFE
DHH1_CANAL      --------------------------------------------------FEDFNLKRELLMGIFEAGFE
DHH1_ASPFU      -----------------------------------LNMPAKDARPQTEDVTATKGLERELMMGIFEAGFE
DBP3_ASPFU      ------------------------------------------------------------------SSFS
DBP3_AJECN      -------------------------------------------------------------------HFS
DBP2_CHAGB      --------------------------------------------------FDEAGFPRYVMDEVKAQGFP
DBP10_MAGGR     --------------------------------------------------FQAMGLNPSLLQAITRKGFA
Y2316_STAA8     --------------------------------------------------FKELGISDNTVQSLESMGFK
Y2168_STAAR     --------------------------------------------------FKELGISDNTVQSLESMGFK
Y2081_STAAM     --------------------------------------------------FKELGISDNTVQSLESMGFK
Y2072_STAAC     --------------------------------------------------FKELGISDNTVQSLESMGFK
Y2037_STAA3     --------------------------------------------------FKELGISDNTVQSLESMGFK
Y2004_STAAW     --------------------------------------------------FKELGISDNTVQSLESMGFK
Y1985_STAAS     --------------------------------------------------FKELGISDNTVQSLESMGFK
Y1885_STAAN     --------------------------------------------------FKELGISDNTVQSLESMGFK
RH5_ARATH       ----------------------------------------------------------AALKTFAESNFE
PRP28_PICGU     ------------------------------------------------------GIPTTLLNTIDQLGYK
FAL1_MAGGR      --------------------------------------------------FESMALKESLLRGIYAYGYE
DHH1_ASPNC      ------------------------------KWKEQLNVPAKDARPQTEDVTATKGLERELMMGIFEAGFE
DBP3_PICGU      ----------------------------------------------------------------------
Y1965_STAAB     --------------------------------------------------FKELGISDNTVQSLESMGFK
DHH1_PHANO      -----------------------------------LKAPAKDARPQTEDVTATKGLERELMMGIFEAGFE
DHH1_ASPOR      -----------------------------------LKAPAKDARPQTEDVTATKGLERELMMGIFEAGFE
RH20_ARATH      --------------------------------------------------FRDVGFPDYVLEEVKKAGFT
FAL1_EMENI      --------------------------------------------------FEDMHLKESLLRGIYAYGYE
DRS1_PICGU      --------------------------------------------------FQALQLSRPLLKGVGNLGYT
DRS1_ASPOR      ------------------------------------------AAELSKKSFQEFNLSRPILRGLAAVNFT
RH6_ORYSJ       ------------------------------------------------NEFEDYFLKRELLMGIYEKGFE
IF4A_YARLI      --------------------------------------------------FDDLGLKDELLRGIYGYGFE
FAL1_SCHPO      ------------------------------------------------SSFEEMNLKEDLLRGIYAYGYE
FAL1_GIBZE      --------------------------------------------------FESMSLKENLLRGIYAYGYE
RH35A_ORYSJ     --------------------------------------------------FRDLRLPEPMLRKLREKGIV
RH34_ORYSJ      --------------------------------DENLTFETSPGVEVISS-FDQMGIREDLLRGIYAYGFE
RH25_ORYSJ      ------------------------------EFDAAKSGDESGGVDGSDTRFDQCTISPLSLKAVKDAGYE
DHH1_ASPTN      -----------------------------------------------------------LMMGIFEAGFE
RH8_ARATH       ------------------------------------------------NEFEDYFLKRELLMGIYEKGFE
FAL1_AJECN      --------------------------------------------------FEDMHLKENLLRGIYAYGYE
DDX53_HUMAN     -----------------------------------------------------------LLKSIIRVGIV
DBP2_MAGGR      ---------------------------------AVQGSDVPKPVET----FDEAGFPRYVMDEVKAQGFP
FAL1_ASPCL      --------------------------------------------------FEDMHLKESLLRGIYAYGYE
DDX59_MOUSE     --------------------------------------------------FEHCGFPETLNQNLKKSGYE
DDX46_RAT       --------------------------------------------------WVQCGISMKILNSLKKHGYE
DDX46_MOUSE     --------------------------------------------------WVQCGISMKILNSLKKHGYE
DDX46_HUMAN     --------------------------------------------------WVQCGISMKILNSLKKHGYE
FAL1_NEOFI      --------------------------------------------------FEDMHLKESLLRGIYAYGYE
FAL1_CANAL      --------------------------------------------------FESMNLKPDLLKGIYAYGFE
DDX59_HUMAN     --------------------------------------------------FEHCSLPEVLNHNLKKSGYE
RH2_ORYSJ       --------------------------------DENLTFETSPGVEVISS-FDQMGIRDDLLRGIYAYGFE
IF4A3_NICPL     --------------------------------------------------FAEMGIKDDLLRGVYQYGFE
FAL1_SCLS1      -----------------------------DRMEFTTSADVTVAPT-----FQDMHLKENLLRGIYAYGYE
FAL1_CHAGB      --------------------------------------------------FESMSLKESLLRGIYAYGYE
FAL1_BOTFB      -----------------------------DRMEFTTSADVTVAPT-----FQDMHLKENLLRGIYAYGYE
FAL1_ASPTN      --------------------------------------------------FEDMHLKESLLRGIYAYGYE
FAL1_ASPOR      --------------------------------------------------FEDMHLKESLLRGIYAYGYE
FAL1_ASPNC      --------------------------------------------------FEDMHLKESLLRGIYAYGYE
FAL1_ASPFU      --------------------------------------------------FEDMHLKESLLRGIYAYGYE
RHLB_PSYIN      ----------------------------------------------TQTKFADLPLEKSLISGLTSQGYE
IF4A_CRYPV      --------------------------------------------------FEALNLEGDLLRGIFAYGFE
IF4A3_TAEGU     --------------------------------------------------FDTMGLREDLLRGIYAYGFE
IF4A3_RAT       --------------------------------------------------FDTMGLREDLLRGIYAYGFE
IF4A3_PIG       --------------------------------------------------FDTMGLREDLLRGIYAYGFE
IF4A3_HUMAN     --------------------------------------------------FDTMGLREDLLRGIYAYGFE
IF4A3_CHICK     --------------------------------------------------FDTMGLREDLLRGIYAYGFE
IF4A3_BOVIN     --------------------------------------------------FDTMGLREDLLRGIYAYGFE
DHH1_COCIM      -----------------------------------------------------------LMMGIFEAGFE
DDX6_XENTR      ------------------------------------------------NEFEDYCLKRELLMGIFEMGWE
RRP3_SCHPO      --------------------------------------------------FKELGVIDELCEACEKLGFK
RH42_ORYSJ      ------------------------------------------------------GLTSKLLDTIKKLGFE
RH12_ORYSJ      ------------------------------------------------NEFEDYFLKRELLMGIYEKGFE
IF4A3_MOUSE     --------------------------------------------------FDTMGLREDLLRGIYAYGFE
DRS1_YARLI      --------------------------------------------ESVHKTFQTLNLSRPVMKGISALGYQ
DDX46_PONAB     --------------------------------------------------WVQCGISMKILNSLKKHGYE
RH2_ARATH       --------------------------------------------------FNDMGIKEDVLRGVYEYGFE
PRP28_LODEL     ------------------------------------------------------GLDPKILASLKSFGFR
IF4A_BOTFB      ------------------------------------------------DSFDTMNLKPELLRGVYAYGFE
DDX6_XENLA      ------------------------------------------------NEFEDYCLKRELLMGIFEMGWE
DBP2_ASHGO      --------------------------------------------------FDEAGFPEYVLKEVKEEGFE
RH7_ARATH       ------------------------------------------------NAVSKFRISAPLREKLKANGIE
IF4A_SCLS1      ------------------------------------------------DSFDTMNLKPELLRGVYAYGFE
DDX6_DROME      ------------------------------------------------NEFEEFCLKRELLMGIFEKGWE
DDX41_HUMAN     --------------------------------------------------FKEMKFPAAILRGLKKKGXX
DDX6_MOUSE      ------------------------------------------------NEFEDYCLKRELLMGIFEMGWE
DDX6_HUMAN      ------------------------------------------------NEFEDYCLKRELLMGIFEMGWE
DDX6_CHICK      ------------------------------------------------NEFEDYCLKRELLMGIFEMGWE
RH34_ARATH      --------------------------------------------------FDDMGMNDKVLRGVYDYGYK
IF4A3_SALSA     --------------------------------------------------FDTMGLREDLLRGIYAYGFE
IF4A3_MACFA     --------------------------------------------------FDTMGLREDLLRGIYAYGFE
DDX43_HUMAN     -----------------------------------------------------------VMENIKKAGFQ
DDX41_MOUSE     --------------------------------------------------FKEMKFPAAILRGLKKKGIL
DBP4_COCIM      --------------------------------------------------FSELPLSDATLQGLSASHFK
DBP3_ASPNC      --------------------------------------------------------NSALYRPLE--SFT
RH3_ORYSJ       ---------------------------------------------------ARLGLPEQLVSTLEKRGIT
DBP3_CANGA      --------------------------------------------------FNQISLDKEVQNEIAK--FP
PRP28_CANAL     -----------------------------------------------------------LVSIISQLGYE
IF4A3_XENTR     --------------------------------------------------FDTMGLREDLLRGIYAYGFE
RRP3_ENCCU      --------------------------------------------------FGDLRIDESLIKTCQEKGIT
DDX6_CAVPO      ------------------------------------------------NEFEDYCLKRELLMGIFEMGWE
CGH1_CAEEL      -----------------------------------------------------LGRD--LLMGIFEKGWE
I4A3B_XENLA     --------------------------------------------------FDTMGLREDLLRGIYAYGFE
DBP10_PICGU     ------------------------------------------ATKAKAGSFASFGLSKFLLKNIAKKGFK
PRP5_YARLI      --------------------------------------------------WTQLGLPGPTMGVLNDLRYD
FAL1_COCIM      --------------------------------------------------FDDMHLKENLLRGIYAYGFE
DBP10_CRYNE     -----------------------------------------------------LNVGPDLIRSLLIRKFK
DBP10_CANGA     -----------------------------------VNTDAKS--KHKKGSFASFGLSKLILVNISKRGFR
RH6_ARATH       ------------------------------------------------NEFEDYFLKRDLLRGIYEKGFE
DDX6_PONAB      ------------------------------------------------NEFEDYCLKRELLMGIFEMGWE
PRP5_LODEL      -----------------------------------------------------------------DLGFA
PRP5_CRYNE      ------------------------------------------------------GLPQGCLDVIKHQGWE
IF4A_ASPNC      ------------------------------------------------DSFDSMDLKPELLRGVYAYGFE
DRS1_USTMA      --------------------------------------------------FGAFDLSRPVLRALSSLSFH
DBP10_YARLI     ----------------------------------------------SSGSFAGLGLSQLVLKNIARKGFK
IF4A_CRYNE      ------------------------------------------------DNFDDMKLKGELLRGIYAYGFE
FAL1_YEAST      -----------------------------------------------------MNLKDDLLRGIYSYGFE
FAL1_YEAS7      -----------------------------------------------------MNLKDDLLRGIYSYGFE
DBP4_SCHPO      ------------------------------------------ALSETVDHFAELPLTQPTKSALKNAHFI
DBP10_SCHPO     ------------------------------------------------SNFQSMGLNQTLLRAIFKKGFK
PRP5_MAGGR      ------------------------------------------------------GLTRPILDVIAKLEYD
PRP5_GIBZE      --------------------------------------------------WAQCGLTRQTLDVVDNLGYE
IF4A_NEOFI      ------------------------------------------------DSFDSMELKPELLRGIYAYGFE
IF4A_MAGGR      ------------------------------------------------DSFDEMNLKSELLRGIYAYGFE
I4A3A_XENLA     --------------------------------------------------FDTMGLREDLLRGIYAYGFE
DDX49_DICDI     ----------------------------------------------SDKTFEELGLTTWLVANCKQLGFK
DBP10_KLULA     -----------------------------DDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFR
IF4A_SCHPO      --------------------------------------------------FDDMNLKPELLRGIYAYGFE
IF4A_NEUCR      ------------------------------------------------DSFDEMNLKPELLRGIYAYGFE
IF4A_ASPFU      ------------------------------------------------DSFDAMDLKPELLRGVYAYGFE
IF4A3_DANRE     --------------------------------------------------FDTMGLREDLLRGIYAYGFE
DBP4_ASPTN      -------------------------------------------LKESFKAFTDLPLSEPTLSGLSASHYK
DBP3_KLULA      ------------------------------------------------------------------SKFP
DHH1_SCHPO      -------------------------------------------------------LKRELLMGIFEAGFE
DBP8_PICST      --------------------------------------------------FEDLGVSRWLSEALAAMKIH
IF4A_CHAGB      ------------------------------------------------DSFDDMNLKSELLRGIYAYGFE
IF4A_ASPTN      ------------------------------------------------DSFDSMELKAELLRGVYAYGFE
DBP8_PICGU      --------------------------------------------------FKDLGVSKWLLEALAAMKIR
DBP4_ASPNC      --------------------------------------------------FTDLPLSEPTASGLASSHYK
RH12_ARATH      ------------------------------------------------NEFEDYFLKRDLLKGIYEKGFE
FAL1_LODEL      --------------------------------------------------FESMRLKPELLKGIYAYGFE
DBP4_ASPCL      -----------------------------EELSSLIQRVEGLDLKESFESFSDLPLSEPTLSGLTSSHFK
DBP2_VANPO      --------------------------------------------------FDEAGFPDYVLEEVKAEGFE
DBP4_NEOFI      -----------------------------DELSSLIQRVEDLDLKETFKSFSDLPLSEPTASGLASSHYK
RH7_SPIOL       ----------------------------------------------------------------------
IF4A_USTMA      ------------------------------------------------DNFDNMELKEELLRGVYAYGFE
IF4A_EMENI      ------------------------------------------------DSFDSMELKPELLRGVYAYGFE
IF4A_ASPCL      ------------------------------------------------DSFDSMDLKPELLRGIYAYGFE
FAL1_DEBHA      --------------------------------------------------FESMNLKTDLLKGIYGYGFE
DRS1_ASPTN      --------------------------------------------DGAQRSFQEFNLSRPILRGLAAVNFT
DHH1_CRYNE      --------------------------------------------------FEDFGLRRELLMGIYTAGFE
DBP4_ASPOR      -------------------------------------------IKETYKSFSDLPLSEPTASGLASSHFK
IF4A_PHANO      --------------------------------------------DETTDSFDAMNLKAELLRGVYAYGFE
IF4A_ASHGO      --------------------------------------------------FDELKLKEVLLRGIYGYGFV
FAL1_VANPO      --------------------------------------------------FESMNLKDDLLRGIYGYGFE
FAL1_CRYNE      --------------------------------------------------FEALNLKEDLLRGIYAYNFE
DHH1_CRYNV      --------------------------------------------------FEDFGLRRELLMGIYTAGFE
DBP8_DEBHA      --------------------------------------------------FEELGVSKWLSEALNSMKIH
DBP4_ASPFU      --------------------------------------------------FSDLPLSEPTASGLASSHYK
RHLB_IDILO      ----------------------------------------------TETRFADLALHPKIQQAISSAGFE
FAL1_PICGU      --------------------------------------------------FESMNLKPELLKGIYNYGFE
RH53_ARATH      ---------------------------------------------------SELGISPEIVKALSSKGIE
PRP28_PICST     --------------------------------------------------------------------YL
IF4A_LEIMA      --------------------------------------------------FDDMPLHQNLLRGIYSYGFE
IF4A_LEIIN      --------------------------------------------------FDDMPLHQNLLRGIYSYGFE
IF4A_LEIBR      --------------------------------------------------FDDMPLHQNLLRGIYSYGFE
IF415_TOBAC     ------------------------------KMNELLSADGQDFFTSYDDSFDAMGLQENLLRGIYAYGFE
H669_METJA      -------------------------------------------MEVEYMNFNELNLSDNILNAIRNKGFE
FAL1_PICST      --------------------------------------------------FESMNLKPDLLKGIYGYGFE
DBP8_YARLI      --------------------------------------------------FTDLGLPEWLNESLSNMAIT
DBP8_CANAL      --------------------------------------------------FNDLGVAKWLSESLDAMKIY
DBP10_DEBHA     -----------------------------------------PQAKKAKNGFPSFGFSKFLLTNISKKGFK
RH41_ORYSJ      --------------------------------------------------FSSSGLPEKLVLNLEAAGYV
RH9_ARATH       -----------------------------------------------------------IVKALKGRGIE
IF4A_LODEL      --------------------------------------------------FDDLNLKPNIVRGIFGYGYE
IF4A_COCIM      ------------------------------------------------DSFDAMNLRAELLRGVYAYGFE
DBP4_EMENI      -------------------------------------------LKAKYESFSDLPISEPTLSGLTSSHFK
DBP10_PICST     --------------------------------------------------FQSFGLSKLVLTNIAKKGYR
CSHB_BACSU      -----------------------------------------------ETKFELYELKPFIIDAVHRLGFY
IF4A_CANAL      --------------------------------------------------FDDLNLKPNIVRGIFGYGYE
IF4A3_ARATH     ------------------------------------------------DSFDAMELQPDLLRGIYAYGFE
DBP4_MAGGR      -------------------------------------------LKSTPKAFAELPLSEPTAKGVRDSHFE
RH7_ORYSJ       ---------------------------------------------ADPNALANFRISESLREKLKSKGIK
DDX46_DICDI     --------------------------------------------------WAQAGLTEKVHLLLKKFQYE
DBP8_BOTFB      ----------------------------LDAKNVSNGATLAPT--DAQTTFAALNVKPWLVGSLGSMAIK
IF4A_MAIZE      ------------------------------KMQEILTEDFFTSYDDVCESFDSMGLQENLLRGIYAYGFE
DBP8_ASPOR      ------------------------------------------------NGFTTLNVSPWLVGSLTTMAVR
PRP5_PICGU      --------------------------------------------------WAQLGLPSSIMTVLEEKGYD
IF4A_PICST      --------------------------------------------------FDDLNLKPNIVRGIFGYGYE
IF4A_CANGA      --------------------------------------------------FDDMNLNEKLLRGVFGYGFN
DRS1_SCLS1      --------------------------------------------------FQSMSLSRPILRGLATVGFT
DBP8_NEOFI      ------------------------------------------------SSFAALNVAPWLVGSLTTMAVR
DBP3_NEUCR      ------------------------------------------------------------------AAYT
IF4A8_TOBAC     ------------------------------KMNDLLAADGKDFFTSYDDSFDAMGLQENLLRGIYAYGFE
DRS1_BOTFB      --------------------------------------------------FQSMSLSRPILRGLATVGFT
DHH1_ASHGO      ------------------------------------------------NTFEDFYLRRELLMGIFEAGFE
RH31_ORYSJ      ----------------------------------------------SQTRFDECSLSPLTLKGVKAAGYE
IF4A1_ORYSJ     --------------------------------------------------FDDMGLQENLLRGIYAYGFE
IF4A1_ARATH     --------------------------------------------------FDAMGLQENLLRGIYAYGFE
IF4A_AJECN      ------------------------------------------------DSFDAMNLRAELLRGVYAYGFE
IF4A9_TOBAC     ------------------------------KMTELLNADFFTSYDEVYHSFDAMGLKENLLRGIYAYGFE
IF410_TOBAC     ------------------------------------------------DSFDAMGLQENLLRGIYAYGFE
DDX49_DROME     ------------------------------------------------NPFQILGLRPWLVKQLTKLGLK
DBP10_ASPNC     -------------------------------------------------GFQAMGLNANLLKAITRKGFS
IF4A_DEBHA      --------------------------------------------------FDDLNLKPNIVRGIFGYGYE
IF4A7_TOBAC     ------------------------------------------------DSFDAMGLQENLLRGIYAYGFE
FAL1_CANGA      --------------------------------------------------FESMDLKEGLLRGIYSYGFE
DRS1_ASPNC      ------------------------------------------AMADAKRSFQEFNLSRPILRGLAGVNFS
DDX54_MOUSE     -------------------------------------------------GFQSMGLSYPVFKGIMKKGYK
DDX10_CHICK     -----------------------------------------PQINANEQRFSDFPLSKKTLKGLQEAQYR
RH9_ORYSJ       -----------------------------------------------------------IVSQLASRGIT
PRP28_YEAST     ---------------------------------------------------------------IQELRFP
IF4A_TRYCR      --------------------------------------------------FDDMPLHQNLLRGIYSHGFE
DBP8_ASPCL      ------------------------------------------------SSFSALNVAPWLVGSLTTLAVR
RRP3_LODEL      --------------------------------------------------FTEFDLVPELLESIQSLKYT
PRP5_PICST      --------------------------------------------------WSHLGLPASYMNIIEDKEYK
IF4A3_ORYSJ     --------------------------------------------------FDDMGLQENLLRGIYAYGFE
IF4A2_NICPL     ------------------------------------------------DSFDAMGLQENLLRGIYAYGFE
IF414_TOBAC     ------------------------------------------------DSFDAMGLQENLLRGIYAYGFE
GLH2_CAEEL      --------------------------------EVKITSDKKPVGVKTCKTFSEANLGETMKKNVAHAGYT
DRS1_COCIM      ---------------------------------------------SSNSTFQNFNLSRPILRGLAAVGFS
DBP4_YARLI      ----------------------------LSKLQERVDNFGEDEADKEVSKFEELPLSEATIEGLKNSHYV
PRP5_NEUCR      --------------------------------------------------WSQCGLTRPILDTIESLGFE
PRP5_COCIM      --------------------------------------------------WSQCGLGVQTLDVIRKLGYE
IF4A_PICGU      --------------------------------------------------FDDLNLKPNIVRGIFGYGYE
PRP5_ASPFU      --------------------------------------------------WSQCGLGVQTLDVIQKLGYE
DBP3_ASPOR      ------------------------------------------------------------------SSFK
PRP5_ASPTN      --------------------------------------------------WSQCGLGVQTLDVIDRLGYE
PRP5_ASPOR      --------------------------------------------------WSQCGLGVQTLDVIDRLGYS
GLH1_CAEEL      --------------------------------------------------FAEANLTETMQKNVAHAGYS
PRP5_ASHGO      --------------------------------------------------WSQLGLNSGIMNLLTELEFT
IF4A_TRYBB      --------------------------------------------------FDDMPLHQNLLRGIYSHGFE
IF4A2_ARATH     --------------------------------------------------FDAMGLQENLLRGIYAYGFE
SUB2_ASPCL      -------------------------------------------------GFRDFLLKGELLRAITDCGFE
PRP5_NEOFI      --------------------------------------------------WSQCGLGVQTLDVIHRLGYE
PRP5_ASPCL      --------------------------------------------------WSQCGLGVQALDVIERLGYE
IF4A_WHEAT      --------------------------------------------------FDDMGLQENLLRGIYAYGFE
DBP8_SCLS1      ------------------------------------NNGAVLAPTDAQTTFAALDVKPWLVASLGAMAIK
DBP4_SCLS1      ----------------------------VDELDA----------KAEIKNFSELPLSGPTSSGLEASHFK
DBP3_VANPO      --------------------------------------------------FSHISLDSRIQAEISK--FP
DDX54_DICDI     -------------------------------------------------GFQSMDLTKNLLKAILKKGFN
DBP4_GIBZE      --------------------------------------------------FSELPLSVPTAEGLEIAHFQ
PRP28_CANGA     -----------------------------------------------------------LVRALTEGGFD
DRS1_SCHPO      ----------------------------------------------THSSFQSMNLSRPILKGLSNLGFE
DBP8_LODEL      --------------------------------------------------FKELGVAKWLSESLEAMKIH
DBP3_EMENI      --------------------------------------------------------------------FA
SUB2_NEOFI      -------------------------------------------------GFRDFLLKGELLRAITDCGFE
RH48_ORYSJ      --------------------------------------------------FEECGISPLTVKALTDAGYV
IF4A_VANPO      --------------------------------------------------FDDMNLKDELLKGVYGYGFE
IF411_TOBAC     --------------------------------------------------FDAMGLQENLLRGIYAYGFE
DRS1_PHANO      --------------------------------------------------FHAMSLSRPIQKGLAAIGFT
DBP4_YEAST      --------------------------------------------------FKDLPISDPTLKGLRESSFI
DBP4_YEAS7      --------------------------------------------------FKDLPISDPTLKGLRESSFI
DBP4_NEUCR      ------------------------------------------------NKFSDLPLCEPTASGLRASHFE
DBP4_PHANO      ------------------------------------------------NDFSDLPLSDPTKQGLKACHFA
DBP4_KLULA      ---------------------------------------------AKANLFQDLPISEQTLKGLKEAAFI
DBP3_ASHGO      --------------------------------------------------FSHLNLHSAIQKEISK--FP
SUB2_AJECN      -------------------------------------------------GFRDFLLKGELLRAITDCGFE
PRP5_ASPNC      --------------------------------------------------WSQCGLGVQTLDVIDKLGYE
FAL1_ASHGO      --------------------------------------------------FESMKLQENLLRGIYGYGFE
DBP4_CHAGB      --------------------------------------------------FTDLPLCEATASGLRASHFE
SUB2_ASPNC      -------------------------------------------------GFRDFLLKEELLRAITDCGFE
SUB2_ASHGO      -------------------------------------------------GFKDFLLKPELSRAIIDCGFE
SUB22_VANPO     -------------------------------------------------GFKDFLLKPELARAIIDCGFE
RH45_ARATH      ------------------------------------------------------GLTSKILDTLKKLNYE
PRP5_PHANO      --------------------------------------------------WAQMGLLQQTMDVFTRVGYX
DDX21_RAT       -------------------------------------------VEQKEGAFSNFPISEETVKLLKARGVN
SUB2_KLULA      -------------------------------------------------GFKDFLLKPELSRAIIDCGFE
SUB2_COCIM      -------------------------------------------VGVHSTGFRDFLLKPELLRAITDCGFE
SUB2_ASPOR      -------------------------------------------------GFRDFLLKGELLRAITDCGFE
PRP5_CHAGB      --------------------------------------------------WSQCGLTRPILDVVEGLGYE
DBP3_CHAGB      ------------------------------------------------------------------ASFT
SUB21_VANPO     -------------------------------------------------GFKDFLLKPELARAIIDCGFE
ROK1_PICGU      -----------------------------------------------EDLIARCNLNRKLLANLIASGYS
RH26_ORYSJ      ------------------------------ELDAGMSAAEVGGVHLSETRFDQCPVSPLSLKAIKDAGYE
IF4A_KLULA      --------------------------------------------------FDDLKLKEELLRGIFGYGFV
DDX54_HUMAN     -------------------------------------------------GFQSMGLSYPVFKGIMKKGYK
DBP8_NEUCR      --------------------------------------------------FDALNVRPWLVQSLANMAIK
DBP8_COCIM      -----------------------------DQPDPVTAKDAAMGLQSMDSSFSSLGLAPWLVGSLSAMAIR
DBP3_NEOFI      ------------------------------------------------------------------SSFS
DBP10_ASHGO     -------------------------------------------------------LSKFILGNISRKGFR
SUB2_ASPFU      -------------------------------------------------GFRDFLLKGELLRAITDCGFE
DRS1_NEOFI      ------------------------------------------AASTSNRSFQDFNLSRPILRGLASVNFX
DBP4_USTMA      --------------------------------------------------FTQLPLSDRTCRGLKRAGYT
RH56_ORYSJ      ------------------------------------------------SGFRDFLLKPELLRAIQDCGFE
RH15_ORYSJ      ------------------------------------------------SGFRDFLLKPELLRAIQDCGFE
HAS1_PHANO      --------------------------------------------------FDELNLSERTMEAIKTMGFE
DBP8_GIBZE      --------------------------------------------------FSALDVRPWLVQSLENMAIK
DBP3_YEAST      ------------------------------------------------------------------SKFP
IF4A1_MACFA     ------------------------------------------------DSFDDMNLSESLLRGIYAYGFE
DRS1_ASPFU      ------------------------------------------AVSTFNRSFQDFNLSRPILRGLASVNFX
DDX21_MOUSE     -------------------------------------------VEQKEGAFSNFPISEETVKLLKARGVN
DBP4_PICST      -----------------------------------------PAVEKSISQFSDLPITQETLRGLNESSFM
DBP3_YEAS7      ------------------------------------------------------------------SKFP
RH36_ARATH      ----------------------------------------------SATNFEGLGLAEWAVETCKELGMR
PRP5_SCLS1      --------------------------------------------------WSQCGLDVKSLDVIKKLGYD
PRP5_BOTFB      --------------------------------------------------WSQCGLDVKSLDVITKLGYE
DBP8_PHANO      -----------------------------------------------ENGFASIDVAPWLVASLASMEIK
DBP4_CANGA      --------------------------------------------------FKDLPISKSTLKGLNEASFI
PRP28_YARLI     ---------------------------------------------------------------ISRMGYK
DDX21_HUMAN     -------------------------------------------VEQKEGAFSNFPISEETIKLLKGRGVT
SUB2_CANGA      -------------------------------------------------GFKDFLLKPELSRAIIDCGFE
PRP5_EMENI      --------------------------------------------------WSQCGLGIQTLDVIDKLGFA
PRP5_CANAL      --------------------------------------------------------------------FE
FAL1_KLULA      --------------------------------------------------FESMNLKPDLLRGIYFYGFE
DRS1_ASPCL      ----------------------------------------------SKRSFQDFNLSRPILRGLASVNFX
DBP5_USTMA      ----------------------------------------------SAKSFEALGLHENLLKGIYAMKYQ
RH18_ARATH      -------------------------------------------------------LSGDIIEALNQSDFE
IF4A2_RAT       ------------------------------------------------DNFDDMNLKESLLRGIYAYGFE
IF4A2_PONAB     ------------------------------------------------DNFDDMNLKESLLRGIYAYGFE
IF4A2_MOUSE     ------------------------------------------------DNFDDMNLKESLLRGIYAYGFE
IF4A2_HUMAN     ------------------------------------------------DNFDDMNLKESLLRGIYAYGFE
IF4A2_BOVIN     ------------------------------------------------DNFDDMNLKESLLRGIYAYGFE
IF4A1_RABIT     ------------------------------------------------DSFDDMNLSESLLRGIYAYGFE
IF4A1_MOUSE     ------------------------------------------------DSFDDMNLSESLLRGIYAYGFE
IF4A1_HUMAN     ------------------------------------------------DSFDDMNLSESLLRGIYAYGFE
IF4A1_BOVIN     ------------------------------------------------DSFDDMNLSESLLRGIYAYGFE
DDX10_MOUSE     --------------------------------------------------FSDFPLSKKTLKGLQEAQYR
SUB2_DEBHA      -------------------------------------------------GFRDFLLKPELLRAIGDCGFE
DBP8_USTMA      --------------------------------------------------FSSIGISPMLIRSLASLQIK
SUB2_YEAST      -------------------------------------------------GFKDFLLKPELSRAIIDCGFE
SUB2_YEAS7      -------------------------------------------------GFKDFLLKPELSRAIIDCGFE
IF4A2_MACFA     ------------------------------------------------DNFDDMNLKESLLRGIYAYGFE
IF4A1_PONAB     -----------------------------------------------------MNLSESLLRGIYAYGFE
DDX10_HUMAN     --------------------------------------------------FSDFPLSKKTLKGLQEAQYR
SUB2_YARLI      -------------------------------------------------GFRDFLLKPELLRAIVDCGFE
SUB2_PICST      -------------------------------------------------GFRDFLLKPELLRAIGDCGFE
SUB2_CHAGB      -------------------------------------------------GFRDFLLKPELLRAIADCGFE
RH35B_ORYSJ     -------------------------------------------VPPPSRSFGDLRLPEPILRALRGKGIE
HAS1_MAGGR      --------------------------------------------ESEAQAFSELNLSENTMKAIEEMGFT
DBP3_ASPTN      -------------------------------------------------------------------SFK
IF4A_ASPOR      ------------------------------------------------DSFDAMELKPELLRGVYAYGFE
IF4A1_PANTR     ------------------------------------------------DSFDDMNLSESLLRGIYAYGFE
DBP8_SCHPO      --------------------------------------------EHTRKSFSDLGISPWLIDTLKALAIY
DBP8_ASPNC      -----------------------------DKDEPVLIKDALEGLNDAQNSFASLNVAPWLIGSLTTMAVR
GLH3_CAEEL      --------------------------------------------------FSDSDIPQSMRRNVERAGYT
SUB2_PHANO      -------------------------------------------------GFRDFLLKDELVRAITDCGFE
ROK1_YARLI      --------------------------------------DSPLPIGSFEDLITRFNLHPYLLANLKKNKYT
RH29_ARATH      --------------------------------------------------FESLNLGPNVFNAIKKKGYK
IF4A2_CHICK     ------------------------------------------------DNFDDMNLKESLLRGIYAYGFE
HAS1_ASPCL      -----------------------------------MDAVRLPTVDGEPQKFTELGLSEKTLKAINEMGFE
DBP8_YEAST      --------------------------------------------------FKSLGLSKWLTESLRAMKIT
DBP8_YEAS7      --------------------------------------------------FKSLGLSKWLTESLRAMKIT
UAP56_CAEEL     ------------------------------------------------SGFRDFLLKPEILRAIGDCGFE
SUB2_PICGU      -------------------------------------------------GFRDFLLKPELLRAIGDCGFE
DDX27_DICDI     -------------------------------------------VEEELPTFEELHLSRPLLKAVQKLGFS
DBP5_YEAST      ----------------------------------------------SAKSFDELGLAPELLKGIYAMKFQ
DBP5_YEAS7      ----------------------------------------------SAKSFDELGLAPELLKGIYAMKFQ
DBP4_CANAL      --------------------------------------------EASVSQFSDLPITENTLKGLKEATFV
SPB4_YEAST      --------------------------------------------------------------------FE
SPB4_YEAS7      --------------------------------------------------------------------FE
DRS1_CHAGB      ------------------------------------------------SSFQGMSLSRPILRGLTSVGFT
DBP8_CANGA      -----------------------------------------------KQNFRQLGLSKWLVESLDAMRIR
DBP3_CANAL      --------------------------------------------------FDQVQLTSAITSKLSK--FD
DBP10_PHANO     -------------------------------------------------GFQAMGLNVALLKAIAQKGFK
RH56_ARATH      ------------------------------------------------SGFRDFLLKPELLRAIVDSGFE
RH44_ARATH      ----------------------------------------------------------------------
FAL1_PHANO      --------------------------------------------------FEAMHLKENLLRGIYAYGYE
DBP5_NEUCR      ------------------------------KLSDLQNDTESPLYSVSS--FDELGLPEAVNRGLLAINFK
RH15_ARATH      ------------------------------------------------SGFRDFLLKPELLRAIVDSGFE
DHH1_ENCCU      -------------------------------------------------GWESLGLGPVLLKRIRDIGYD
IF4A_YEAST      --------------------------------------------------FDDMELDENLLRGVFGYGFE
IF4A_YEAS7      --------------------------------------------------FDDMELDENLLRGVFGYGFE
DBP8_MAGGR      --------------------------------------------------FESLGVEPWLVQSLANLAVK
SUB2_ASPTN      -------------------------------------------------GFRDFLLKGELLRAITDCGFE
RH26_ARATH      ----------------------------------------------SKTRFDQFPLSPLSLKAIKDAGFE
PRP28_KLULA     -----------------------------------------------------------------DLHYN
DBP4_PICGU      --------------------------------------------EQSISQFKHLPISEGTYKGLLENNFV
DBP3_PICST      --------------------------------------------------------------------FP
RH49_ARATH      -------------------------------------------------------LSEDIIEALDRSGFE
RH45_ORYSJ      ------------------------------------------------------GLTSKLLDTIKKLGFE
RH31_ARATH      ------------------------------------------------------------LKAIKDAGYE
DDX20_DANRE     --------------------------------------------------FSSLLLSKPVLEGLSASGFQ
DBP5_CHAGB      -----------------------------------LQADDESLLYSGVASFEELGLAKSINDGLLAMNFK
DBP5_CANAL      ----------------------------------------------SVKSFEELGLSPELLKGLYAMKFN
HAS1_NEOFI      ------------------------------------SADALPTVEGEPQKFTELGLTEKTLKAINDMGFD
HAS1_GIBZE      -----------------------------------------PVAGAEAQSFEELKLSEKTMKAINEMKFT
YFML_BACSU      ------------------------------------------------------------------SGFQ
RH41_ARATH      --------------------------------------------------FTSCGLPPKLLLNLETAGYD
PRP5_YEAST      --------------------------------------------------WSQLGLSTDTMVLITEKHFG
PRP5_YEAS7      --------------------------------------------------WSQLGLSTDTMVLITEKHFG
HAS1_CANAL      ------------------------------------------------------------MKAIKEMGFT
HAS1_ASPFU      -----------------------------------------PTVEGEPQKFTELGLSEKTLKAINDMGFE
IF4A_DROME      ------------------------------------------------DNFDDMNLREELLRGIYGYGFE
DDX52_DICDI     -----------------------------------------------------------LLNNINEIGYK
DBP4_LODEL      --------------------------------------------EASIKHFSDLPITQNTLRGLKECSFV
SUB2_LODEL      -------------------------------------------------GFRDFLLKPELLRAIGDCGFE
HAS1_COCIM      ------------------------------------NALSLPQTENEPQKFTELNLSEKTLKAIQEMGFE
DDX52_BOVIN     -------------------------------------------------------INSRLLQNILDAGFQ
PRP5_VANPO      --------------------------------------------------WSQLGLPTDIMNLITELKYD
DBP5_PICST      ----------------------------------------------SVKSFEELGLTPELLKGLYAMKFN
SPB4_LODEL      ----------------------------------------------------RVDLEPWLKDAIRSLNYP
HAS1_LODEL      ------------------------------------NTSEAEADEPGVNSFEKADFSEPTMKAIKEMGFQ
DBP5_YARLI      ----------------------------------------------SAKRFEDLGLDENLLKGLYAMKFN
HAS1_ASPNC      -----------------------------------LDAVRLPQTDGEPKKFTELNLSEKTMKGIQDMGFE
DDX59_RAT       --------------------------------------------------FEHCGFPETLNQNLKKSGYE
DDX27_HUMAN     ------------------------------------------ASQYDENSFQDMNLSRPLLKAITAMGFK
DDX19_DROME     --------------------------------------------------FEALHLKASLLKGIYAMGFN
DDX50_MOUSE     --------------------------------------------EQKEGAFSNFSISEETIKLLKGRGVT
DDX25_MOUSE     --------------------------------------------------------------------FN
DBP8_EMENI      -------------------------------------------LNAEENSFKALNVAPWLVGSLTTMAVR
SUB2_SCHPO      -------------------------------------------------GFRDFLLKPELLRAITDSGFE
ROK1_PICST      -------------------------------------------------------LDSKLLSNLLEAEFV
ROK1_LODEL      -------------------------------------------------------IDKRVLSNLLDAEFV
ROK1_ASHGO      -------------------------------------ADAPLPIGSFEDLVTRFKLDKRLLSNLIENNFT
PRP5_DEBHA      --------------------------------------------------WSQLGLPSTIMSIIGRLNYS
HAS1_NEUCR      ----------------------------------------APSIATNATDFSELNLSDKTMKAIAEMGFT
DDX55_CHICK     ----------------------------------------------TEGGWSSLALSPGVLRALQDLGFD
DDX27_BOVIN     ------------------------------------------ASQYDENSFQDMNLSRPLLKAITAMGFK
DDX25_HUMAN     --------------------------------------------------------------------FN
RH51_ARATH      --------------------------------------------------FDSLDLSEQTSIAIKEMGFQ
RH27_ARATH      --------------------------------------------------FESLSLSDNTYKSIKEMGFA
RH25_ARATH      ----------------------------------------------SKTRFDQFPLSPLTLKGIEDAGFK
DDX25_RAT       --------------------------------------------------------------------FN
DBP4_ASHGO      --------------------------------------------------FQDLPISSGTVKGLKEAAYI
DDX39_RAT       -------------------------------------------VSIHSSGFRDFLLKPELLRAIVDCGFE
DDX39_MOUSE     -------------------------------------------VSIHSSGFRDFLLKPELLRAIVDCGFE
DDX25_BOVIN     --------------------------------------------------------------------FN
DBP8_CRYNE      ------------------------------------NGLASASKPSADVTFESLGLSHPLITALASINIK
DBP4_VANPO      ----------------------------IDEYDASINKPVF---------FKDLPISNSTLKGLNDSAFL
ROK1_DEBHA      -----------------------------------------------EDLIGRYKLDKKLLSNLIDAGFT
RH39_ORYSJ      ------------------------------------------------DSFEELGLGEEVMAALGEMGIS
HAS1_USTMA      --------------------------------------------------FSILDLSEPTRKAIDAMGFK
DDX52_HUMAN     -------------------------------------------------------INSRLLQNILDAGFQ
DDX50_HUMAN     --------------------------------------------EQKEGAFSNFPISEETIKLLKGRGVT
DBP5_MAGGR      -----------------------------------------------------------IIDGLLAMNFK
SUB2_CRYNE      -------------------------------------------------GFRDFLLKPELLRAISDLGFE
ROK1_CANGA      -----------------------------------------------EDLISRFSLDKRLLNNLIENHFT
HAS1_YARLI      ------------------------------------------ASDAERKPFSTIPLSENTMQSLKDMGFE
HAS1_CRYNE      --------------------------------DAVLGARSAPGTDYERVPFSTLNLSPPTTAAIERMGFE
ROK1_SCHPO      ---------------------------------------------------------------LKKQNIT
RH39_ARATH      --------------------------------------------------FQELGLSEEVMGALQELNIE
DDX31_HUMAN     --------------------------------------------------FHELGLHPHLISTINTVKMS
UAP56_RAT       -----------------------------DEVETAAGADGAPAVSIHSSGFRDFLLKPELLRAIVDCGFE
UAP56_MOUSE     -----------------------------DEVETAAGADGAPAVSIHSSGFRDFLLKPELLRAIVDCGFE
SPB4_PICST      -----------------------------------------------------------IKEAIASLGFP
RH27_ORYSJ      --------------------------------------------------FSELGVSEPTARAIREMNYT
HAS1_CANGA      ------------------------------------------------HSFKSLNLSQPTMRAIEKMGFS
DBP5_ASPNC      ----------------------------------------------SVKNFEDLGLDPRILQGLSAMNFR
Y623_MYCPN      -----------------------------------------------DSTFNELGVSPALIATLKDNNIN
Y425_MYCGE      -----------------------------------------------DSTFHELGISQTLIETLNALHIN
UAP56_PONAB     -------------------------------------------VSIHSSGFRDFLLKPELLRAIVDCGFE
UAP56_PIG       -------------------------------------------VSIHSSGFRDFLLKPELLRAIVDCGFE
UAP56_PANTR     -------------------------------------------VSIHSSGFRDFLLKPELLRAIVDCGFE
UAP56_MACMU     -------------------------------------------VSIHSSGFRDFLLKPELLRAIVDCGFE
UAP56_HUMAN     -------------------------------------------VSIHSSGFRDFLLKPELLRAIVDCGFE
UAP56_CANFA     -------------------------------------------VSIHSSGFRDFLLKPELLRAIVDCGFE
ROK1_CANAL      -------------------------------------------------------INKKVLSNLIDNEFI
DBP4_DEBHA      ----------------------------LAKLQERIDAYDPVVDEKSISQFSDLPISEETARGLKEASFA
DBP3_ASPCL      ----------------------------------------------------------------------
UAP56_CHICK     -------------------------------------------VSIHSSGFRDFLLKPELLRAIVDCGFE
UAP56_BOVIN     -------------------------------------------VSIHSSGFRDFLLKPELLRAIVDCGFE
DDX39_HUMAN     -------------------------------------------VSIHSSGFRDFLLKPELLRAIVDCGFE
DDX10_DICDI     ----------------------------------------------SATDFKDLPISQLTLKALTESKFL
SUB2_EMENI      -------------------------------------------------GFRDFLLKGELLRAITDCGFE
DBP5_SCLS1      ----------------------------------------------SVDTFEQLGIDASILKGLYAMNFK
SUB2_MAGGR      -------------------------------------------------GFRDFLLKPELLRAIGDCGFE
DD19A_MOUSE     ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
DD19A_HUMAN     ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
DBP5_PICGU      ----------------------------------------------SVKSFEELGLSPELLKGLYAMKFN
RH18_ORYSJ      ----------------------------------------------TEQRFSELSLSPEVVKALKGGGFR
PRP5_KLULA      --------------------------------------------------WSQLGLSSEIMDLISELQFV
DDX25_XENLA     ----------------------------------------------SVKSFEELHLKNELLRGIYAMGFN
DD19A_BOVIN     ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
DBP5_GIBZE      ----------------------------------------------------------------------
HAS1_DEBHA      ------------------------------------------------DNFEEAGLSEPTLKAIKDMGFS
DDX52_RAT       -----------------------------------------------------------LLQNILDAGFQ
DDX20_DICDI     -------------------------------------------IEIEDNTFSELLLQKEVLKGLEDGGYQ
DBP5_BOTFB      --------------------------------------------------FEQLGIDASILKGLYAMNFK
SUB2_SCLS1      -----------------------------DSGNLTVSGNAAAAKKGSSTGFREFLLKPELLRAISWCGFE
SPB4_CANGA      -----------------------------------------------------------IKKAINVSGFD
DDX18_DICDI     --------------------------------------------------FSNLPIEENTKKSIEEMGFK
DBP8_VANPO      --------------------------------------------------FKSLGLSRWLVESLNAMRIT
HAS1_ASPOR      --------------------------------------------------FTELGLSEKTMKGIEGMGFE
DDX52_MOUSE     -------------------------------------------------------INSRLLQNILDAGFQ
DD19B_HUMAN     ----------------------------------------------SVKSFEELRLKPQLLQGVYAMGFN
DBP5_EMENI      ----------------------------------------------SVKNFEDLGLDPRILQGLSAMNFR
HAS1_PICST      --------------------------------------------DAQNDKFEDAGLSEPTMRAISDMGFK
HAS1_CHAGB      -----------------------------------------PSVSTDAQAFSELNLSDKTMMSINEMGFT
SPB41_CANAL     -------------------------------------------------------LHSWIKEAISSMGYP
RH36_ORYSJ      -----------------------------------------------------LGLSQWLVDVCDSLGMR
DBP5_LODEL      --------------------------------------------------------------------FN
SPB42_CANAL     -----------------------------------------------------------IKEAISSMGYP
RH57_ARATH      ---------------------------------------------------SRYGCEGYILRNLAELGFK
RH47_ARATH      ----------------------------------------------SAKSFEELGLPDSLLDSLEREGFS
DDX55_DROME     -------------------------------------------------------LSDAVLQVVQSFGFQ
SPB4_PICGU      --------------------------------------------------WSQASLQPWIHDAIDSLGFR
HAS1_ASHGO      --------------------------------------------------FDELNLSSQTLKAIGKMGFT
DDX55_BOVIN     -------------------------------------------------------LHPKVLSVLRELGFP
SPB4_ENCCU      -------------------------------------------------GIEDVAMNGRLKKEIEENGFG
HAS1_EMENI      -----------------------------------VDAVSLPQPDGGPKKFTELGLSEKTLQGIKEMGFE
DDX55_HUMAN     -------------------------------------------------------LHPQVLGALRELGFP
DBP5_SCHPO      --------------------------------------------------------------------FQ
PRP5_CANGA      --------------------------------------------------WSQLGIPYDIIRFIKDVSYK
HAS1_ASPTN      --------------------------------------------DAAPQKFDELNLSEPTMKAIRQMGFE
DBP5_ASPTN      ----------------------------------------------SVKNFEDLGLDPRILQGLSAMNFR
MS116_ASHGO     -------------------------------------ADEAAGVESTPRTLVEEGLSNELYEMLQSRGFD
HAS1_YEAST      ----------------------------VDEKSTSKQNNAAPEGEQTTEKFEELKLSQPTLKAIEKMGFT
DDX55_DANRE     -----------------------------------------------------------ILQTLKELGFT
HAS1_KLULA      -----------------------------------------------EGSFSDLKLSDGTMKAIGKMGFT
DBP8_ASPFU      ------------------------------------------------SSFAALNVAPWLVGSLTTMAVR
DBP5_ASPFU      ----------------------------------------------SVKNFEDLGLDPRILKGLSSMNFR
RH51_ORYSJ      --------------------------------------------------FSDLPISDLTANAIRDMNYT
DBP5_COCIM      ----------------------------------------------SIKSFEELGLAEPIQMGLSKMNFR
DDX55_XENLA     -------------------------------------------------------LNGSIRRTLEELKFT
DBP9_ASPOR      --------------------------------------------------FESLNLDPRLRQALIKEKFT
DBP5_NEOFI      ----------------------------------------------SVKNFEDLGLDPRILKGLSNMNFR
RH13_ORYSJ      ------------------------------------NNDGLILGEDEVYAWRELRLHPLLITAVRRLGFK
RH13_ORYSI      ------------------------------------NNDGLILGEDEVYAWRELRLHPLLITAVRRLGFK
MS116_LODEL     -------------------------------------------------------IDDVILRALDRAHFK
HAS1_PICGU      --------------------------------------------------FEDLGLSEPTMRAIKDMGFE
UAP56_DROME     -------------------------------------------VSIHSSGFRDFLLKPEILRAIVDCGFE
ROK1_YEAS7      -----------------------------------------------EDLISRFSFDRRLLNNLIENGFT
MAK5_CANAL      -------------------------------------------------------ISAYTLYGLSQLDFK
ROK1_YEAST      -----------------------------------------------EDLISRFSFDKRLLNNLIENGFT
DBP5_DEBHA      --------------------------------------------------------------------FN
RH57_ORYSJ      ------------------------------KFDIHISGQNVPALENFEELVSRYGCDSYLVGNLSKLGFQ
DDX55_MOUSE     -------------------------------------------------------LHPRVLGALRELGFP
DDX20_MOUSE     -------------------------------------------VLAEPADFESLLLSRPVLEGLRAAGFE
DBP5_ASPCL      ----------------------------------------------SVKNFEDLGLDPRILKGLSAMNFR
RH32_ARATH      --------------------------------------------------FAQLPISDKTKRGLKDAKYV
MAK5_DEBHA      -----------------------------------------------------LSLSSFTLNGLSALEYE
DBP5_ASPOR      ----------------------------------------------SVKSFEDLGLDPRILQGLSAMNFR
RH47A_ORYSJ     ----------------------------------------------SAKSFEELGLPPLLIDRLNKEGLT
GLH4_CAEEL      ---------------------------------------------ASFDGFKILPQD--LHDNLKRMKMN
DDX20_HUMAN     --------------------------------------------------FESLLLSRPVLEGLRAAGFE
DDX56_BOVIN     -------------------------------------------------GFEHMGLDHRLLQAVTDLGWS
ROK1_KLULA      -----------------------------------------------EDLITRFQFDKRLLNNLIENNFT
RH17_ARATH      --------------------------------------------------FSSLGLDTKLSDQLKERGFE
DDX27_MOUSE     --------------------------------------------------FQDMNLSRPLLKAITAMGFK
SPB4_DEBHA      ----------------------------------------------------KCDLHPWIKEAIKSLGYP
MAK5_NEUCR      -----------------------------------------------------LDLSPRMISSIAKLRFS
MAK5_LODEL      -------------------------------------------------------LSPYILNGLSNMKFT
RH32_ORYSJ      --------------------------------------------------FDELPLSNKTKDGLRKAGYT
DBP7_COCIM      ----------------------------------------APLVDGIDT-FTSLGLSPSLAHLLTKLNLK
ROK1_VANPO      -----------------------------------------------EDLITRFSFDKRLLNNLILNHFT
DBP6_ASPNC      --------------------------------------------------FADLGIDSSLLRVLEDNGYR
MAK5_MAGGR      -----------------------------------------------------LGLSEEIMSSIAKLKFA
DBP5_CANGA      ----------------------------------------------SVKSFDELGLSPELLKGIYAMKFQ
RH47B_ORYSJ     ----------------------------------------------SAKSFEELGLPPLLIDRLNKEGLS
RH17_ORYSJ      --------------------------------------------------FTDLGLHPTLCAHLQDKGFQ
IF4A_ENCCU      ------------------------------------------------------GLKEDLLKGIYSIGFE
DDX28_MACFA     ----------------------------------------APAVQSSEGNFADLGLEPRVLHALQEVAPE
DDX18_DROME     --------------------------------------------DSDDRSFASLAVSEATLRAIKEMGFT
DBP5_ASHGO      ----------------------------------------------SVKSFEELGLAPELLKGLYAMKFQ
DBP4_ENCCU      --------------------------------------------------FEDLKIDQRIEKGLRENGFV
HAS1_SCHPO      -----------------------------------LNASSTSDIEK----FSDLQLSENIQKAIKEMGFE
DBP9_PHANO      --------------------------------------------------FAELQLEPRLLRGIRDQKWG
MAK5_PICGU      -------------------------------VDASLPKDTDLPKWSMEN----VSLSTYTINGLAGCGFK
DDX18_MOUSE     -----------------------------------------------DTSFASLSVNENTLKAIEEMGFK
DBP7_ASPCL      ----------------------------------------APLIDGLDT-FTNLGLSPSLAHLLTKLELK
SPB4_VANPO      -----------------------------------------------------------IRSAVDVMGFE
RH13_ARATH      ------------------------------------------------SAWSSMRLHPLLMKSIYRLDFK
DBP8_ASPTN      --------------------------------------------DAGESSFKALNVAPWLIGSLTTMAVR
IF4A6_TOBAC     ----------------------------------------------------------------------
DBP7_PICST      ----------------------------------------APVEDAST--FEGLGINERLSKHLTETRFK
DBP5_CRYNE      ----------------------------------------------SVQSFKELNLHEDLMKGIIAAGFQ
MAK5_SCLS1      -----------------------------------LDEDAAGEVEVS--GWVELDLSSNTLMALSKMGFS
SPB4_KLULA      -----------------------------------------------------------IRTAIESMGFE
RH38_ARATH      ----------------------------------------------SASRFEDLNLSPELMKGLVEMKFE
MAK5_SCHPO      ------------------------------------------------SAWAHFSLSPEMLGSLSKAGFS
DDX19_DICDI     --------------------------------------------------------------------YN
DBP8_ASHGO      ----------------------------------------------SNSTFKDLGVAKWLAEALNSMKIT
DBP7_YARLI      --------------------------------------------------FSGLGCSQRLVDALVGMQLA
DBP5_AJECN      ----------------------------------------------SIKSFEELGLHPSILQGLHSMSFR
DDX28_MOUSE     ----------------------------------------APALRSSRGSFVDLGLEPRVLLALQEAEVV
DBP7_ASPTN      ----------------------------------------APLIDGLDT-FTNLGLSPTLAHLLTKLELK
SPB4_ASPOR      -----------------------------------------------------------VLEAVSSMGFT
MAK5_PHANO      ------------------------------------------------SAWEELELSTKILESLAKLKFS
IF413_TOBAC     ------------------------------------------------DSFDAMGLQENLLRGIYAYGFE
DBP7_NEOFI      ----------------------------------------APLIDGLDT-FTNLGLSPSLAHLLTKLELK
SPB4_ASHGO      -----------------------------------------------------------IRTAVDAMGYE
MS116_YEAST     -------------------------------------------------------LDKEIHKAITRMEFP
DBP7_ASPFU      ----------------------------------------APLIDGLDT-FTNLGLSPNLAHLLTKLELK
DBP4_CRYNE      --------------------------------------------------FSELPMSSKTQKGLKSSHFL
MS116_PHANO     --------------------------------------DAAPAAEASAKPFSELSLDKSLLDGLDKMGFE
SPB4_EMENI      -----------------------------------------------------------VLDAVSSMGFT
DDX18_HUMAN     ------------------------------------------------------------LKAIKEMGFT
MAK5_VANPO      -------------------------------------------------------LSFTTLHGLTKLGFN
DBP5_KLULA      --------------------------------------------------------------------FQ
DBP9_COCIM      --------------------------------------------KALEKTFETLHLDPRLLQALTKQKFT
RH48_ARATH      ------------------------------------------------------------LKALSASGIL
DBP7_SCHPO      --------------------------------------------------FAGVQLDTQLADHLNKMNIS
RH16_ARATH      -----------------------------------------------------LGLDSRLIRALTKKGIE
MAK5_AJECN      ------------------------------------------------SGWDPLGISAEIQTSLSKLRFA
SPB4_ASPTN      -----------------------------------------------------------VLDAVASWGFS
DBP7_ASPNC      ----------------------------------------APLIDGLDT-FTNLGLSAPLAHLLTKLEVK
DBP8_KLULA      ----------------------------------------------SNSEFKSLGCSKWLVEALNAMKIV
RH33_ARATH      ------------------------------------------------------------LKALSASGIV
MS116_CANGA     --------------------------------------------------------------SISRMGFE
DBP7_GIBZE      --------------------------------------------------FGTLTISARLVDELGKMGLE
SPB4_SCLS1      -----------------------------------------------------------ILDAIKSMGFE
MS116_ASPOR     -------------------------------------------------------LDSKLLQALKVMEFE
MS116_KLULA     -------------------------------------------------------LDANVHKAISAMKFE
MS116_ASPFU     -------------------------------------------------------VDPKIIRAIVDMNIK
MAK5_PICST      -----------------------------------------------QNEDSNFSLSPYTLHGLSVLGFD
DDX28_HUMAN     ----------------------------------------APAVRSSKGSFADLGLEPRVLHALQEAAPE
SPB4_NEOFI      -----------------------------------------------------------VLEAMSSMGFT
MS116_SCHPO     -------------------------------------------------------LSSTFKNSLSRAGFE
MAK5_ASPOR      ---------------------------------------------ADVSAWESLGLSPEILAGISKMKFT
SPB4_YARLI      -----------------------------------------------------------LIDTMEQFGFT
SPB4_ASPFU      -----------------------------------------------------------VLEAMSSMGFT
MAK5_ASPNC      ------------------------------------------------SAWESLGLSPEILTSLSKMKFT
DDX1_CHICK      --------------------------------------------------FSEMGVMPEIAQAVEEMDWL
DBP6_VANPO      ----------------------------------------------------------------------
RH38_ORYSJ      -------------------------------------------VYESAAAFEDLKLTPELLKGLHEMGFS
MAK5_COCIM      -----------------------------------------------------LDLSAELQTSLGRLKFS
DBP9_EMENI      -----------------------------------LDANDVPSTEANEEDFETLNLDPRLRQALVKEKFS
DDX1_BOVIN      --------------------------------------------------FSEMGVMPEIAQAVEEMDWL
Y8611_DROME     ----------------------------------------------------------------------
DDX56_MOUSE     -------------------------------------------------GFEHMGLDPRLLQAVTDLGWS
DDX51_DANRE     ------------------------------------------------------GICPTLLRKLQTNGIQ
SPB4_PHANO      -----------------------------------------------------------IIDAVDAMGFV
SPB4_GIBZE      --------------------------------------------------------------AVATMGFD
MAK5_YEAST      -------------------------------------------------------LSMTILQSLQNLNFL
MAK5_YEAS7      -------------------------------------------------------LSMTILQSLQNLNFL
DDX1_RAT        --------------------------------------------------FSEMGVMPEIAQAVEEMDWL
DDX1_PONAB      --------------------------------------------------FSEMGVMPEIAQAVEEMDWL
DDX1_MACFA      --------------------------------------------------FSEMGVMPEIAQAVEEMDWL
DDX1_HUMAN      --------------------------------------------------FSEMGVMPEIAQAVEEMDWL
DBP9_AJECN      -----------------------------------LDANNVPSPEDSAHSFETLKLDPRLLQALTQQKFT
SPB4_ASPNC      -----------------------------------------------------------VLDAVASMGFT
SPB4_ASPCL      -----------------------------------------------------------VLEAMSSMGFA
DDX1_MOUSE      --------------------------------------------------FSEMGVMPEIAQAVEEMDWL
DBP10_CANAL     -----------------------------------------------------------ILANIAKKGYK
DDX55_CAEBR     -----------------------------------------------------------------DKSYK
DBP10_VANPO     -----------------------------------------------KGSFPSFGFSKLILSNVHKKGFR
RH55_ARATH      -------------------------------------------------------LSEDIIEALDRSGFE
MAK5_CRYNE      --------------------------------------------------WSSISLHPSLKRSFLASSFT
DDX55_CAEEL     -----------------------------------------------------------------DKSYK
DBP7_EMENI      ----------------------------------------APLIDGLDT-FTNLGLSPTLAHLLTKLELK
MAK5_GIBZE      --------------------------------------------------WVSLNLSPQIISAIAKLKFM
DBP10_LODEL     -----------------------------------------------------------LLANIAKKGYK
DBP9_ASPCL      -------------------------------------AEGKEAKDADNTDFENLNLDPRLRQALIKEQFT
DBP7_ASHGO      --------------------------------------DVAPSAPLLQDTFEALGVRGTLLEHLTKMKIQ
DDX56_HUMAN     -------------------------------------------------GFEHMGLDPRLLQAVTDLGWS
MAK5_ASPFU      ---------------------------------------------ADVSAWDSLGLSPEILTGLSKMKFG
RH50_ORYSJ      ----------------------------------------------SRRSFKEIGCSDEILGALRSFGFP
DBP9_NEOFI      -------------------------------------AEEKETKDADNTDFESLNLDPRLRQALIREQFT
DBP6_PICST      ---------------------------------------ATPIYASPEDSFSEFEISPFLLKNLERDNFT
DBP9_ASPFU      --------------------------------------------DADNTDFESLNLDPRLRQALIKEQFT
RH16_ORYSJ      --------------------------------------------------FDELGLDEQLKRALRKKGLD
MAK5_ASHGO      --------------------------------DIGLDEAEAPELPSWTN---TMKLSATVLQGLSRLGFS
DDX1_DROME      --------------------------------------------------FEEFGVLPELGMATDELDWT
DBP9_ASPTN      -----------------------------------LDANDVPSPEAADDSFESLNLDPRLRQALVKEKFT
DBP10_YEAST     -----------------------------DDVNEYFSTNNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFR
DBP10_YEAS7     -----------------------------DDVNEYFSTNNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFR
MAK5_ASPTN      ---------------------------------ALQDAEEDDGVDIS--AWESLGLSPEILNSLSKLKFS
DDX1_XENLA      --------------------------------------------------FSEMGVMPEIAQAVEEMDWL
SPB4_SCHPO      --------------------------------------------------FQSINIDKWLKNAVAAQGFK
DDX1_XENTR      --------------------------------------------------FSEMGVMAEIAQAVEEMDWL
DBP6_PICGU      --------------------------------------------------FSSFGLSSSMVKNLQSNGFS
DBP7_CHAGB      --------------------------------------------EEAEN-FHSLGVSRRVAQHLAKLEMK
SPB4_CHAGB      -----------------------------------------------------------ILDYLSSMGFE
SPB4_BOTFB      -----------------------------------------------------------VLDAISSMGFE
MAK5_EMENI      -----------------------------------------------------LGLSPETLTSLSKLKFS
DDX24_PONAB     --------------------------------DTVIESEALPSDTAAE-ARAKTGSDQALLFGDDDAGEG
SPB4_NEUCR      -----------------------------------------------------------ILDYLSSMGFT
DDX51_MOUSE     ----------------------------------------------------------------------
DBP6_SCHPO      ----------------------------------------------------------------------
DDX24_MOUSE     --------------------------------------------KADVSAWRDLFVPKAVLRALSFLGFS
DBP5_PHANO      -------------------------------------------------------------KGVRNMNFR
ROK1_CRYNE      -----------------------------------------------------------LLSALSRANIH
SPB4_AJECN      -----------------------------------------------------------ILDAISAMGFS
DDX51_HUMAN     ----------------------------------------------------------------------
DDX24_HUMAN     ----------------------------------------------------------------AEARAK
DBP7_NEUCR      ----------------------------------------APLSAEAEN-FLSLGLSRRVSQHLAKLEMK
DBP9_ASPNC      -------------------------------------AETKETSDADEADFESLNLDPRLRQALIKEKFT
DBP6_KLULA      -------------------------------------------------------LDARLLKNIT-SNFS
DBP9_VANPO      --------------------------------------------------FESLQLDTRLLQAIKRNGFK
MAK5_NEOFI      ---------------------------------------------ADVSAWDSLGLSPEILTGLSKMKFA
DBP9_NEUCR      --------------------------------------------------FSDLGLDPRLVQAVAKQSFE
DBP6_YARLI      ----------------------------------------ATYVEIDDVGFDEFDLSKNMMKNLDTLGYT
DBP9_GIBZE      --------------------------------------------QEEETSFVDLGLDPRLLQAIAQQKFA
DBP9_DEBHA      ------------------------------------------------------GLDARLLQAIDQLGFE
RH58_ARATH      -----------------------------------------------------------ILHRMEEIGFV
MAK5_KLULA      --------------------------------------DQEPPVEWSEN----MDLSFTVLKGLSGLGFT
DDX1_DICDI      ------------------------------------------------SAFEDLGVLPEIIKAIEELDWL
SPB4_COCIM      -----------------------------------------------------------ILDAVAAMGFT
RH58_ORYSJ      -----------------------------------------------------------VLQRAEEVGYV
DBP9_BOTFB      ----------------------------LDANDVPVPTEGSDAIKENVT-FASLGLDARLLQGIAKQNFQ
DBP6_CANAL      ----------------------------------------------------KMGFTEAFSVQISVLNMM
DBP10_USTMA     --------------------------------------------------FQSMGLHPSLLRSLLIRGFT
MS116_PICGU     --------------------------------------------------------DKSIFRGLYNSKMK
DBP9_YARLI      --------------------------------------------DLEDKSFDSFGLDDRLLSGLAACDMK
MAK5_ASPCL      ---------------------------------ALQDAEEDDGVDVS--AWDALNLSTELLTGISKMKFT
DBP9_SCLS1      ------------------------------KLD--VNDVPVPTEEAAANGFASLGLDARLLQGIAKQNFQ
DBP9_SCHPO      --------------------------------------------ESSEKTFSDFNLDPRLQRAIHKCEFE
MAK5_CANGA      -------------------------------------------------------LSMTTINGLSNLGFT
DBP9_PICGU      -------------------------------------------------------LDPRLLQAVYQLGFE
DDX56_DICDI     --------------------------------------------------FESMGLDNRILRALKKMGFQ
DBP7_CANGA      ----------------------------------------------TDDSFEGLGVGSLVVSHLEKMRIQ
DBP6_DEBHA      ----------------------------------------------------------------------
ROK1_ASPCL      ---------------------------------------------------SKYKISSRLAENIAEQGFT
RH50_ARATH      ----------------------------------------------SRKTFAEIGCSEDMMKALKEQNFD
DBP6_CANGA      ----------------------------------------------------------------------
DBP6_ASHGO      ----------------------------------------------------------------------
MS116_CANAL     ----------------------------------------------------------SIINSLHKNDFK
DBP6_LODEL      ----------------------------------------------------------------------
DBP7_VANPO      -----------------------------------INPSNAPL--AADN-FDSLKIEQQLVNHLNEKRIQ
DBP9_CANAL      -----------------------------------MSTSASSSYLDDETTWDSFNLDPRLLQAIDQLGFS
DDX5_DICDI      -----------------------------------------------------------------KTQFP
DBP9_PICST      ----------------------------------MSTTSASEAYVDDNSSWDSFHLDARLVQAIDQLGFE
DBP7_YEAS7      --------------------------------------------------FASLGVTSLLVSHLEQKRIK
DBP9_MAGGR      -----------------------------------------------------LGLDPRLLQAVAQQSFQ
ROK1_ASPOR      --------------------------------------------------FKELRTQYKISRRLAEQGFT
IF4A2_ORYSJ     ----------------------------------------------------------------------
DBP9_KLULA      -------------------------------------------------------------QAIRSIGFK
DBP7_PICGU      --------------------------------------------------FNGLGLNDNLVHHLTESRFK
DBP6_YEAST      ----------------------------------------------------------------------
DBP6_YEAS7      ----------------------------------------------------------------------
DBP9_USTMA      --------------------------------------------------------------------YG
ROK1_EMENI      ---------------------------------------------------SKYKISRRLAENIAEQGFT
YO12_CAEEL      ----------------------------------------------------------------------
DBP7_YEAST      ----------------------------------------------------------------------
DBP7_KLULA      --------------------------------------------------------DTMVSHLNVKMKIS
DBP7_ASPOR      ----------------------------------------APLIDGLDT-FTNLGLSPSLAHLLTKLELK
DDX55_DICDI     -------------------------------------------------------LSDSTLNTINRLGFK
DDX31_DICDI     ----------------------------------------------SSMNWGSLQLSETLVRNLVHMKHE
DBP7_CANAL      ----------------------------------------APMKDATN--FSGLGLNEKLSIHLTDLRFM
DBP7_BOTFB      --------------------------------------------------FTNLGLSRRLAAHLSKLDMK
DDX51_DROME     -------------------------------------------------------LEKYTCQALKQMKIK
ROK1_COCIM      ----------------------------------------------------------------------
RH1_ORYSJ       -------------------------------------------------------LDPRLVKPLQRMGIE
DBP7_MAGGR      --------------------------------------------------FAALGLSRRIAQHLAKLELK
DBP7_DEBHA      ----------------------------------------APLKDATT--FDGLGLNDKLATHLTESRFK
SPB4_CRYNE      -----------------------------------------PAAPAFGGSWAKLNLSPWILDVINSMGFK
RH1_ARATH       ----------------------------------------------------------------------
DBP7_PHANO      --------------------------------------------------FTSLGISTTLAHLLKKMDLK
MRH4_NEUCR      ----------------------------------------------------------------------
ROK1_NEOFI      ---------------------------------------------------------------IAEQGFS
DBP9_CRYNE      --------------------------------DALLDADFS----FSQPPFSTL-IDSRVLVALADQKFA
ROK1_ASPFU      ---------------------------------------------------------------IAEQGFT
DBP9_CANGA      --------------------------------------------------FESFKLDARLLQAIKGSGFT
DDX24_DICDI     -------------------------------------------------------LDPLILKGLRSLGFS
Y4443_DROME     --------------------------------------------------FERSGFNATILQQLEDQGYD
MRH4_MAGGR      --------------------------------------------------------DAVLNEALKGMLDI
ROK1_ASPNC      ----------------------------------------------------KYNISRRLAENIAEQGFT
MRH4_YARLI      ----------------------------------------------------------------------
DBP9_YEAST      --------------------------------------------------FEAFHLDSRLLQAIKNIGFQ
DBP9_YEAS7      --------------------------------------------------FEAFHLDSRLLQAIKNIGFQ
ROK1_ASPTN      ----------------------------------------------------KYKISRRLAENIAEQGFT
DBP9_LODEL      -----------------------------------------------ETTWDSLNLDPRLLQAIDKLGFE
MRH4_SCLS1      ---------------------------------------------------------AIFQQALPELKEH
DBP9_ASHGO      --------------------------------------------------FSSFQLDLRLQQSLKSSGFH
YR458_MIMIV     -----------------------------------------------------------LIRKTFAKGYE
ROK1_GIBZE      ------------------------------------------------------GLSDKVADNLVFQGYR
MRH4_PHANO      -------------------------------------------------------VQAAIKDALPALEYR
MRH4_ASPOR      ----------------------------------------------------------------------
DBP7_USTMA      ----------------------------------------APSVGSD---FASCGLDPLLVYHLASKMNS
DBP7_CRYNE      --------------------------------------------------FQGLGLNKLLINHLGKMGVE
MRH4_VANPO      ----------------------------LDKLSSFDQLKILPEVRNSIKNIIK---DETLSKKAKESEDV
MRH4_ASPTN      ----------------------------------------------------------------------
DDX1_DROVI      ----------------------------------------------------------------------
MRH4_KLULA      ----------------------------------------------------------------------
RH22_ARATH      -----------------------------------------------------LGLSDNVSIALRDSGFD
DBP7_SCLS1      --------------------------------------------------FTNLGLSRRLAAHLSKLDMK
MRH4_ASHGO      ----------------------------------------------------------------------
ROK1_CHAGB      ---------------------------------------------------------------IAAQGFR
MRH4_NEOFI      ----------------------------------------------------------------------
RECQ_ECOLI      -----------------------------------------------------LNLESGAKQVLQETGYQ
Y443_MYCPN      ----------------------------------------------------------------------
MRH4_ASPFU      ----------------------------------------------------------------------
MRH4_PICGU      ----------------------------------------------------------------------
MRH4_LODEL      ----------------------------------------------------------------------
RECQ_SALTY      -----------------------------------------------------LNLESGAKQVLQETGYQ
MRH4_CHAGB      ----------------------------------------------------------------------
MRH4_CANGA      ----------------------------------------------------------------------
MRH4_COCIM      --------------------------------------------------------------ALPGLEYV
MRH4_DEBHA      ----------------------------------------------------------------------
Y308_MYCGE      ----------------------------------------------------------------------
RH22_ORYSJ      -----------------------------------------------------LGVSDRLASALHGAGLA
MRH4_ASPCL      ----------------------------------------------------------------------
ROK1_NEUCR      ------------------------------------------------NSFGELGIHPVLADNITRQGFR
MRH4_AJECN      ----------------------------------------------------------------------
MRH4_ASPNC      -------------------------------------------------------------QALSRTGDI
RECQ_BACSU      ----------------------------------------------------------------------
BLM_DROME       ----------------------------------------------------------------------
MRH4_EMENI      ----------------------------------------------------------------------
MRH4_CANAL      ----------------------------------------------------------------------
MRH4_PICST      ----------------------------------------------------------------------
RECQ4_MOUSE     ---------------------------------------------------------AEVFQALERLGYR
ROK1_MAGGR      ----------------------------------------------------------------------
IF4AX_DICDI     -------------------------------------------------GFASLGLNEQLINNIKRYGIT
SPB4_USTMA      -----------------------------------------------------------VVSLLSDLGFG
BLM_MOUSE       ----------------------------------------------------------------------
RECQ_PASMU      ---------------------------------SLLSKDNKSAVDFHEIPLKQTALD--VLHAVF--GYQ
RECQ1_CAEEL     ----------------------------------------------------------------------
TLH2_SCHPO      ----------------------------------------------------------------------
TLH1_SCHPO      ----------------------------------------------------------------------
RECQ_HAEIN      ----------------------------------------------------------------------
WRN_CAEEL       ----------------------------------------------------------------------
RECS_BACSU      ----------------------------------------------------------------------
YR290_MIMIV     ----------------------------------------------------------------------
BLM_CAEEL       ----------------------------------------------------------------------
RECQ1_MOUSE     ----------------------------------------------------------------------
BLM_HUMAN       ----------------------------------------------------------------------
BLM_CHICK       ----------------------------------------------------------------------
RECQ1_RAT       ----------------------------------------------------------------------
HUS2_SCHPO      ----------------------------------------------------------------------
DDX51_DICDI     ------------------------------------------------------GIEEWLINNLKEQSII
HELX_METJA      --------------------------------------------------------------------YK
RECQ_SYNY3      ----------------------------------------------------------------------
LHR_ECOLI       --------------------------------------------------------------------FK
HELX_SULSO      --------------------------------------------------------------------YT
UVRB_TROW8      ----------------------------------------------------------------------
RECQ1_HUMAN     ----------------------------------------------------------------------
WRN_XENLA       ----------------------------------------------------------------------
RECQ1_PONAB     ----------------------------------------------------------------------
RECQ4_HUMAN     ----------------------------------------------------------------------
UVRB_PSESM      ----------------------------------------------------------------------
UVRB_DESDG      ----------------------------------------------------------------------
MRH4_YEAST      ----------------------------------------------------------------------
MRH4_YEAS7      ----------------------------------------------------------------------
UVRB_DESVV      ----------------------------------------------------------------------
UVRB_DESVM      ----------------------------------------------------------------------
UVRB_DESVH      ----------------------------------------------------------------------
UVRB_CHLTR      ----------------------------------------------------------------------
UVRB_CHLTA      ----------------------------------------------------------------------
UVRB_SYNP6      ----------------------------------------------------------------------
UVRB_SYNE7      ----------------------------------------------------------------------
UVRB_RALEJ      ----------------------------------------------------------------------
UVRB_PSEU2      ----------------------------------------------------------------------
UVRB_PSE14      ----------------------------------------------------------------------
UVRB_GLOVI      ----------------------------------------------------------------------
UVRB_AZOSE      ----------------------------------------------------------------------
UVRB_ANATD      ----------------------------------------------------------------------
UVRB_CALS8      ----------------------------------------------------------------------
UVRB_SYNY3      ----------------------------------------------------------------------
UVRB_RALSO      ----------------------------------------------------------------------
UVRB_NEIMB      ----------------------------------------------------------------------
UVRB_NEIMA      ----------------------------------------------------------------------
UVRB_NEIGO      ----------------------------------------------------------------------
UVRB_NEIG1      ----------------------------------------------------------------------
UVRB_LACBA      ----------------------------------------------------------------------
UVRB_LACAC      ----------------------------------------------------------------------
UVRB_FUSNN      ----------------------------------------------------------------------
UVRB_CHLAB      ----------------------------------------------------------------------
UVRB_BORPD      ----------------------------------------------------------------------
UVRB_SYNJB      ----------------------------------------------------------------------
UVRB_PSEPF      ----------------------------------------------------------------------
UVRB_CLOBM      ----------------------------------------------------------------------
UVRB_CHLCV      ----------------------------------------------------------------------
UVRB_BURPS      ----------------------------------------------------------------------
UVRB_BURMA      ----------------------------------------------------------------------
UVRB_BORAP      ----------------------------------------------------------------------
UVRB_AQUAE      ----------------------------------------------------------------------
UVRB_THEEB      ----------------------------------------------------------------------
UVRB_PSEF5      ----------------------------------------------------------------------
UVRB_PELCD      ----------------------------------------------------------------------
UVRB_NITEU      ----------------------------------------------------------------------
UVRB_METCA      ----------------------------------------------------------------------
UVRB_LEGPL      ----------------------------------------------------------------------
UVRB_LEGPH      ----------------------------------------------------------------------
UVRB_LEGPC      ----------------------------------------------------------------------
UVRB_LEGPA      ----------------------------------------------------------------------
UVRB_KLEP7      ----------------------------------------------------------------------
UVRB_KLEP3      ----------------------------------------------------------------------
UVRB_CITK8      ----------------------------------------------------------------------
SGS1_YEAST      ----------------------------------------------------------------------
UVRB_YERPY      ----------------------------------------------------------------------
UVRB_YERPS      ----------------------------------------------------------------------
UVRB_YERPP      ----------------------------------------------------------------------
UVRB_YERPN      ----------------------------------------------------------------------
UVRB_YERPG      ----------------------------------------------------------------------
UVRB_YERPE      ----------------------------------------------------------------------
UVRB_YERPB      ----------------------------------------------------------------------
UVRB_YERPA      ----------------------------------------------------------------------
UVRB_YERP3      ----------------------------------------------------------------------
UVRB_XYLFT      ----------------------------------------------------------------------
UVRB_XYLFM      ----------------------------------------------------------------------
UVRB_XYLFA      ----------------------------------------------------------------------
UVRB_XYLF2      ----------------------------------------------------------------------
UVRB_LEPBL      ----------------------------------------------------------------------
UVRB_LEPBJ      ----------------------------------------------------------------------
UVRB_EDWI9      ----------------------------------------------------------------------
UVRB_CLOBL      ----------------------------------------------------------------------
UVRB_CLOBK      ----------------------------------------------------------------------
UVRB_CLOBJ      ----------------------------------------------------------------------
UVRB_CLOB6      ----------------------------------------------------------------------
UVRB_CLOB1      ----------------------------------------------------------------------
UVRB_ACIAD      ----------------------------------------------------------------------
UVRB_VIBF1      ----------------------------------------------------------------------
UVRB_THICR      ----------------------------------------------------------------------
UVRB_SALTY      ----------------------------------------------------------------------
UVRB_SALTI      ----------------------------------------------------------------------
UVRB_SALSV      ----------------------------------------------------------------------
UVRB_SALPK      ----------------------------------------------------------------------
UVRB_SALPC      ----------------------------------------------------------------------
UVRB_SALPB      ----------------------------------------------------------------------
UVRB_SALPA      ----------------------------------------------------------------------
UVRB_SALNS      ----------------------------------------------------------------------
UVRB_SALG2      ----------------------------------------------------------------------
UVRB_SALEP      ----------------------------------------------------------------------
UVRB_SALDC      ----------------------------------------------------------------------
UVRB_SALCH      ----------------------------------------------------------------------
UVRB_SALA4      ----------------------------------------------------------------------
UVRB_PROMH      ----------------------------------------------------------------------
UVRB_PECCP      ----------------------------------------------------------------------
UVRB_NATPD      ----------------------------------------------------------------------
UVRB_LACCB      ----------------------------------------------------------------------
UVRB_LACC3      ----------------------------------------------------------------------
UVRB_ERWCT      ----------------------------------------------------------------------
UVRB_DECAR      ----------------------------------------------------------------------
UVRB_CHLTE      ----------------------------------------------------------------------
UVRB_ANASP      ----------------------------------------------------------------------
UVRB_YERE8      ----------------------------------------------------------------------
UVRB_XANCP      ----------------------------------------------------------------------
UVRB_XANCB      ----------------------------------------------------------------------
UVRB_XANC8      ----------------------------------------------------------------------
UVRB_THEYD      ----------------------------------------------------------------------
UVRB_SHISS      ----------------------------------------------------------------------
UVRB_SHIFL      ----------------------------------------------------------------------
UVRB_SHIF8      ----------------------------------------------------------------------
UVRB_SHIDS      ----------------------------------------------------------------------
UVRB_SHIBS      ----------------------------------------------------------------------
UVRB_SHIB3      ----------------------------------------------------------------------
UVRB_HELHP      ----------------------------------------------------------------------
UVRB_HALSA      ----------------------------------------------------------------------
UVRB_ESCF3      ----------------------------------------------------------------------
UVRB_ECOUT      ----------------------------------------------------------------------
UVRB_ECOSM      ----------------------------------------------------------------------
UVRB_ECOSE      ----------------------------------------------------------------------
UVRB_ECOLU      ----------------------------------------------------------------------
UVRB_ECOLI      ----------------------------------------------------------------------
UVRB_ECOLC      ----------------------------------------------------------------------
UVRB_ECOL6      ----------------------------------------------------------------------
UVRB_ECOL5      ----------------------------------------------------------------------
UVRB_ECOK1      ----------------------------------------------------------------------
UVRB_ECOHS      ----------------------------------------------------------------------
UVRB_ECODH      ----------------------------------------------------------------------
UVRB_ECOBW      ----------------------------------------------------------------------
UVRB_ECO8A      ----------------------------------------------------------------------
UVRB_ECO81      ----------------------------------------------------------------------
UVRB_ECO7I      ----------------------------------------------------------------------
UVRB_ECO5E      ----------------------------------------------------------------------
UVRB_ECO57      ----------------------------------------------------------------------
UVRB_ECO55      ----------------------------------------------------------------------
UVRB_ECO45      ----------------------------------------------------------------------
UVRB_ECO27      ----------------------------------------------------------------------
UVRB_ECO24      ----------------------------------------------------------------------
UVRB_CLOPS      ----------------------------------------------------------------------
UVRB_CLOPE      ----------------------------------------------------------------------
UVRB_CLOP1      ----------------------------------------------------------------------
UVRB_BORPE      ----------------------------------------------------------------------
UVRB_BORBR      ----------------------------------------------------------------------
UVRB_THEAB      ----------------------------------------------------------------------
UVRB_SERP5      ----------------------------------------------------------------------
UVRB_SALHS      ----------------------------------------------------------------------
UVRB_PSYIN      ----------------------------------------------------------------------
UVRB_PSEAE      ----------------------------------------------------------------------
UVRB_LACPL      ----------------------------------------------------------------------
UVRB_FRATT      ----------------------------------------------------------------------
UVRB_CLOAB      ----------------------------------------------------------------------
UVRB_BORPA      ----------------------------------------------------------------------
MPH1_YEAS7      ----------------------------------------------------------------------
DCL1_PHANO      ----------------------------------------------------------------------
UVRB_XANOM      ----------------------------------------------------------------------
UVRB_XANAC      ----------------------------------------------------------------------
UVRB_WOLSU      ----------------------------------------------------------------------
UVRB_THIDA      ----------------------------------------------------------------------
UVRB_STRA5      ----------------------------------------------------------------------
UVRB_STRA3      ----------------------------------------------------------------------
UVRB_STRA1      ----------------------------------------------------------------------
UVRB_PHOPR      ----------------------------------------------------------------------
UVRB_MANSM      ----------------------------------------------------------------------
UVRB_GEOSL      ----------------------------------------------------------------------
UVRB_BACTN      ----------------------------------------------------------------------
UVRB_BACHK      ----------------------------------------------------------------------
UVRB_BACHD      ----------------------------------------------------------------------
UVRB_BACCZ      ----------------------------------------------------------------------
UVRB_BACC1      ----------------------------------------------------------------------
UVRB_BACAN      ----------------------------------------------------------------------
UVRB_ALISL      ----------------------------------------------------------------------
MPH1_YEAST      ----------------------------------------------------------------------
UVRB_VIBPA      ----------------------------------------------------------------------
UVRB_SALAR      ----------------------------------------------------------------------
UVRB_PHOLL      ----------------------------------------------------------------------
UVRB_HAMD5      ----------------------------------------------------------------------
UVRB_HAEI8      ------------------------------------------