[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF09446.1

[Show Plain Result]


## Summary of Sequence Search
    1::166
    1::159     7e-43  51%  162 aa  DYR_NEIGO RecName: Full=Dihydrofolate reductase;       
    2::160     7e-42  50%  162 aa  DYR3_SALTY RecName: Full=Dihydrofolate reductase type 3;       
    1::164     4e-40  47%  168 aa  DYR_BACSU RecName: Full=Dihydrofolate reductase;       
    1::161     2e-36  46%  162 aa  DYR_NEIMA RecName: Full=Dihydrofolate reductase;       
    1::161     4e-36  46%  162 aa  DYR_NEIMB RecName: Full=Dihydrofolate reductase;       
    7::164     3e-35  44%  166 aa  DYR_STAHA RecName: Full=Dihydrofolate reductase;       
    1::158     9e-35  44%  159 aa  DYR_ENTAE RecName: Full=Dihydrofolate reductase;       
    1::158     1e-34  44%  159 aa  DYR_KLEAE RecName: Full=Dihydrofolate reductase;       
    1::158     7e-34  50%  159 aa  DYR_MYCTU RecName: Full=Dihydrofolate reductase;       
    1::158     7e-34  50%  159 aa  DYR_MYCBO RecName: Full=Dihydrofolate reductase;       
    1::158     2e-33  42%  159 aa  DYR_CITFR RecName: Full=Dihydrofolate reductase;       
    1::158     3e-33  42%  159 aa  DYR_SHIFL RecName: Full=Dihydrofolate reductase;       
    1::158     3e-33  42%  159 aa  DYR_ECOLI RecName: Full=Dihydrofolate reductase;       
    1::158     3e-33  42%  159 aa  DYR_ECOL6 RecName: Full=Dihydrofolate reductase;       
    1::164     8e-33  47%  165 aa  DYR_MYCLE RecName: Full=Dihydrofolate reductase;       
    4::159     9e-32  43%  160 aa  DYR_HAEIN RecName: Full=Dihydrofolate reductase;       
    3::153     3e-31  42%  161 aa  DYR_STAES RecName: Full=Dihydrofolate reductase;       
    3::153     3e-31  42%  161 aa  DYR_STAEQ RecName: Full=Dihydrofolate reductase;       
    3::153     3e-31  42%  161 aa  DYR_STAEP RecName: Full=Dihydrofolate reductase;       
    3::153     5e-31  42%  161 aa  DYRA_STAAU RecName: Full=Dihydrofolate reductase type 1 from
    3::135     5e-30  43%  164 aa  DYR_BUCBP RecName: Full=Dihydrofolate reductase;       
    3::153     1e-29  41%  159 aa  DYR_STAAU RecName: Full=Dihydrofolate reductase;       
    3::153     1e-29  41%  159 aa  DYR_STAAR RecName: Full=Dihydrofolate reductase;       
    3::153     1e-29  41%  159 aa  DYR_STAAN RecName: Full=Dihydrofolate reductase;       
    3::153     1e-29  41%  159 aa  DYR_STAAM RecName: Full=Dihydrofolate reductase;       
    3::153     1e-29  41%  159 aa  DYR_STAAC RecName: Full=Dihydrofolate reductase;       
    3::153     2e-28  41%  159 aa  DYR_STAAW RecName: Full=Dihydrofolate reductase;       
    3::153     2e-28  41%  159 aa  DYR_STAAS RecName: Full=Dihydrofolate reductase;       
   26::200     7e-27  45%  528 aa  DRTS_DAUCA RecName: Full=Bifunctional dihydrofolate
    3::161     6e-26  40%  161 aa  DYR_BUCAI RecName: Full=Dihydrofolate reductase;       
    7::204     1e-24  47%  206 aa  DYR_PNECA RecName: Full=Dihydrofolate reductase;       
   24::204     1e-24  41%  519 aa  DRTS1_ARATH RecName: Full=Bifunctional dihydrofolate
    5::158     1e-24  41%  168 aa  DYR_STRPN RecName: Full=Dihydrofolate reductase;       
   20::167     1e-23  46%  521 aa  DRTS_MAIZE RecName: Full=Bifunctional dihydrofolate
   23::164     2e-23  43%  167 aa  DYR2_HALMA RecName: Full=Dihydrofolate reductase 2;       
    3::161     3e-23  39%  161 aa  DYR_BUCAP RecName: Full=Dihydrofolate reductase;       
   29::206     2e-22  43%  530 aa  DRTS_SOYBN RecName: Full=Bifunctional dihydrofolate
   68::242     3e-22  40%  565 aa  DRTS2_ARATH RecName: Full=Bifunctional dihydrofolate
    3::167     4e-22  38%  494 aa  DRTS_ORYSJ RecName: Full=Putative bifunctional dihydrofolate
   10::137     9e-22  35%  165 aa  DYR13_ECOLX RecName: Full=Dihydrofolate reductase type A13;        
    7::137     1e-20  38%  167 aa  DYR_ENTFC RecName: Full=Dihydrofolate reductase;       
    3::132     3e-19  35%  162 aa  DYR_HALVO RecName: Full=Dihydrofolate reductase;       
    5::185     1e-18  43%  187 aa  DYR_SHV21 RecName: Full=Viral dihydrofolate reductase;       
    3::151     1e-18  37%  157 aa  DYR5_ECOLX RecName: Full=Dihydrofolate reductase type 5;       
    1::133     2e-18  39%  177 aa  DYR9_ECOLX RecName: Full=Dihydrofolate reductase type 9;       
    8::160     3e-18  36%  462 aa  DRTS_PARTE RecName: Full=Bifunctional dihydrofolate
    5::185     3e-18  42%  187 aa  DYR_BOVIN RecName: Full=Dihydrofolate reductase;       
    1::183     1e-17  39%  186 aa  DYR_AEDAL RecName: Full=Dihydrofolate reductase;       
    5::185     1e-17  42%  187 aa  DYR_HUMAN RecName: Full=Dihydrofolate reductase;       
    4::184     2e-17  40%  186 aa  DYR_PIG RecName: Full=Dihydrofolate reductase;         EC=1.5.1.3;
    5::185     2e-17  42%  187 aa  DYR_MOUSE RecName: Full=Dihydrofolate reductase;       
    5::185     3e-17  41%  187 aa  DYR_RAT RecName: Full=Dihydrofolate reductase;         EC=1.5.1.3;
    5::185     5e-17  41%  187 aa  DYR_MESAU RecName: Full=Dihydrofolate reductase;       
    6::154     5e-17  42%  185 aa  DYR_HELVI RecName: Full=Dihydrofolate reductase;       
    1::164     8e-17  40%  169 aa  DYR8_SHISO RecName: Full=Dihydrofolate reductase type 8;       
    1::164     8e-17  40%  169 aa  DYR8_ECOLX RecName: Full=Dihydrofolate reductase type 8;       
    7::126     1e-16  34%  163 aa  DYR_LACCA RecName: Full=Dihydrofolate reductase;       
    6::148     2e-16  40%  192 aa  DYR_CANAL RecName: Full=Dihydrofolate reductase;       
    1::127     3e-16  30%  592 aa  SCPA_MYCGA RecName: Full=Segregation and condensation protein A;
    5::164     3e-16  32%  168 aa  DYR_LACLA RecName: Full=Dihydrofolate reductase;       
    1::151     3e-16  42%  189 aa  DYR_CAEEL RecName: Full=Putative dihydrofolate reductase;       
    1::131     4e-16  34%  160 aa  DYR_MYCGE RecName: Full=Dihydrofolate reductase;       
    7::176     5e-16  37%  185 aa  DYR1_HALMA RecName: Full=Dihydrofolate reductase 1;       
    3::131     7e-16  36%  157 aa  DYR1_ECOLX RecName: Full=Dihydrofolate reductase type 1;       
    1::180     9e-16  36%  182 aa  DYR_DROME RecName: Full=Dihydrofolate reductase;       
   17::155     1e-15  29%  179 aa  DYR_MYCPU RecName: Full=Dihydrofolate reductase;       
    3::131     1e-15  37%  157 aa  DYR6_PROMI RecName: Full=Dihydrofolate reductase type 6;       
    3::131     2e-15  35%  157 aa  DYR15_ECOLX RecName: Full=Dihydrofolate reductase type 15;       
    1::115     6e-15  41%  156 aa  DYR_UREPA RecName: Full=Dihydrofolate reductase;       
   30::170     6e-15  47%  527 aa  DRTS_TRYBB RecName: Full=Bifunctional dihydrofolate
    4::184     8e-15  38%  186 aa  DYR_SHV24 RecName: Full=Viral dihydrofolate reductase;       
    1::131     1e-14  31%  160 aa  DYR_MYCPN RecName: Full=Dihydrofolate reductase;       
    3::131     1e-14  36%  157 aa  DYR7_ECOLX RecName: Full=Dihydrofolate reductase type 7;       
   24::164     1e-14  48%  521 aa  DRTS_TRYCR RecName: Full=Bifunctional dihydrofolate
    4::184     5e-14  37%  213 aa  DYR_SHV2C RecName: Full=Viral dihydrofolate reductase;       
    4::153     7e-14  41%  187 aa  DYRL1_HUMAN RecName: Full=Dihydrofolate reductase-like protein 1;
  234::411     9e-14  40%  461 aa  DYR_SCHPO RecName: Full=Dihydrofolate reductase;       
    1::154     1e-13  38%  205 aa  DYR_ENCCU RecName: Full=Dihydrofolate reductase;       
    1::121     4e-13  31%  506 aa  SCPA_MYCPN RecName: Full=Segregation and condensation protein A;
    4::184     7e-13  36%  189 aa  DYR_CHICK RecName: Full=Dihydrofolate reductase;       
   21::144     1e-12  38%  211 aa  DYR_YEAST RecName: Full=Dihydrofolate reductase;       
   11::129     4e-12  46%  229 aa  DYR_CRYNE RecName: Full=Dihydrofolate reductase;       
    7::186     1e-11  44%  610 aa  DRTS_TOXGO RecName: Full=Bifunctional dihydrofolate
   28::234     1e-11  36%  520 aa  DRTS_LEIMA RecName: Full=Bifunctional dihydrofolate
   28::234     9e-11  34%  520 aa  DRTS_LEIAM RecName: Full=Bifunctional dihydrofolate
   28::166     9e-11  43%  515 aa  DRTS_CRIFA RecName: Full=Bifunctional dihydrofolate
  111::232     6e-09  32%  623 aa  DRTS_PLAVI RecName: Full=Bifunctional dihydrofolate
   23::122     2e-08  43%  169 aa  DYR_THEMA RecName: Full=Dihydrofolate reductase;       
   23::176     4e-08  37%  193 aa  DYR_BPT4 RecName: Full=Dihydrofolate reductase;         EC=1.5.1.3;
  102::228     9e-08  28%  608 aa  DRTS_PLAFK RecName: Full=Bifunctional dihydrofolate
  100::229     8e-07  32%  583 aa  DRTS_PLACH RecName: Full=Bifunctional dihydrofolate
   17::137     4e-06  29%  187 aa  DYR10_ECOLX RecName: Full=Dihydrofolate reductase type A10;        
  104::237     3e-05  26%  587 aa  DRTS_PLABA RecName: Full=Bifunctional dihydrofolate
   89::172     4e-05  35%  182 aa  DRTS_PLAVN RecName: Full=Bifunctional dihydrofolate
    1::166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTLLTLIVARARNGVIGRNNTLPWRLPEDLQHFKRTTMGAPIIMGRKTWDSIGRPLPGRRNIVVTRNRDL
DYR_NEIGO       MLKITIIAACAENLCIGAGNAMPWHIPEDFAFFKVYTLGKPVIMGRKTWESLPKPLPGRRNIVISRQADY
DYR3_SALTY      --LISLIAALAHNNLIGKDNLIPWHLPADLRHFKAVTLGKPVVMGRRTFESIGRPLPGRRNVVVSRNPQW
DYR_BACSU       --MISFIFAMDANRLIGKDNDLPWHLPNDLAYFKKITSGHSIIMGRKTFESIGRPLPNRKNIVVTSAPDS
DYR_NEIMA       MLKITLIAACAENLCIGAGNAMPWHIPEDFAFFKAYTLGKPVIMGRKTWESLPKPLPGRRNIVISRQADY
DYR_NEIMB       MLKITLIAACAENLCIGAGNAMPWHIPEDFAFFKAYTLGKPVIMGRKTWESLPKPLPGRRNIVISRQADY
DYR_STAHA       ---ISLIVAMDKKRVIGKDNDIPWRISSDWEYVKNTTKGHAIILGRKNLQSIGRALPDRRNIILTRDKNF
DYR_ENTAE       --MISLIAALAVDRVIGMENAMPWDLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNIVIS-SKPG
DYR_KLEAE       --MISLIAALRVDRVIGMENAMPWNLNEDLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNIVIS-SKPG
DYR_MYCTU       --MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPRPLPGRRNVVLSRQADF
DYR_MYCBO       --MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPRPLPGRRNVVLSRQADF
DYR_CITFR       --MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNIVISSKPGT
DYR_SHIFL       --MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
DYR_ECOLI       --MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
DYR_ECOL6       --MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
DYR_MYCLE       MTVVGLIWAQSTTGVIGRDGGMPWRVPEDLTRFKQLTMGHPVVMGRRTWDSLPRPLPGRRNIVLSRQIDF
DYR_HAEIN       ----SLIVATTLNNVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGRKTFESIGRPLPKRTNIVLSRQLFE
DYR_STAES       ---LSIIVAHDKQRVIGYQNQLPWHLPNDLKHVKQLTTGNTLVMGRKTFNSIGKPLPNRRNVVLTNQASF
DYR_STAEQ       ---LSIIVAHDKQRVIGYQNQLPWHLPNDLKHVKQLTTGNTLVMGRKTFNSIGKPLPNRRNVVLTNQASF
DYR_STAEP       ---LSIIVAHDKQRVIGYQNQLPWHLPNDLKHVKQLTTGNTLVMGRKTFNSIGKPLPNRRNVVLTNQASF
DYRA_STAAU      ---LSIIVAHDKQRVIGYQNQLPWHLPNDLKHIKQLTTGNTLVMARKTFNSIGKPLPNRRNVVLTNQASF
DYR_BUCBP       ---ISIIVAMSQNLVIGQKNSIPWNIPKDLSWFKKHTIKKSIIMGRKTWESIGRVLPMRQNIVLTRQKNI
DYR_STAAU       ---LSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSF
DYR_STAAR       ---LSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSF
DYR_STAAN       ---LSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSF
DYR_STAAM       ---LSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSF
DYR_STAAC       ---LSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSF
DYR_STAAW       ---LSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSF
DYR_STAAS       ---LSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSF
DRTS_DAUCA      -----VVVAATQNMGIGKDGKLPWRLPSDMKFFKDVTMTTAVIMGRKTWESIHRPLPGRLNVVLTRSGSF
DYR_BUCAI       ---ISLIAAISKNLVIGYKNKIPWYLPEDLKWFKQKTINKNIIMGRLTWESIKKPLPMRKNIVISSN-EI
DYR_PNECA       ---LTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPVLMGRKTWESIPRPLKGRINVVITRNESL
DRTS1_ARATH     -----VVVAATKEMGIGKDGKLPWNLPTDLKFFKDITLTTAVVMGRKTWESIPRPLSGRLNVVLTRSGGF
DYR_STRPN       ---IVAIWAQDEEGVIGKENRLPWHLPAELQHFKETTLNHAILMGRVTFDGMGRRLPKRETLILTRNPEE
DRTS_MAIZE      -----VVVAGTRDMGIGKDGVLPWKLPGDLKFFKELTLTTAVIMGRKTWESISRPLPGRLNVILTRSGSF
DYR2_HALMA      ---------------------IPWQYPEDLTHFKETTVGHPVIMGRRTFESIRRPLPERLNIVLTTTPHQ
DYR_BUCAP       ---ISLISAISNNLVIGHNNKIPWYLPEDLKWFKKNTIHKDIIMGRLTWESINHPLPMRKNIVISHKEII
DRTS_SOYBN      -----VVVAATQDWGIGKDGKLPWRLPTDLKFFKEITMKTAIVMGRKTWESIPRPLSGRLNVVLTRSGSF
DRTS2_ARATH     -----VVVAATKEMGIGKDGKLPWNLPTDLKFFKDLTLSTAVVMGRKTWESIPRPLSGRLNVVLSRSSGF
DRTS_ORYSJ      ---------------IGKDGTLPWKLPGDLKFFKDITVTTAVVMGRKTWESIPRPLPGRLNVILTRSGSF
DYR13_ECOLX     -----LVAAMGANRVIGNGPDIPWKIPGEQKIFRRLTESKVVVMGRKTFESIGKPLPNRHTVVLSRQAGY
DYR_ENTFC       --------AQDKNGLIGKDGLLPWRLPNDMRFFREHTMDKILVMGRKTYEGMGKSLPYRHIIVLTTQKDF
DYR_HALVO       ---LVSVAALAENRVIGRDGELPWSIPADKKQYRSRIADDPVVLGRTTFESMRDDLPGSAQIVMSRSRSF
DYR_SHV21       ---LNCIVAVAQNMGIGKQGNLPWRLMNDFKHFQRTTSSVPVIMGKKTWFSINRPLKGRINVVLSKEKEL
DYR5_ECOLX      ---VSLMAAKAKNGVIGCGPHIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGA-LPNRKYAVVTRSATA
DYR9_ECOLX      MASLNMIVAVNKTGGIGFENQIPWHEPEDLKHFKAVTMNSVLIMGRKTFASLPKVLPGRLHVVVTQNTDQ
DRTS_PARTE      ----SMVLAMTLNGGIGYQNRLPWKLKEDLQRFKKITTGGIVIMGRKTFESMSKPLPNRVNVVISKNMKS
DYR_BOVIN       ---LNCIVAVSQNMGIGKNGDLPWPLRNEFQYFQRMTTVSSVIMGRKTWFSINRPLKDRINIVLSRELKE
DYR_AEDAL       MKKFSLIVAVCANGGIGIKGDLPWRLRQELKYFSRMTKKIAIIMGRKTYFGVKRPLPERLNIILTRDPSA
DYR_HUMAN       ---LNCIVAVSQNMGIGKNGDLPWPLRNEFRYFQRMTTTSSVIMGKKTWFSINRPLKGRINLVLSRELKE
DYR_PIG         ---LNCIVAVSQNMGIGKNGDLPWPLRNEYKYFQRMTTTSSVIMGRKTWFSINRPLKDRINIVLSRELKE
DYR_MOUSE       ---LNCIVAVSQNMGIGKNGDLPWPLRNEFKYFQRMTTTSSVIMGRKTWFSINRPLKDRINIVLSRELKE
DYR_RAT         ---LNCIVAVSQNMGIGKNGDLPWPLRNEFKYFQRMTTTSSVIMGRKTWFSINRPLKDRINIVLSRELKE
DYR_MESAU       ---LNCIVAVSQNMGIGKNGDFPWMLRNEFKYFQRMTTTSSVIMGRKTWFSINRPLKDRINIVLSRELKE
DYR_HELVI       ---LNLIAAACDNMGIGVNGALPWRLKKEMAYF--TTMTSAVIMGRRTWDCIPRPLQDRVNIVLTHNKEN
DYR8_SHISO      MIELHAILAATANGCIGKDNALPWPLKGDLARFKKLTMGKVVIMGRKTYESLPVKLEGRTCIVMTRQRDA
DYR8_ECOLX      MIELHAILAATANGCIGKDNALPWPLKGDLARFKKLTMGKVVIMGRKTYESLPVKLEGRTCIVMTRQRDA
DYR_LACCA       --------AQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFKRPLPERTNVVLTHQEDY
DYR_CANAL       ---VAIIVAALKPALIGYKGKMPWRLRKEIRYFKDVTTRTTVIMGRKTWESIPRPLPDRLNIILSRSYEN
SCPA_MYCGA      --MIKLIWCEDLNHGIAKNNQIPWKIDEELNHFHQTTTNHPIIMGYNTYLAMNKILANQANIVISKKHQR
DYR_LACLA       ------IWAEDEAGLIGEADKMPWSLPAEQQHFKETTMNQVILMGRKTFEGMNRVLPGRISIILTRDETY
DYR_CAEEL       MRKMNLIVAMDAEGGIGKNGVLPWRIKKDMQYFASVTKNVAVLMGRKCWESIRRPLAGRLNIVL--SRQL
DYR_MYCGE       --MLIAIWAMTQEGLIGNNNTLPWMIKQELAHFKKTTLFQALLMGRKTYESLPKVFEKRTIFLLSKDQNY
DYR1_HALMA      -TELVLVVAADENNVIGLDGGVPWHYPEDVRQYKNRIAGHPIILGRRTFESM-KPIPDCYTVVLTSDDRR
DYR1_ECOLX      ---LSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMG-ALPNRKYAVVTRSSTS
DYR_DROME       MLRFNLIVAVCENFGIGIRGDLPWRIKSELKYFSRTTKRTAVVMGRKTYFGVKRPLPDRLNIVLSQESDL
DYR_MYCPU       --MIISIWAMTKEGLIGKDNQMPWHIKEEFQHFRRQTLHKTLIMGKNTFFSLPKVFDKRKMYVLSHEKDF
DYR6_PROMI      ---ISLMAAVSENGVIGSGLDIPWHVQGEQLLFKAMTYNQWLLVGRKTFDSMGK-LPNRKYAVVTRSKII
DYR15_ECOLX     ---LSLMAAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMG-ALPNRKYAVVTRSSTS
DYR_UREPA       --MLKLIWCQTLNGGISKNNKLPWYIKEELDHFYKTTKNHKIIMGKNTFDSLDKPLNNRTNIIFTPEDES
DRTS_TRYBB      ----SVVVASDEKGGIGDGGTIPWEIPEDMQYFRRVTTNLAVVMGRKTWDSLPRPLSNRLNVVLSRSKEQ
DYR_SHV24       --LLNCIVAVDQNMGIGKNGYLPWLLTNDFKYFQRMTTSSVVIMGKNTWFSINRPLKDRINLVLSKKLKE
DYR_MYCPN       --MVKAIWAMDQNGLIGNGNSLPWRIKAELQHFRQTTLHQDVLMGSATYLSLPPVFSERNVYILTRNLNF
DYR7_ECOLX      ---ISLISATSENGVIGNGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFDSMG-VLPNRKYAVVSRKGSS
DRTS_TRYCR      ----SLVVAVDEHGGIGDGRSIPWNVPEDMKFFRDLTTKLAVVMGRKTWDSIPRPLPGRLNVVLSEKRNL
DYR_SHV2C       --LLNCIVAVDQNMGIGKKGHLPWPLLNDFKYFQRMTTSSVVIMGKNTWFSINRPLKDRINLVLSKKLKE
DYRL1_HUMAN     --LLNCIVAVSQNMGIGKNGDLPRPLRNEFRYFQRMTTTSSVIMGRKTWFSINRPLKDRINLVLSRELKE
DYR_SCHPO       ---LTMIVASSPNLGIGKKNSMPWHIKQEMAYFANVTSSTEVIMGRSCYDSLNRPLKDRINIVITRNSNY
DYR_ENCCU       --MLALVVALASHRGIGNANALPWPRPADMAWFRTLSQSIPVVMGRRTWDSIPRPLANRINVVLSRGPAR
SCPA_MYCPN      --MITLIWCQDKHFGIGRDNTIPWKLTEANQHFYNTTKNQTVVMGYNTFQELGDKLTDHNVVVLSKKHFE
DYR_CHICK       ---LNSIVAVCQNMGIGKDGNLPWPLRNEYKYFQRMTSTSAVIMGKKTWFSINRPLKDRINIVLSRELKE
DYR_YEAST       ---------------IGFRGGLPWRLPSEMKYFRQVTKKNALIMGRKTWESIPRPLPNRMNVIISRSKDV
DYR_CRYNE       -SITAVVAATAENG-IGLNGGLPWRLPGEMKYFARVTTGETVIMGRKTWESIPRPLKNRRNVVISKGVDL
DRTS_TOXGO      -----LVVAMTPKRGIGINNGLPWHLTTDFKHFSRVTKTTPVVMGRKTWESMPRPLVDRLNIVVSKEEDI
DRTS_LEIMA      ----SIVVALDMQHGIGDGESIPWRVPEDMTFFKNQTKRNAVVMGRKTWESVPRPLKGRLNIVLSSKATV
DRTS_LEIAM      ----SIVVALDKQHGIGDGESIPWRVPEDMAFFKQTTLRNAVVMGRKTWESVPRPLKGRLNVVLSSKATV
DRTS_CRIFA      ----SIVVAADQQHGIGDGETIPWTVPETLAFFKQTTLRNAVVMGRKTWELKFRPLKGRLNVVLSCRRPV
DRTS_PLAVI      -----------------------------------------VVMGRSSWESIPKPLPNRINVVLSKTKED
DYR_THEMA       -----------------------WSSFEDRKNFRKTTEIGNVVMGRITFEEIGRPLPERLNVVLTRRPKF
DYR_BPT4        ----------------GLGDGLPWRVKKDLQNFKARTEGTIMIMGAKTFQSLPTLLPGRSHIVVTKDGDL
DRTS_PLAFK      -----------------------------------------VVMGRTNWESIPKPLSNRINVILSRKKED
DRTS_PLACH      -----------------------------------------VVMGKASWESIPKPLQNRINIILSRTEDL
DYR10_ECOLX     ----------------GNQGKLPWQIKEDMQFFQKTTENSVVVMGLNTWRSLPKMKKGRDFIVISSTITE
DRTS_PLABA      -----------------------------------------VVMGKKSWESIPKPLQNRINIILSRTXXX
DRTS_PLAVN      -----------------------------------------VVMGKTSWESIPKPLENRINIILSRNLAK


                         .         .         *         .         .         .         .:140
query           HIEGADVVGSIEDAQRLCIGAEQVFLIGGAQLYAEALPSADRLIVTEIDADVEGDAFFPAVDRTTWVETA
DYR_NEIGO       CAAGAETVASLEVALALCAGAEEAVIMGGAQIYGQAMPLATDLRITEVDLSVEGDAFFPEIDRTHWREAE
DYR3_SALTY      QAEGVEVAPSLDAALALLTDCEEAMIIGGGQLYAEALPRADRLYLTYIDAQLNGDTHFPDYLSLGWQELE
DYR_BACSU       EFQGCTVVSSLKDVLDICSGPEECFVIGGAQLYTDLFPYADRLYMTKIHHEFEGDRHFPEFDESNWLVSS
DYR_NEIMA       XXXXXXXXXXXXXXXXXXXXXXXXVIMGGAQIYGQAMPLATDLRITEVDLSVEGDAFFPAIDRTHWKEAE
DYR_NEIMB       XXXXXXXXXXXXXXXXXXXXXXXXVIMGGAQIYGQAMPLATDLRITEVDLSVEGDAFFPAIDRTHWKEAE
DYR_STAHA       NFKDCEIAHSIEAAFKLCENEEEVFIFGGEQIYVMFLPYVEKMYVTKIHHEFEGDTFFPVVNFDDWKEVS
DYR_ENTAE       SDDRVQWVKSVDEAIAACGDAEEIMVIGGGRVYEQFLPKAHKLYLTHIDAEVEGDTHFPDYDPDEWESVF
DYR_KLEAE       SDDRVQWVSSVEEAIAACGDVEEIMVIGGGRVYDEFLPKAQKLYLTHIDAEVEGDTHFPDYDPDEWESVF
DYR_MYCTU       MASGAEVVGSLEEA----LTSPETWVIGGGQVYALALPYATRCEVTEVDIGLAGDALAPVLDE-TWRGET
DYR_MYCBO       MASGAEVVGSLEEA----LTSPETWVIGGGQVYALALPYATRCEVTEVDIGLAGDALAPVLDE-TWRGET
DYR_CITFR       D-DRVQWVKSVDEAIAACGDEPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
DYR_SHIFL       D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
DYR_ECOLI       D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
DYR_ECOL6       D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
DYR_MYCLE       MAEGAEVFGSLEETISNLETEPEMWVIGGEQIYRLALPLATRCGVTEVDTYLDDDVLAPVLD-DTWVGVT
DYR_HAEIN       H-EGVIWKDSFESAVNFVRDFDEIMLIGGGELFKQYLPKADKLYLTQIQTELDGDTFFPQLNWEEWIEFD
DYR_STAES       HHEGVDVINSLDEIKEL---SGHVFIFGGQTLFEAMIDQVDDMYITVIDGKFQGDTFFPPYTFENWVESS
DYR_STAEQ       HHEGVDVINSLDEIKEL---SGHVFIFGGQTLFEAMIDQVDDMYITVIDGKFQGDTFFPPYTFENWVESS
DYR_STAEP       HHEGVDVINSLDEIKEL---SGHVFIFGGQTLFEAMIDQVDDMYITVIDGKFQGDTFFPPYTFENWVESS
DYRA_STAAU      HHEGVDVINSLDEIKEL---SGHVFIFGGQTLYEAMIDQVDDMYITVIDGKFQGDTFFPPYTFENWVESS
DYR_BUCBP       KNTNVLFVNSISKAIQSALYKNEIMIIGGSNLYNQMLTSANKLYITHIEKYILGDTYFPTYDHLPW----
DYR_STAAU       NVEGVDVIHSIEDIYQL---PGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWVASS
DYR_STAAR       NVEGVDVIHSIEDIYQL---PGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWVASS
DYR_STAAN       NVEGVDVIHSIEDIYQL---PGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWVASS
DYR_STAAM       NVEGVDVIHSIEDIYQL---PGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWVASS
DYR_STAAC       NVEGVDVIHSIEDIYQL---PGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWVASS
DYR_STAAW       NVVGVDVIHSIEDIYQL---PGHVFIFGGQILFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWVASS
DYR_STAAS       NVVGVDVIHSIEDIYQL---PGHVFIFGGQILFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWVASS
DRTS_DAUCA      DIENVVICGSMISALELCVSVEKVFVIGGGQIYREALPGCDAVHITEIEEHIECDTFIPLLDESVFQPWY
DYR_BUCAI       KQEGIIWADSISNAIISAQYNQEIMIIGGAKIYKEMLFYANKLYLTHIDIDIVGDAYFPEYKLYPYWKTR
DYR_PNECA       DLNGIHSAKSLDHALELSVQINRIFVIGGAQLYKAAMPKLDRIMATIIYKDIHCDVFFPLSDLESWVGT-
DRTS1_ARATH     DIANTENVSSVDSALDLCLSIERVFVIGGGDILREALPSCDAIHLTEIDTSVDCDTFIPAIDTSVYQPWS
DYR_STRPN       KIDG---VATFQDVQSVLAQEKNLYIIGGKQIFQAFEPYLDEVIVTHIHARVEGDTYFPEELDLSLFETV
DRTS_MAIZE      DVENVVICGSMESALELCLSIEKVFVIGGGQVLREYLPACEAIHLTDIQSSIECDTFIPPVD--------
DYR2_HALMA      XXXXXXXXXXXXXXXXXXXXXXXXYVIGGATVYEQFLPQADELILTELAAAFDGDTVFPTVDWSNWTEME
DYR_BUCAP       H---KDVINSISKALLSTTYDKEIMVIGGSKIYKQMLFYATKLYLTHVDFNGIGDTYFPQYKSCKWKTIF
DRTS_SOYBN      DIATAENVXXXXXXXXXXXXIEKVFVIGGGQIFREALPGCEAIHLTEIQSSIECDTFMPPVDFTPWYSSF
DRTS2_ARATH     DIANTENVSSIDSALDLSLSIEKVFVIGGGDILREALPSCEAIHITEIDTSIDCDTFIPTVDTSAYQPWC
DRTS_ORYSJ      DFATAEICGSLDSALQLCLTVEKTFIIGGGEILRQSLPACEAIHLTDIESSIECDTFIPPIDLSMFHPWY
DYR13_ECOLX     SAPGCAVVSTLSHSPSTAEHGKELYVARGAEVYALALPHANGVFLSEVHQTFEGDAFFPVLN--------
DYR_ENTFC       KVENAEVLHSIDELLAYAKDPEDIYVSGGSRIFQALLPETKIIWRTLIDAEFEGDTFIGEIDFTSF----
DYR_HALVO       SVDTAHRAASVEEAVDIALDAETAYVIGGAAIYALFQPHLDRMVLSRVPGEYEGDTYYP-----------
DYR_SHV21       PHRAHFLAKSLDDALKLTEQPEMVWIIGGSSVYKEAMPCDLKLFVTRIMQDFECDTFFPEFDLEKYIEYP
DYR5_ECOLX      DNDNVIVFPSIEEAMYLAELTDHVIVSGGGEIYRETLPMASTLHISTIDIEPEGDVFFPNIPNT--FEVV
DYR9_ECOLX      VVYVSTYQIAVRTASLLVDKPEQIFVIGGKSAYENLAAYVDKLYLTRVQLNTQQD---------------
DRTS_PARTE      SNE-VQVFPRIEDAQFYNTSHQKLYLIGGKRIFEEGLATCSDVHLTRIGVETKCDVYLNKNIFSTFQVNK
DYR_BOVIN       PPKGAHFLASLDDALELIEDPELVWIVGGSSVYKEAMPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLP
DYR_AEDAL       NAYPSEVMTSMQEALKLVNEIENVWIVGGNAVYKEAMQSCHRIYLTEIKETFECDAFFPEITSDQLVKND
DYR_HUMAN       PPQGAHFLSSLDDALKLTEQPEMVWIVGGSSVYKEAMPGHLKLFVTRIMQDFESDTFFPEID----LEKY
DYR_PIG         PPQGAHFLASLDDALKLTEQPEMVWIVGGSSVYKEAMPGHIRLFVTRIMKEFESDTFFPEIDLEKYKLLS
DYR_MOUSE       PPRGAHFLASLDDALRLIEQPEMVWIVGGSSVYQEAMPGHLRLFVTRIMQEFESDTFFPEIDLGKYPEYP
DYR_RAT         PPQGAHFLASLDDALKLIEQPEMVWVVGGSSVYQEAMPGHLRLFVTRIMQEFESDTFFPEIDLEKYPEYP
DYR_MESAU       PPQGAHFLASLDDALKLIEQPEMVWIVGGSSVYKEAMPGHLRLFVTRIMQEFESDTFFPEIDLEKYPEYP
DYR_HELVI       VPEGVMVFPGLDEAIKYIEGREDIWVIGGSSIYRAAMPNCGKIYLTEIQKSFDCDTFFPNIDK-------
DYR8_SHISO      N--GAIFVNNVSDAMRFAVG-DVAYVIGGAEIFKRLALMITQIELTFVKRLYEGD---------TYVDLA
DYR8_ECOLX      N--GAIFVNNVSDAMRFAVG-DVAYVIGGAEIFKRLALMITQIELTFVKRLYEGD---------TYVDLA
DYR_LACCA       QAQGXXXXXXXXXXXXXXHPDQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGD---------------
DYR_CANAL       KIIDDNIISSIESSLNLVSDVERVFIIGGAEIYNELINNSSHLLITEIEESIEMDTF-------------
SCPA_MYCGA      ELKNKNELFLYSDLKKALISIVDLFIIGGKKTIEQAIKYADQLVISKLNADYGCDLF-------------
DYR_LACLA       QSDNEKVLIMHSPKEVLDWYHKQLFITGGAEILALFESELELLYRTVVHEKFKGDTYFPSTFDFGRFKLV
DYR_CAEEL       PAQKSDVVNSLEAAMKLLSSIETIWNIGGAEIYDLALREVDEIHLTRIFKNFEADVHLKSLD--------
DYR_MYCGE       RFEKGSEVKVINDFWPLIKSEKDLFICGGKSVYEQTINECDQLIVSIIKKKYKGDQF-------------
DYR1_HALMA      SADSE----TVEYATTPQIAVEXTYVIGGEAVYDLFLPFAGRVFLSRIHEHNEGDRYFPDLG-AEWTELS
DYR1_ECOLX      DNENVLIFPSIKDATNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDIEPEGDVYFPEI---------
DYR_DROME       P-KGVLLCPNLETAMKILNEVENIWIVGGSGVYEEAMPRCHRLYITKIMQKFDCDTFFPAIPREVAPDSD
DYR_MYCPU       KIDHPDVIYDYKDLLKEYANNDKIYVAGGLYVYQQLIPLSDILIVSIVKGSYEGNKYL-SVDFSNFVQ--
DYR6_PROMI      S-NDPDVVASVESALAYLNNAAHIFVSGGGEIYKALIDQADVIHLSVIHKHISGDVFFPPV---------
DYR15_ECOLX     SDENVLVFPSIDEANHLKTITDHVIVSGGGEIYKSLIDKVDTLHISTIDIEPEGDVYFPEI---------
DYR_UREPA       YFVTNDFQQVLNDAKK-----EDIFIIGGKELFDIFLAYADVLIVS------------------------
DRTS_TRYBB      LLAGIDVVGGLEDALRMLVSKEHVFCIGGGTIYKQAL---------------------------------
DYR_SHV24       IPHGAHFLASLNDALKLIEQPEMVWIIGGSSVYKDAMSSHLKLFVTRIMQSFETDTFFPEIDLKKYKPLI
DYR_MYCPN       NPPDKGCLTKVIHEYENFIQPKHLYICGGAQVYEQLIPRCDALIVSTIFGKYTGDKY-------------
DYR7_ECOLX      SNENVLVFPSIEIAQELSKITDHLYVSGGGQIYNSLIEKADIIHLSTVHVEVEGDINFPKI---------
DRTS_TRYCR      HADSIVAVGGLEQALRLLASIETVYCIGGGSVYAEAL---------------------------------
DYR_SHV2C       IPHGAHFLASLNDALKLIEQPERVWIIGGSSVYKDAMNYSSKLFVTRIMQSFETDTFFPEIDLKNYIEPG
DYRL1_HUMAN     PPQGAHFLASLDDALKLTERPEMIWIVGGSSVYKEAMNHLGKLFVTRIMQDFESDTFFSEID--------
DYR_SCHPO       NLYAADCIDSALDLVAEKYGADKVFIIGGSFLYGSALPLTKNLLFTRIHKEYPCDSFFPPAESSDWVRKA
DYR_ENCCU       STENTFFIQTFEALDSLPLPSSMTFVIGGRDVYSLALESGHLIFATEVFESPECDVFFPHID--------
SCPA_MYCPN      ELQNIKVFNSIEKLLQHHFNRD-LYVIGGKQIFHHFIELADRLIISVLPVD-------------------
DYR_CHICK       APKGAHYXXXXXXXXELKSKVDMVWIVGGTAVYKAAMPINHRLFVTRILHEFESDTFFPEIDLTEYPGVP
DYR_YEAST       HDKERSIVQSNSLANAIMEHLERIYVIGGGEVYSQIFSITDHWLITKIN---------------------
DYR_CRYNE       TAENSTVYTDIPSALSALRSSPRIFLIGGA----------------------------------------
DRTS_TOXGO      AAEKPQAEG--QQRVRVCXSVDQIFVVGGAGLYEAALSVASHLYITRVAREFPCDVFFPA----------
DRTS_LEIMA      E----ELLAPLPEGQRYCSSIETAYCVGGAQVYADAMPCIEKLYLTRIYATAPATRFFPFPPETAWLASS
DRTS_LEIAM      E----ELLAPLPEEKRYCSSIETAYCVGGAQVYADAMPCVEKLIHTTAPACTRFFPFPPENAATAWLASS
DRTS_CRIFA      DAAAADVVGGLKEALHLCSSIETAYCIGGARVYTEAMQS-------------------------------
DRTS_PLAVI      VKEKVFIIDSIDDXXXXXXXXXXXFIIGGAQVYRECLSRIKQIYFTRINGAYPCDVFFPEFDESQFVTSV
DYR_THEMA       NGSPADVVKFLEGK-----GYERVAVIGGKTVFTEFLREVDELFVT------------------------
DYR_BPT4        YISGGEIQVSSPNAETMLDQNSKVSVIGGXXXXXXXXXXXDEVVVSRINSTVQLDAFLDDISKREMVET-
DRTS_PLAFK      FDEDVYIINKVEDLIVLLLNYYKCFIIGGSVVYQEFLEKIKKIYFTRINSTYECDVFFPEINENEYIISV
DRTS_PLACH      AKEYNNVINSVDDLFPICIKYYKCFIIGGASVYKEFLDRIKKIYFTRINNAYTCDVLFPDINEDLFITSI
DYR10_ECOLX     HNNNIQIFKSFESLEAFRDTTKPINVIGGVGLLSEAIEHASTVYMSSIHKPVHADVYVP-----------
DRTS_PLABA      XXXXXXXXKSVDDLFPICTKYYKCFIIGGSSVYKEFLDRIKKIYFTRINNSYNCDVLFPEINENLFITSI
DRTS_PLAVN      EYSNVIIIKSVDELFPICIKYYKCFIIGGASVYKEFL---DRNLIKKI----------------------


                         +         .         .         .         .         *         .:210
query           RELHHSETNGFDYAFVTYERPASGEE
DYR_NEIGO       RTERRVSSKGVAYTFVHY--------
DYR3_SALTY      RSTHPADKNSYACEFVTLSR------
DYR_BACSU       EQGTKDEKNPYDYEFLMYEKKNSSK-
DYR_NEIMA       RTERRVSSKGTSYAFVHYLR------
DYR_NEIMB       RTERRVSSKGTRYAFVHYLR------
DYR_STAHA       VEKGKDEKNPYDYYFHIYER------
DYR_ENTAE       SEFHDADANSHSYCFEILER------
DYR_KLEAE       SEFHDADANSHSYCFEILER------
DYR_MYCTU       GEWRFSR-SGLRYRLYSYHR------
DYR_MYCBO       GEWRFSR-SGLRYRLYSYHR------
DYR_CITFR       SEFHDADANSHSYCFEILER------
DYR_SHIFL       SEFHDADANSHSYCFEILER------
DYR_ECOLI       SEFHDADANSHSYCFEILER------
DYR_ECOL6       SEFHDADANSHSYCFEILER------
DYR_MYCLE       GEWLVS-CSGLRYRLHSYHR------
DYR_HAEIN       EYRKADEQNRYDCRFLILTR------
DYR_STAES       VEGQLDEKNTIPHTFL----------
DYR_STAEQ       VEGQLDEKNTIPHTFL----------
DYR_STAEP       VEGQLDEKNTIPHTFL----------
DYRA_STAAU      VEGQLDEKNTIPHTFL----------
DYR_BUCBP       --------------------------
DYR_STAAU       VEGKLDEKNTIPHTFL----------
DYR_STAAR       VEGKLDEKNTIPHTFL----------
DYR_STAAN       VEGKLDEKNTIPHTFL----------
DYR_STAAM       VEGKLDEKNTIPHTFL----------
DYR_STAAC       VEGKLDEKNTIPHTFL----------
DYR_STAAW       VEGKLDEKNTIPHTFL----------
DYR_STAAS       VEGKLDEKNTIPHTFL----------
DRTS_DAUCA      SSFPLVE-NKIRYCFTTYVR------
DYR_BUCAI       KKNTKNKMNPYNYSFEILSR------
DYR_PNECA       -KVPHGKINGFDYEFEMWTR------
DRTS1_ARATH     SSFPVTE-NGLRFCFTTFVRVKSSAD
DYR_STRPN       SSKFYAEKNPYDF-------------
DRTS_MAIZE      --------------------------
DYR2_HALMA      RTTHS------EFAIVRYTRTSS---
DYR_BUCAP       RKQHFKDKNNYNFCFEILSR------
DRTS_SOYBN      PKVE----NNIRYSFTTYVRVRS---
DRTS2_ARATH     SSFPICE-NGLRFSFTTHVR------
DRTS_ORYSJ      SSFPVVE-NGIKHSFISFVR------
DYR13_ECOLX     --------------------------
DYR_ENTFC       --------------------------
DYR_HALVO       --------------------------
DYR_SHV21       SVLSNQEEKSIKYKFEVYEK------
DYR5_ECOLX      FEQHFSSNINYCY-------------
DYR9_ECOLX      --------------------------
DRTS_PARTE      TSQTKSE-NGINYDY-----------
DYR_BOVIN       EPLDVQEEKGIKYKFEVYEK------
DYR_AEDAL       DDVPEQEENGIQYQYRIYEK------
DYR_HUMAN       KLLPEQEEKGIKYKFEVYEK------
DYR_PIG         EPSDVQEEKGIKYKFEVYEK------
DYR_MOUSE       GVLSEQEEKGIKYKFEVYEK------
DYR_RAT         GVLSEQEEKGIKYKFEVYEK------
DYR_MESAU       GVLSEQEEKGIKYKFEVYEK------
DYR_HELVI       --------------------------
DYR8_SHISO      EMVKDYEQNGMEHTYFTYRK------
DYR8_ECOLX      EMVKDYEQNGMEHTYFTYRK------
DYR_LACCA       --------------------------
DYR_CANAL       --------------------------
SCPA_MYCGA      --------------------------
DYR_LACLA       SEKFHDERNSYTFTIKKYEK------
DYR_CAEEL       --------------------------
DYR_MYCGE       --------------------------
DYR1_HALMA      REPH----DGFD--VIEYEQ------
DYR1_ECOLX      --------------------------
DYR_DROME       MPLGVQEENGIKFEYKILEK------
DYR_MYCPU       --------------------------
DYR6_PROMI      --------------------------
DYR15_ECOLX     --------------------------
DYR_UREPA       --------------------------
DRTS_TRYBB      --------------------------
DYR_SHV24       EPSNTQEEKGIRYKFEVYEK------
DYR_MYCPN       --------------------------
DYR7_ECOLX      --------------------------
DRTS_TRYCR      --------------------------
DYR_SHV2C       VPSNTQEEKGIKYKFEVYEK------
DYRL1_HUMAN     --------------------------
DYR_SCHPO       --------------------------
DYR_ENCCU       --------------------------
SCPA_MYCPN      --------------------------
DYR_CHICK       ADI--QEEDGIQYKFEVYQK------
DYR_YEAST       --------------------------
DYR_CRYNE       --------------------------
DRTS_TOXGO      --------------------------
DRTS_LEIMA      QGRRKSEAEGLEFEICKYV-PRNHEE
DRTS_LEIAM      QGRRKSAVDGLEFEICKYV-PRNHEE
DRTS_CRIFA      --------------------------
DRTS_PLAVI      SEVYNSKGTTLDF-------------
DYR_THEMA       --------------------------
DYR_BPT4        --------------------------
DRTS_PLAFK      SDVYTSNNTTLD--FIIYKK------
DRTS_PLACH      SDVYSSNNTTLD--FVIYSK------
DYR10_ECOLX     --------------------------
DRTS_PLABA      SDVYYSNNTTLD--FIIYSK------
DRTS_PLAVN      --------------------------