[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF09485.1

[Show Plain Result]


## Summary of Sequence Search
    1::149
    1::148     3e-23  37%  148 aa  YQEY_BACSU RecName: Full=Uncharacterized protein yqeY;
   51::116     9e-10  43%  185 aa  YO215_YEAST RecName: Full=Uncharacterized protein YOR215C,
 1140::1234    1e-04  32% 1332 aa  RPOC_CORK4 RecName: Full=DNA-directed RNA polymerase subunit beta';  
    1::149

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLKARINDDMKXXXXXXXXXXLGTVRLLLAAIKQREVDERIELDDAGITAVIDKMIKQRKDSISQFEQA
YQEY_BACSU      MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKKKDSLTEDEELTVLSRELKQRKDSLQEFSNA
YO215_YEAST     -------------------------IRNMLSAIKNKEIALKGKADEYSLYDMYSKLISQRKDSINEFLAN
RPOC_CORK4      -----------------------------------------------------------QKHLIEQVQKV


                         .         .         *         .         .         .         .:140
query           GRDDLVAKEKAELDVLVAYMPAQLSDAEVAAEVQKAVTESGAAGPQDMGKVMGLVKARLAGRADMTAVSA
YQEY_BACSU      NRLDLVDKVQKELDILEVYLPEQLSEEELRTIVNETIAEVGASSKADMGKVMGAIMPKVKGKADGSLINK
YO215_YEAST     KRDDLVAKEQGEMDIIKKYM--------------------------------------------------
RPOC_CORK4      YRDQGVAIHDKHIEIIVRQMPGSLIDRNEARAINKAVATNGGEGAAFRQEIMGITKASLATESWLSAAS-


                         +         .         .         .         .         *         .:210
query           LVKAALAxx
YQEY_BACSU      LVSSQLS--
YO215_YEAST     ---------
RPOC_CORK4      ---------