[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF09628.1

[Show Plain Result]


## Summary of Sequence Search
    1::188
    1::188     e-111 100%  188 aa  DCD_RALME RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     e-110  99%  188 aa  DCD_CUPTR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     e-110  98%  188 aa  DCD_RALEJ RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     e-109  97%  188 aa  DCD_RALEH RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     e-108  96%  188 aa  DCD_RALSO RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     e-108  96%  188 aa  DCD_RALPJ RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     e-104  93%  188 aa  DCD_JANMA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     e-103  91%  188 aa  DCD_POLSJ RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     e-103  91%  188 aa  DCD_ACIAC RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     e-103  91%  188 aa  DCD_VARPS RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     e-102  91%  188 aa  DCD_HERAR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-102  93%  189 aa  DCD_BURP8 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-102  93%  189 aa  DCD_BURXL RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-102  91%  189 aa  DCD_LEPCP RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-102  93%  189 aa  DCD_BURPP RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     e-101  89%  188 aa  DCD_DIAST RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     e-101  89%  188 aa  DCD_ACISJ RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURVG RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURS3 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURPS RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURP6 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURP0 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURMS RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURMA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURM9 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURM7 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURM1 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURCM RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURCJ RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURCH RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURCC RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURCA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-101  91%  189 aa  DCD_BURA4 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     e-101  90%  189 aa  DCD_RHOFD RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     e-100  91%  189 aa  DCD_BURTA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     e-100  89%  188 aa  DCD_DECAR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     2e-99  90%  187 aa  DCD_BORPA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     2e-99  90%  187 aa  DCD_BORBR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     3e-99  89%  187 aa  DCD_BORPE RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     2e-98  89%  187 aa  DCD_BORPD RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     5e-98  87%  189 aa  DCD_CELJU RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     6e-98  89%  187 aa  DCD_BORA1 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     3e-97  87%  188 aa  DCD_THISH RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     1e-96  86%  188 aa  DCD_NITEC RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     1e-96  86%  188 aa  DCD_NEIMB RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     1e-96  86%  188 aa  DCD_NEIMA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     2e-96  85%  188 aa  DCD_NEIG2 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     2e-96  85%  188 aa  DCD_NEIG1 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     3e-96  85%  188 aa  DCD_NEIMF RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     3e-96  85%  188 aa  DCD_NEIM0 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     5e-96  86%  189 aa  DCD_NITMU RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     8e-96  86%  189 aa  DCD_TERTT RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     1e-95  84%  188 aa  DCD_NITEU RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     2e-94  84%  188 aa  DCD_MARAV RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     2e-94  82%  188 aa  DCD_LARHH RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     2e-93  82%  188 aa  DCD_NITOC RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     4e-93  83%  188 aa  DCD_THIDA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     4e-93  84%  188 aa  DCD_AZOSB RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     6e-93  82%  188 aa  DCD_FRATW RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     6e-93  82%  188 aa  DCD_FRATT RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     6e-93  82%  188 aa  DCD_FRATO RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     6e-93  82%  188 aa  DCD_FRATN RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     6e-93  82%  188 aa  DCD_FRATM RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     6e-93  82%  188 aa  DCD_FRATH RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     6e-93  82%  188 aa  DCD_FRATF RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     6e-93  82%  188 aa  DCD_FRAT1 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     8e-93  81%  188 aa  DCD_FRAP2 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     8e-93  84%  188 aa  DCD_AZOSE RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     1e-92  85%  190 aa  DCD_CHRVO RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::191     2e-92  83%  191 aa  DCD_PSYA2 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     2e-92  81%  188 aa  DCD_CHRSD RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::191     2e-92  83%  191 aa  DCD_PSYCK RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     3e-92  82%  188 aa  DCD_PSEMY RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     7e-92  81%  189 aa  DCD_XANC5 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::191     7e-92  82%  191 aa  DCD_PSYWF RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     9e-92  80%  189 aa  DCD_XANAC RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     2e-91  81%  188 aa  DCD_PSESM RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     2e-91  80%  189 aa  DCD_ACIBT RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     2e-91  81%  189 aa  DCD_XANCP RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     2e-91  81%  189 aa  DCD_XANCB RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     2e-91  81%  189 aa  DCD_XANC8 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     2e-91  80%  189 aa  DCD_ACIBY RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     2e-91  80%  189 aa  DCD_ACIBS RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     2e-91  80%  189 aa  DCD_ACIBC RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     2e-91  80%  189 aa  DCD_ACIB5 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     2e-91  80%  189 aa  DCD_ACIB3 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     3e-91  81%  188 aa  DCD_PSEU2 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     3e-91  81%  188 aa  DCD_PSE14 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::190     3e-91  80%  190 aa  DCD_STRM5 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     4e-91  81%  188 aa  DCD_METCA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     6e-91  80%  189 aa  DCD_XANOR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     6e-91  80%  189 aa  DCD_XANOP RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     6e-91  80%  189 aa  DCD_XANOM RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::190     7e-91  80%  190 aa  DCD_STRMK RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-90  81%  189 aa  DCD_ALCBS RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     2e-90  80%  189 aa  DCD_HALHL RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     2e-90  80%  189 aa  DCD_ACIAD RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     3e-90  80%  188 aa  DCD_PSEFS RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     4e-90  80%  188 aa  DCD_PSEAE RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     4e-90  80%  188 aa  DCD_PSEAB RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     4e-90  80%  188 aa  DCD_PSEA8 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     4e-90  80%  188 aa  DCD_PSEA7 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-89  80%  188 aa  DCD_PSEPW RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-89  80%  188 aa  DCD_PSEPK RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-89  80%  188 aa  DCD_PSEP1 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     2e-89  80%  188 aa  DCD_PSEPG RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     2e-89  80%  188 aa  DCD_AZOVD RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::186     3e-89  79%  188 aa  DCD_COXBU RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::186     3e-89  79%  188 aa  DCD_COXBR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::186     3e-89  79%  188 aa  DCD_COXBN RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::186     3e-89  79%  188 aa  DCD_COXB2 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::186     3e-89  79%  188 aa  DCD_COXB1 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::191     9e-89  79%  191 aa  DCD_XYLFT RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::191     9e-89  79%  191 aa  DCD_XYLF2 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::189     9e-89  80%  189 aa  DCD_SACD2 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::191     1e-88  79%  191 aa  DCD_XYLFM RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::191     2e-88  79%  191 aa  DCD_XYLFA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     8e-88  79%  188 aa  DCD_PSEPF RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     3e-87  77%  188 aa  DCD_LEGPL RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     3e-87  77%  188 aa  DCD_LEGPH RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     3e-87  77%  188 aa  DCD_LEGPA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     3e-85  78%  188 aa  DCD_ACIF5 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     3e-85  78%  188 aa  DCD_ACIF2 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     8e-83  75%  184 aa  DCD_ACIBL RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::187     1e-82  76%  188 aa  DCD_DICNV RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     3e-81  72%  190 aa  DCD_CHLFF RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     7e-81  73%  190 aa  DCD_CHLAB RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     2e-80  72%  190 aa  DCD_CHLCV RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     6e-80  74%  185 aa  DCD_NITSB RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     1e-79  74%  190 aa  DCD_CAMHC RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     3e-79  74%  184 aa  DCD_GEMAT RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::182     3e-79  75%  183 aa  DCD_ACIC5 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     7e-79  73%  188 aa  DCD_RICBR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     7e-79  73%  188 aa  DCD_RICB8 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     4e-78  73%  186 aa  DCD_WOLSU RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-77  72%  188 aa  DCD_RICRS RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-77  72%  188 aa  DCD_RICPU RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-77  72%  188 aa  DCD_RICCN RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-77  72%  188 aa  DCD_RICAE RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     2e-77  72%  184 aa  DCD_MAGSA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     2e-77  74%  184 aa  DCD_SPHAL RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     2e-77  70%  190 aa  DCD_CHLMU RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     5e-77  71%  190 aa  DCD_CHLPN RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-76  71%  188 aa  DCD_RICFE RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-76  71%  188 aa  DCD_RICAH RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-76  68%  190 aa  DCD_CHLTR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-76  68%  190 aa  DCD_CHLTB RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-76  68%  190 aa  DCD_CHLTA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-76  68%  190 aa  DCD_CHLT2 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-76  68%  189 aa  DCD_METI4 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     2e-76  72%  186 aa  DCD_NAUPA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     2e-76  73%  184 aa  DCD_GRABC RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     2e-76  71%  186 aa  DCD_CAMFF RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     9e-76  70%  188 aa  DCD_RICCK RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     1e-75  70%  188 aa  DCD_SULNB RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     1e-75  73%  184 aa  DCD_SPHWW RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     1e-75  70%  188 aa  DCD_RICPR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::188     2e-75  70%  188 aa  DCD_RICTY RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     3e-75  69%  186 aa  DCD_CAMJE RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     6e-75  70%  184 aa  DCD_HERA2 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     6e-75  69%  186 aa  DCD_CAMLR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     1e-74  72%  184 aa  DCD_NOVAD RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     1e-74  69%  186 aa  DCD_CAMJR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     2e-74  72%  184 aa  DCD_RHOCS RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     4e-74  69%  186 aa  DCD_CAMJD RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     4e-74  69%  186 aa  DCD_CAMJ8 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     1e-73  71%  184 aa  DCD_ERYLH RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     1e-73  68%  186 aa  DCD_CHLSY RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     1e-73  68%  186 aa  DCD_CHLAA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     2e-72  67%  186 aa  DCD_CHLAD RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::186     1e-71  68%  188 aa  DCD_PARUW RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     3e-71  68%  184 aa  DCD_ACICJ RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     5e-71  68%  186 aa  DCD_CAMC5 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::182     7e-71  67%  185 aa  DCD_WOLWR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::182     7e-71  67%  185 aa  DCD_WOLPM RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     7e-71  68%  186 aa  DCD_CAMC1 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::186     3e-70  64%  188 aa  DCD_ORITB RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::182     6e-70  66%  185 aa  DCD_WOLPP RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::186     2e-69  63%  188 aa  DCD_ORITI RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::182     3e-69  68%  183 aa  DCD_GLUOX RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::182     2e-68  65%  185 aa  DCD_WOLTR RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::182     2e-66  63%  185 aa  DCD_ANAPZ RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::185     5e-66  65%  188 aa  DCD_HELAH RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     6e-66  66%  184 aa  DCD_ROSCS RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::185     8e-66  63%  188 aa  DCD_HELPJ RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::182     1e-65  62%  185 aa  DCD_NEOSM RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::185     1e-65  63%  188 aa  DCD_HELPY RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::185     1e-65  63%  188 aa  DCD_HELPS RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::185     1e-65  63%  188 aa  DCD_HELPG RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::185     1e-65  63%  188 aa  DCD_HELP2 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::185     1e-65  66%  188 aa  DCD_HELHP RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::182     3e-62  60%  185 aa  DCD_ANAMM RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::182     3e-62  60%  185 aa  DCD_ANAMF RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::184     7e-62  66%  185 aa  DCD_PELUB RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::182     2e-56  57%  187 aa  DCD_EHRCJ RecName: Full=Deoxycytidine triphosphate deaminase;      
    2::181     1e-20  38%  187 aa  DCD_CORK4 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::178     7e-20  37%  194 aa  DCD_METS3 RecName: Full=Probable deoxycytidine triphosphate
    4::181     1e-19  37%  189 aa  DCD_CORGL RecName: Full=Deoxycytidine triphosphate deaminase;      
    4::181     1e-19  37%  189 aa  DCD_CORGB RecName: Full=Deoxycytidine triphosphate deaminase;      
    4::181     2e-19  37%  193 aa  DCD_COREF RecName: Full=Deoxycytidine triphosphate deaminase;      
   13::178     2e-18  35%  193 aa  DCD_BIFAA RecName: Full=Deoxycytidine triphosphate deaminase;      
    2::167     4e-18  35%  178 aa  DCD_CLOTH RecName: Full=Deoxycytidine triphosphate deaminase;      
    4::173     5e-18  36%  177 aa  DCD_KORCO RecName: Full=Probable deoxycytidine triphosphate
    4::181     5e-18  34%  187 aa  DCD_CORDI RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     8e-18  36%  193 aa  DCD_BIFLO RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     8e-18  36%  193 aa  DCD_BIFLI RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     8e-18  36%  193 aa  DCD_BIFLD RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::172     1e-17  41%  179 aa  DCD_CALMQ RecName: Full=Probable deoxycytidine triphosphate
   33::181     1e-17  37%  188 aa  DCD_CORJK RecName: Full=Deoxycytidine triphosphate deaminase;      
    4::178     1e-17  35%  193 aa  DCD_BIFA0 RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::182     2e-17  35%  201 aa  DCD_LEIXX RecName: Full=Deoxycytidine triphosphate deaminase;      
    4::182     3e-17  34%  191 aa  DCD_ARTCA RecName: Full=Deoxycytidine triphosphate deaminase;      
   35::185     4e-17  36%  197 aa  DCD_METST RecName: Full=Probable deoxycytidine triphosphate
    2::171     5e-17  37%  180 aa  DCD_PERMH RecName: Full=Deoxycytidine triphosphate deaminase;      
    4::178     5e-17  35%  191 aa  DCD_ACIC1 RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::178     7e-17  35%  191 aa  DCD_NOCSJ RecName: Full=Deoxycytidine triphosphate deaminase;      
   15::169     1e-16  35%  172 aa  DCD_METS5 RecName: Full=Probable deoxycytidine triphosphate
    4::182     2e-16  33%  191 aa  DCD_RENSM RecName: Full=Deoxycytidine triphosphate deaminase;      
    4::178     2e-16  34%  196 aa  DCD_THEFY RecName: Full=Deoxycytidine triphosphate deaminase;      
   31::169     2e-16  38%  173 aa  DCD_ACIAM RecName: Full=Probable deoxycytidine triphosphate
    4::182     4e-16  34%  191 aa  DCD_STRCO RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::178     4e-16  35%  190 aa  DCD_MYCMM RecName: Full=Deoxycytidine triphosphate deaminase;      
   11::177     4e-16  29%  187 aa  DCD_METMJ RecName: Full=Probable deoxycytidine triphosphate
   19::182     4e-16  32%  201 aa  DCD_CLAMS RecName: Full=Deoxycytidine triphosphate deaminase;      
    4::182     4e-16  33%  191 aa  DCD_ARTAT RecName: Full=Deoxycytidine triphosphate deaminase;      
    4::182     6e-16  35%  191 aa  DCD_STRAW RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::178     6e-16  33%  190 aa  DCD_MYCUA RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::179     6e-16  32%  193 aa  DCD_METKA RecName: Full=Probable deoxycytidine triphosphate
    2::171     8e-16  35%  180 aa  DCD_SULSY RecName: Full=Deoxycytidine triphosphate deaminase;      
   23::169     8e-16  34%  172 aa  DCD_SULAC RecName: Full=Probable deoxycytidine triphosphate
    1::170     8e-16  32%  176 aa  DCD_PYRAR RecName: Full=Probable deoxycytidine triphosphate
    1::170     1e-15  32%  176 aa  DCD_THENV RecName: Full=Probable deoxycytidine triphosphate
    4::182     1e-15  33%  191 aa  DCD_STRGG RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::183     1e-15  36%  197 aa  DCD_METTH RecName: Full=Probable deoxycytidine triphosphate
    2::164     1e-15  33%  182 aa  DCD_HALOH RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::181     1e-15  32%  189 aa  DCD_RHOE4 RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::177     2e-15  33%  186 aa  DCD_METPE RecName: Full=Probable deoxycytidine triphosphate
   33::178     3e-15  33%  190 aa  DCD_MYCLE RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     3e-15  33%  190 aa  DCD_MYCLB RecName: Full=Deoxycytidine triphosphate deaminase;      
    2::173     3e-15  33%  186 aa  DCD_COPPD RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::182     3e-15  31%  201 aa  DCD_CLAM3 RecName: Full=Deoxycytidine triphosphate deaminase;      
    1::170     4e-15  30%  176 aa  DCD_PYRAE RecName: Full=Probable deoxycytidine triphosphate
    4::182     4e-15  32%  192 aa  DCD_KOCRD RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     5e-15  33%  199 aa  DCD_NOCFA RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     5e-15  33%  190 aa  DCD_MYCTU RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     5e-15  33%  190 aa  DCD_MYCTA RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     5e-15  33%  190 aa  DCD_MYCBT RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     5e-15  33%  190 aa  DCD_MYCBP RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     5e-15  33%  190 aa  DCD_MYCBO RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::178     7e-15  35%  192 aa  DCD_SALAI RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::181     7e-15  31%  189 aa  DCD_RHOSR RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::181     7e-15  31%  189 aa  DCD_RHOOB RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     7e-15  33%  190 aa  DCD_MYCVP RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::178     7e-15  35%  190 aa  DCD_MYCPA RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::178     7e-15  35%  190 aa  DCD_MYCA1 RecName: Full=Deoxycytidine triphosphate deaminase;      
   35::179     7e-15  36%  195 aa  DCD_HALMA RecName: Full=Probable deoxycytidine triphosphate
    2::169     9e-15  34%  184 aa  DCD_SULSO RecName: Full=Probable deoxycytidine triphosphate
    1::170     9e-15  30%  176 aa  DCD_PYRIL RecName: Full=Probable deoxycytidine triphosphate
   19::170     9e-15  33%  176 aa  DCD_PYRCJ RecName: Full=Probable deoxycytidine triphosphate
   19::178     9e-15  35%  190 aa  DCD_MYCSS RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::178     9e-15  35%  190 aa  DCD_MYCSK RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::178     9e-15  35%  190 aa  DCD_MYCSJ RecName: Full=Deoxycytidine triphosphate deaminase;      
    4::178     9e-15  32%  189 aa  DCD_MYCS2 RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::182     9e-15  32%  190 aa  DCD_MYCGI RecName: Full=Deoxycytidine triphosphate deaminase;      
   31::172     9e-15  33%  181 aa  DCD_DESK1 RecName: Full=Probable deoxycytidine triphosphate
   19::178     1e-14  33%  201 aa  DCD_FRASN RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::178     1e-14  35%  192 aa  DCD_SALTO RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::169     2e-14  34%  177 aa  DCD_HYDS0 RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::182     2e-14  31%  192 aa  DCD_BEUC1 RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::171     3e-14  35%  198 aa  DCD_NANEQ RecName: Full=Probable deoxycytidine triphosphate
    2::166     4e-14  32%  180 aa  DCD_AQUAE RecName: Full=Deoxycytidine triphosphate deaminase;      
    2::183     6e-14  30%  194 aa  DCD_DICTD RecName: Full=Deoxycytidine triphosphate deaminase;      
   11::179     1e-13  31%  203 aa  DCD_HALLT RecName: Full=Probable deoxycytidine triphosphate
    7::156     2e-13  34%  158 aa  DUT_SIRV1 RecName: Full=Probable deoxyuridine 5'-triphosphate
   19::175     2e-13  32%  180 aa  DCD_IGNH4 RecName: Full=Probable deoxycytidine triphosphate
    1::179     2e-13  29%  206 aa  DCD_HALWD RecName: Full=Probable deoxycytidine triphosphate
   35::180     2e-13  30%  194 aa  DCD_DICT6 RecName: Full=Deoxycytidine triphosphate deaminase;      
   33::178     3e-13  31%  193 aa  DCD_MICLC RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::177     4e-13  32%  187 aa  DCD_METLZ RecName: Full=Probable deoxycytidine triphosphate
   34::184     5e-13  32%  193 aa  DCD_PROMH RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::178     6e-13  29%  196 aa  DCD_TROWT RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::178     6e-13  29%  196 aa  DCD_TROW8 RecName: Full=Deoxycytidine triphosphate deaminase;      
   11::177     6e-13  33%  183 aa  DCD_METB6 RecName: Full=Probable deoxycytidine triphosphate
    2::179     3e-12  31%  195 aa  DCD_NATPD RecName: Full=Probable deoxycytidine triphosphate
   33::177     3e-12  30%  185 aa  DCD_METHJ RecName: Full=Probable deoxycytidine triphosphate
   34::183     5e-12  32%  195 aa  DCD_HAEIN RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     7e-12  33%  193 aa  DCD_YERE8 RecName: Full=Deoxycytidine triphosphate deaminase;      
   35::178     7e-12  31%  197 aa  DCD_THERP RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::183     7e-12  31%  195 aa  DCD_HAEIE RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::183     7e-12  31%  195 aa  DCD_HAEI8 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::183     9e-12  32%  195 aa  DCD_HAEIG RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-11  33%  193 aa  DCD_YERPY RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-11  33%  193 aa  DCD_YERPS RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-11  33%  193 aa  DCD_YERPP RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-11  33%  193 aa  DCD_YERPN RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-11  33%  193 aa  DCD_YERPG RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-11  33%  193 aa  DCD_YERPE RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-11  33%  193 aa  DCD_YERPB RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-11  33%  193 aa  DCD_YERPA RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-11  33%  193 aa  DCD_YERP3 RecName: Full=Deoxycytidine triphosphate deaminase;      
   19::169     2e-11  30%  183 aa  DCD_SULTO RecName: Full=Probable deoxycytidine triphosphate
   34::184     2e-11  31%  199 aa  DCD_PSEA6 RecName: Full=Deoxycytidine triphosphate deaminase;      
    9::152     3e-11  35%  157 aa  DCD_THEGJ RecName: Full=Probable deoxycytidine triphosphate
   34::184     3e-11  31%  193 aa  DCD_PHOLL RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-11  31%  193 aa  DCD_SERP5 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-11  32%  193 aa  DCD_ERWT9 RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::184     3e-11  34%  198 aa  DCD_COLP3 RecName: Full=Deoxycytidine triphosphate deaminase;      
   77::179     6e-11  34%  195 aa  DCD_HALSA RecName: Full=Probable deoxycytidine triphosphate
   77::179     6e-11  34%  195 aa  DCD_HALS3 RecName: Full=Probable deoxycytidine triphosphate
   34::184     8e-11  33%  193 aa  DCD_SODGM RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::183     8e-11  29%  194 aa  DCD_PASMU RecName: Full=Deoxycytidine triphosphate deaminase;      
   26::152     1e-10  33%  155 aa  DCD_PYRKO RecName: Full=Probable deoxycytidine triphosphate
   67::169     1e-10  32%  177 aa  DCD_BACHD RecName: Full=Deoxycytidine triphosphate deaminase;      
   18::174     1e-10  31%  176 aa  DCD_STAMF RecName: Full=Probable deoxycytidine triphosphate
   26::152     1e-10  31%  156 aa  DCD_PYRHO RecName: Full=Probable deoxycytidine triphosphate
   34::189     1e-10  27%  194 aa  DCD_HAEPS RecName: Full=Deoxycytidine triphosphate deaminase;      
   26::152     2e-10  32%  156 aa  DCD_THESM RecName: Full=Probable deoxycytidine triphosphate
   34::184     2e-10  32%  193 aa  DCD_ERWCT RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-10  33%  193 aa  DCD_ENT38 RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::183     2e-10  29%  194 aa  DCD_SHEAM RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-10  32%  193 aa  DCD_PECCP RecName: Full=Deoxycytidine triphosphate deaminase;      
   26::152     4e-10  31%  156 aa  DCD_PYRFU RecName: Full=Probable deoxycytidine triphosphate
   29::184     4e-10  30%  194 aa  DCD_PSYIN RecName: Full=Deoxycytidine triphosphate deaminase;      
   31::174     4e-10  32%  176 aa  DCD_HYPBU RecName: Full=Probable deoxycytidine triphosphate
   34::183     4e-10  28%  194 aa  DCD_HAES2 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::183     4e-10  28%  194 aa  DCD_HAES1 RecName: Full=Deoxycytidine triphosphate deaminase;      
    4::159     5e-10  34%  195 aa  DCD_RHORT RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::183     5e-10  31%  194 aa  DCD_MANSM RecName: Full=Deoxycytidine triphosphate deaminase;      
   83::182     5e-10  36%  195 aa  DCD_IDILO RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     5e-10  31%  193 aa  DCD_HAMD5 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_SHISS RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_SHIFL RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_SHIF8 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_SHIBS RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_SHIB3 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_ESCF3 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_ECOSE RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_ECOLC RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_ECOL5 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_ECOHS RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_ECO8A RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_ECO81 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_ECO55 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_ECO27 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  31%  193 aa  DCD_ECO24 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     6e-10  32%  193 aa  DCD_CITK8 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::183     6e-10  29%  194 aa  DCD_ACTPJ RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::183     6e-10  29%  194 aa  DCD_ACTP7 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::183     6e-10  29%  194 aa  DCD_ACTP2 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     8e-10  31%  193 aa  DCD_EDWI9 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     8e-10  31%  193 aa  DCD_ECOLI RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     8e-10  31%  193 aa  DCD_ECODH RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     8e-10  31%  193 aa  DCD_ECOBW RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::146     8e-10  34%  194 aa  DCD_ACTSZ RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALTY RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALTI RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALSV RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALPK RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALPC RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALPB RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALPA RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALNS RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALHS RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALG2 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALEP RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALDC RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALCH RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALA4 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::183     1e-09  28%  194 aa  DCD_HAEDU RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::184     1e-09  33%  193 aa  DCD_TOLAT RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::146     1e-09  31%  194 aa  DCD_SHELP RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  193 aa  DCD_SALAR RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::185     1e-09  30%  193 aa  DCD_BUCAP RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  32%  193 aa  DCD_BAUCH RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     1e-09  31%  197 aa  DCD_ALTMD RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-09  31%  193 aa  DCD_KLEP7 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-09  31%  193 aa  DCD_KLEP3 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     2e-09  33%  193 aa  DCD_ENTS8 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-09  30%  193 aa  DCD_SHIDS RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-09  30%  193 aa  DCD_ECOUT RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-09  30%  193 aa  DCD_ECOSM RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-09  30%  193 aa  DCD_ECOLU RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-09  30%  193 aa  DCD_ECOL6 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-09  30%  193 aa  DCD_ECOK1 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-09  30%  193 aa  DCD_ECO7I RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-09  30%  193 aa  DCD_ECO5E RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-09  30%  193 aa  DCD_ECO57 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::184     3e-09  30%  193 aa  DCD_ECO45 RecName: Full=Deoxycytidine triphosphate deaminase;      
   26::152     4e-09  31%  154 aa  DCD_PYRAB RecName: Full=Probable deoxycytidine triphosphate
   29::146     7e-09  31%  193 aa  DCD_SHESW RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::146     7e-09  31%  193 aa  DCD_SHESM RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::146     7e-09  31%  193 aa  DCD_SHESA RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::146     7e-09  31%  193 aa  DCD_SHEPC RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::146     7e-09  31%  193 aa  DCD_SHEON RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::183     7e-09  29%  194 aa  DCD_SHEFN RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::183     7e-09  28%  193 aa  DCD_SHEB9 RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::183     7e-09  28%  193 aa  DCD_SHEB8 RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::183     7e-09  28%  193 aa  DCD_SHEB5 RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::183     7e-09  28%  193 aa  DCD_SHEB2 RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::184     7e-09  30%  193 aa  DCD_AERHH RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::182     9e-09  30%  194 aa  DCD_PSEHT RecName: Full=Deoxycytidine triphosphate deaminase;      
   29::146     1e-08  31%  193 aa  DCD_SHESR RecName: Full=Deoxycytidine triphosphate deaminase;      
    2::139     1e-08  33%  178 aa  DCD_AERPE RecName: Full=Probable deoxycytidine triphosphate
   29::184     2e-08  29%  193 aa  DCD_AERS4 RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::189     5e-08  30%  193 aa  DCD_BUCBP RecName: Full=Deoxycytidine triphosphate deaminase;      
   36::149     8e-08  29%  166 aa  DCD_THEAC RecName: Full=Probable deoxycytidine triphosphate
    2::149     1e-07  29%  173 aa  DCD_CLOAB RecName: Full=Deoxycytidine triphosphate deaminase;      
   34::185     5e-07  25%  193 aa  DCD_BUCAI RecName: Full=Deoxycytidine triphosphate deaminase;      
   71::182     9e-07  31%  194 aa  DCD_MARMS RecName: Full=Deoxycytidine triphosphate deaminase;      
   88::149     1e-06  38%  196 aa  DCD_WIGBR RecName: Full=Deoxycytidine triphosphate deaminase;      
    2::191     1e-06  30%  206 aa  DCD_METMP RecName: Full=Probable deoxycytidine triphosphate
   18::191     2e-06  28%  206 aa  DCD_METM5 RecName: Full=Probable deoxycytidine triphosphate
   18::191     3e-06  29%  206 aa  DCD_METM7 RecName: Full=Probable deoxycytidine triphosphate
   45::153     4e-06  27%  154 aa  DUT_METKA RecName: Full=Probable deoxyuridine 5'-triphosphate
   73::191     1e-05  29%  206 aa  DCD_METM6 RecName: Full=Probable deoxycytidine triphosphate
   37::191     1e-04  27%  206 aa  DCD_METVS RecName: Full=Probable deoxycytidine triphosphate
    1::188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSIKSDKWIRRMAEQHGMIEPFEPGQVRESDGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_RALME       MSIKSDKWIRRMAEQHGMIEPFEPGQVRESDGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_CUPTR       MSIKSDKWIRRMAEQHGMIEPFEPGQVREADGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_RALEJ       MSIKSDKWIRRMAEQHGMIEPFEPGQVREADGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_RALEH       MSIKSDKWIRRMAEQHGMIEPFAPGQVREQDGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_RALSO       MSIKSDKWIRRMAEQHGMIEPFEPGQVREADGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_RALPJ       MSIKSDKWIRRMAEQHGMIEPFEPDQVRESDGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_JANMA       MTIKSDKWIRRMAEQTGMIEPFEPGQVRQSNGQKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_POLSJ       MSIKSDKWIRRMAESTGMIEPFEPGQIREADGKKIISYGTSSYGYDIRCAPEFKVFTNIHSTVVDPKNFD
DCD_ACIAC       MSIKSDKWIRRMAEQHGMIEPFEPGQIRENDGRKIISYGTSSYGYDIRCAPEFKVFTNIHSTVVDPKHFD
DCD_VARPS       MSIKSDKWIRRMAEQNGMIEPFEPGQVREAAGHKIISYGTSSYGYDIRCAPEFKVFTNIHSTVVDPKNFD
DCD_HERAR       MTIKSDKWIRRMAQETGMIEPFEPGQVRQSNGQKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURP8       MSIKSDKWIRRMAEEHNMIEPFAPNQVRATDGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURXL       MTIKSDKWIRRMAESHKMIEPFAPDQVRVSDGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_LEPCP       MSIKSDKWIRRMAQESGMIEPFEPGQVRQSDGQKIVSYGTSSYGYDIRCAREFKVFTNIYSTVVDPKNFD
DCD_BURPP       MTIKSDKWIRRMAASHNMIEPFAPDQVRVSDGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_DIAST       MSIKSDKWIRRMAEQHGMIEPFEPGQIRQQDGRKIISYGTSSYGYDIRCAREFKVFTNIHSTVVDPKNFD
DCD_ACISJ       MSIKSDKWIRRMAEQHGMIEPFEPGQIRQQDGRKIISYGTSSYGYDIRCAREFKVFTNIHSTVVDPKNFD
DCD_BURVG       MSIKSDKWIRRMAEEHKMIEPFVPDQVRASDGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURS3       MSIKSDKWIRRMAEEHKMIEPFVPDQVRASDGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURPS       MSIKSDKWIRRMAEEHKMIEPFVPDQVRAADGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURP6       MSIKSDKWIRRMAEEHKMIEPFVPDQVRAADGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURP0       MSIKSDKWIRRMAEEHKMIEPFVPDQVRAADGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURMS       MSIKSDKWIRRMAEEHKMIEPFVPDQVRAADGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURMA       MSIKSDKWIRRMAEEHKMIEPFVPDQVRAADGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURM9       MSIKSDKWIRRMAEEHKMIEPFVPDQVRAADGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURM7       MSIKSDKWIRRMAEEHKMIEPFVPDQVRAADGRKIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURM1       MSIKSDKWIRRMAEEHKMIEPFVPDQVRASDGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURCM       MSIKSDKWIRRMAEEHKMIEPFVPDQVRASDGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURCJ       MSIKSDKWIRRMAEEHKMIEPFVPDQVRASDGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURCH       MSIKSDKWIRRMAEEHKMIEPFVPDQVRASDGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURCC       MSIKSDKWIRRMAEEHKMIEPFVPDQVRASDGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURCA       MSIKSDKWIRRMAEEHKMIEPFVPDQVRASDGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_BURA4       MSIKSDKWIRRMAEEHKMIEPFVPDQVRASDGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_RHOFD       MTIKSDKWIRRMAQQHGMIEPFEPGQIRQANGNKIVSYGTSSYGYDIRCAPEFKVFTNIHSTVVDPKNFD
DCD_BURTA       MSIKSDKWIRRMAEEHKMIEPFVPDQVRAADGRRIVSYGTSSYGYDIRCADEFKIFTNINSTIVDPKNFD
DCD_DECAR       MTIKSDKWIRRMAAEHGMIEPFSPELVREANGQKIVSYGTSSYGYDIRCAREFKVFTNINSTVVDPKNFD
DCD_BORPA       MSIKSDRWIRRAAEA-GMIEPFEPGQVRTAGGNRIVSYGTSSYGYDVRCADEFKIFTNINSTIVDPKQFD
DCD_BORBR       MSIKSDRWIRRAAEA-GMIEPFEPGQVRTAGGNRIVSYGTSSYGYDVRCADEFKIFTNINSTIVDPKQFD
DCD_BORPE       MSIKSDRWIRRAAEA-GMIEPFEPGQVRTAGGNRIVSYGTSSYGYDVRCADEFKIFTNINSTIVDPKQFD
DCD_BORPD       MSIKSDRWIRRAAEA-GMIEPFEAGQVRTANGGRIVSYGTSSYGYDVRCADEFKIFTNINSTIVDPKQFD
DCD_CELJU       MSIKSDKWMRRMVEQYGMIEPYEPGQVRDAAGHKIVSYGTSSYGYDVRCADEFKIFTNVHSTVVDPKNFD
DCD_BORA1       MSIKSDRWIRRAAEG-GMIEPFEAGQVRTVNGGRIVSYGTSSYGYDVRCADEFKIFTNINSTIVDPKNFD
DCD_THISH       MSIKSDRWIRRMAEQHGMIEPFEPGQVRHAGEERIVSYGTSSYGYDVRCADEFKIFTNINSSIVDPKAFD
DCD_NITEC       MSIKSDKWIRRMAAEYGMIEPFEPGQVKQKDGHSIVSYGTSSYGYDIRCSDEFKLFTNLNSTIVDPKRFD
DCD_NEIMB       MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGKRIISYGTSSYGYDIRCANEFKIFTNINSTIVDPKNFD
DCD_NEIMA       MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGKRIISYGTSSYGYDIRCANEFKIFTNINSTIVDPKNFD
DCD_NEIG2       MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGQRIISYGTSSYGYDIRCANEFKIFTNINSTIVDPKNFD
DCD_NEIG1       MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGQRIISYGTSSYGYDIRCANEFKIFTNINSTIVDPKNFD
DCD_NEIMF       MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGKRIISYGTSSYGYDIRCANEFKIFTNINSTIVDPKNFD
DCD_NEIM0       MSIKSDKWIRRMSEEFGMIDPFEPNQIKEADGKRIISYGTSSYGYDIRCANEFKIFTNINSTIVDPKNFD
DCD_NITMU       MTIKSDKWIRRMAMEHGMIEPFEPNQVKHADGHKIVSYGTSSYGYDIRCSDEFKLFTNINSAIVDPKNFD
DCD_TERTT       MSIKSDKWIRRMAEQEGMIEPFEPGQIRDSNNQKLVSYGTSSYGYDVRCAREFKIFTNVHSAVVDPKNFD
DCD_NITEU       MSIKSDKWIRRMAAEYNMIEPFEPNQIKQRNGESIVSYGTSSYGYDIRCSDEFKLFTNLNSTIVDPKRFD
DCD_MARAV       MSIKSDKWIRRMSEQHGMIEPFEAGQVRESEKGRVISYGTSSYGYDVRCSNEFKIFTNVHSATVDPKNFD
DCD_LARHH       MSIKSDKWIRRMAAEYDMISPFEPDLVRQVNGEKVISFGTSSYGYDIRCADEFKVFTNINSTMVDPKNFD
DCD_NITOC       MSIKSDKWIRYMAQAHGIIEPFEPRQIREANNARIISYGTSSYGYDIRCSNEFKIFTNINSAVVDPKNFD
DCD_THIDA       MSIKSDRWIRRMAAEHGMIEPFEAGQIKQAAGRSIVSYGTSSYGYDVRCASEFKLFTDINTTIVDPKAFD
DCD_AZOSB       MSIKSDKWIRRMAEQQGMIAPFAPELVRSNEGGKIVSYGTSSYGYDVRCANEFKIFTNINSTIVDPKDFD
DCD_FRATW       MTIKSDKWIKKMSQEHNMIEPFEAGQVKVINNQKIVSYGTSSYGYDVRCADEFKIFTNINSSIVDPKNFN
DCD_FRATT       MTIKSDKWIKKMSQEHNMIEPFEAGQVKVINNQKIVSYGTSSYGYDVRCADEFKIFTNINSSIVDPKNFN
DCD_FRATO       MTIKSDKWIKKMSQEHNMIEPFEAGQVKVINNQKIVSYGTSSYGYDVRCADEFKIFTNINSSIVDPKNFN
DCD_FRATN       MTIKSDKWIKKMSQEHNMIEPFEAGQVKVINNQKIVSYGTSSYGYDVRCADEFKIFTNINSSIVDPKNFN
DCD_FRATM       MTIKSDKWIKKMSQEHNMIEPFEAGQVKVINNQKIVSYGTSSYGYDVRCADEFKIFTNINSSIVDPKNFN
DCD_FRATH       MTIKSDKWIKKMSQEHNMIEPFEAGQVKVINNQKIVSYGTSSYGYDVRCADEFKIFTNINSSIVDPKNFN
DCD_FRATF       MTIKSDKWIKKMSQEHNMIEPFEAGQVKVINNQKIVSYGTSSYGYDVRCADEFKIFTNINSSIVDPKNFN
DCD_FRAT1       MTIKSDKWIKKMSQEHNMIEPFEAGQVKVINNQKIVSYGTSSYGYDVRCADEFKIFTNINSSIVDPKNFN
DCD_FRAP2       MTIKSDKWIKKMSQEYNMIEPFEAGQIKVSNNQKIVSYGTSSYGYDVRCADEFKIFTNINSSIVDPKNFN
DCD_AZOSE       MSIKSDKWIRRMAEQQGMIAPFAPELVRHNGTGKIVSYGTSSYGYDVRCANEFKIFTNINSTIVDPKDFD
DCD_CHRVO       MSIKSDKWIRRMADQHGMIEPFEANQVKAADGQKLISYGTSSYGYDIRCADEFKVFTNINSTIVDPKNFD
DCD_PSYA2       MSIKSDRWIRKMAEEHGMIEPFEAGQVRFNDGERLVSYGTSSYGYDVRCAPEFKVFTNVHSVIVDPKNFD
DCD_CHRSD       MSIKSDKWIRRMAEREGMIEPFEEDQVRYVNERRVISYGTSSYGYDVRCADEFKVFTNIHSAVVDPKGFD
DCD_PSYCK       MSIKSDRWIRKMAEEHGMIEPFEAGQVRFNDGERLVSYGTSSYGYDVRCAPEFKVFTNVHSVIVDPKNFD
DCD_PSEMY       MSIKSDKWIRRMAQEHGMIEPFVERQVRGADSSRVISYGVSSYGYDVRCADEFKVFTNIHSAIVDPKNFD
DCD_XANC5       MSIKSDRWIKRMAEQHAMIEPFEPGQVKDAAGQRIVSFGTSSYGYDVRCSREFKVFTNINSTIVDPKHFD
DCD_PSYWF       MSIKSDRWIRKMAEEHGMIEPYEPGQVRFNEGDKLVSYGTSSYGYDVRCAREFKVFTNVHSAIVDPKNFD
DCD_XANAC       MSIKSDRWIKRMAEQHAMIEPFEPGQIKDAAGQRIVSFGTSSYGYDVRCSREFKVFTNINSTIVDPKHFD
DCD_PSESM       MSIKSDKWIRRMAQEHGMIEPFVERQVRGEGANRVISFGVSSYGYDVRCADEFKVFTNINSATVDPKNFD
DCD_ACIBT       MAIKSDRWIREMSEKHGMIEPYAENQVRDKNGEKLISYGVSSYGYDVRCAREFKVFTNVHSAIVDPKNFD
DCD_XANCP       MSIKSDRWIKRMAEQHAMIEPFEPGQIKDAAGQRIVSFGTSSYGYDVRCSREFKIFTNINSTIVDPKHFD
DCD_XANCB       MSIKSDRWIKRMAEQHAMIEPFEPGQIKDAAGQRIVSFGTSSYGYDVRCSREFKIFTNINSTIVDPKHFD
DCD_XANC8       MSIKSDRWIKRMAEQHAMIEPFEPGQIKDAAGQRIVSFGTSSYGYDVRCSREFKIFTNINSTIVDPKHFD
DCD_ACIBY       MAIKSDRWIREMSEKHGMIEPYAENQVRDKNGEKLISYGVSSYGYDVRCAREFKVFTNVHSAIVDPKNFD
DCD_ACIBS       MAIKSDRWIREMSEKHGMIEPYAENQVRDKNGEKLISYGVSSYGYDVRCAREFKVFTNVHSAIVDPKNFD
DCD_ACIBC       MAIKSDRWIREMSEKHGMIEPYAENQVRDKNGEKLISYGVSSYGYDVRCAREFKVFTNVHSAIVDPKNFD
DCD_ACIB5       MAIKSDRWIREMSEKHGMIEPYAENQVRDKNGEKLISYGVSSYGYDVRCAREFKVFTNVHSAIVDPKNFD
DCD_ACIB3       MAIKSDRWIREMSEKHGMIEPYAENQVRDKNGEKLISYGVSSYGYDVRCAREFKVFTNVHSAIVDPKNFD
DCD_PSEU2       MSIKSDKWIRRMAQEHGMIEPFVERQVRGEGADRVISFGVSSYGYDVRCADEFKVFTNINSATVDPKNFD
DCD_PSE14       MSIKSDKWIRRMAQEHGMIEPFVERQVRGEGADRVISFGVSSYGYDVRCADEFKVFTNINSATVDPKNFD
DCD_STRM5       MSIKSDRWIRRMSEQHGMIEPFEAGQVKQANGERIVSYGTSSYGYDVRCSREFKVFTNINSTIVDPKHFD
DCD_METCA       MGIKSDRWIRKMAREHGMIEPFEPHQVRHGDCSSVISYGTSSYGYDVRCSNEFKIFTNINSAIVDPKNFD
DCD_XANOR       MSIKSDRWIKRMAEQHAMIAPFEPGQIKDAAGQRIVSFGTSSYGYDVRCSREFKIFTNINSTIVDPKRFD
DCD_XANOP       MSIKSDRWIKRMAEQHAMIAPFEPGQIKDAAGQRIVSFGTSSYGYDVRCSREFKIFTNINSTIVDPKRFD
DCD_XANOM       MSIKSDRWIKRMAEQHAMIAPFEPGQIKDAAGQRIVSFGTSSYGYDVRCSREFKIFTNINSTIVDPKRFD
DCD_STRMK       MSIKSDRWIRRMSEQHGMIEPFEAGQVKQANGERIVSYGTSSYGYDVRCSREFKVFTNINSTIVDPKHFD
DCD_ALCBS       MTIKSDRWISRMAAEKGMIEPFQPGQVRDENGEKLISYGVSSYGYDVRCADEFKVFTNIHSATVDPKAFD
DCD_HALHL       MTIKSDRWIRHMAQEHGMIEPFEPGQVRDTEGQRVISYGTSSYGYDVRCGKDFKIFTDINSAVVDPKNFD
DCD_ACIAD       MAIKSDRWIREMSEKHGMIEPYAENQVRNAQGEKLISYGVSSYGYDVRCAPEFKVFTNVHSAIVDPKNFD
DCD_PSEFS       MSIKSDKWIRRMAQEHGMIEPFVERQIRGEGDERVISYGVSSYGYDVRCADEFKVFTNINSAIVDPKNFD
DCD_PSEAE       MTIKSDKWIRRMAQEHGMIEPFVERQVRGADDSRVISYGVSSYGYDVRCAAEFKVFTNIHSAVVDPKNFD
DCD_PSEAB       MTIKSDKWIRRMAQEHGMIEPFVERQVRGADDSRVISYGVSSYGYDVRCAAEFKVFTNIHSAVVDPKNFD
DCD_PSEA8       MTIKSDKWIRRMAQEHGMIEPFVERQVRGADDSRVISYGVSSYGYDVRCAAEFKVFTNIHSAVVDPKNFD
DCD_PSEA7       MTIKSDKWIRRMAQEHGMIEPFVERQVRGADDSRVISYGVSSYGYDVRCAAEFKVFTNIHSAVVDPKNFD
DCD_PSEPW       MSIKSDKWIRRMAQEHGMIEPFVERQVRGEHDSRVISFGVSSYGYDVRCADEFKVFTNINSATVDPKNFD
DCD_PSEPK       MSIKSDKWIRRMAQEHGMIEPFVERQVRGEQDNRVISFGVSSYGYDVRCADEFKVFTNINSATVDPKNFD
DCD_PSEP1       MSIKSDKWIRRMAQEHGMIEPFVERQVRGEQDNRVISFGVSSYGYDVRCADEFKVFTNINSATVDPKNFD
DCD_PSEPG       MSIKSDKWIRRMAQEHGMIEPFVERQVRGEQDSRVISFGVSSYGYDVRCADEFKVFTNINSATVDPKNFD
DCD_AZOVD       MTIKSDKWIRRMAREQGMIEPFVERQVRTEGSERLISYGVSSYGYDVRCADEFKVFTNIHSATVDPKNFD
DCD_COXBU       MPIKSDKWIRRMAESHQLIYPFEPKQVRETPSGKVISYGTSSYGYDVRCADEFKIFTNINASIVDPKNFD
DCD_COXBR       MPIKSDKWIRRMAESHQLIYPFEPKQVRETPSGKVISYGTSSYGYDVRCADEFKIFTNINASIVDPKNFD
DCD_COXBN       MPIKSDKWIRRMAESHQLIYPFEPKQVRETPSGKVISYGTSSYGYDVRCADEFKIFTNINASIVDPKNFD
DCD_COXB2       MPIKSDKWIRRMAESHQLIYPFEPKQVRETPSGKVISYGTSSYGYDVRCADEFKIFTNINASIVDPKNFD
DCD_COXB1       MPIKSDKWIRRMAESHQLIYPFEPKQVRETPSGKVISYGTSSYGYDVRCADEFKIFTNINASIVDPKNFD
DCD_XYLFT       MSIKSDRWIRHMAKQHGMIAPFEPGQIKQNTGQRIVSYGTSSYGYDVRCSHEFKIFTNINSTIVDPKQFD
DCD_XYLF2       MSIKSDRWIRHMAKQHGMIAPFEPGQIKQNTGQRIVSYGTSSYGYDVRCSHEFKIFTNINSTIVDPKQFD
DCD_SACD2       MSIKSDKWIRRMAENEGMIDPFEPGQVRNADEQRLISYGTSSYGYDVRCADEFKIFTNVHSAIVDPKNXX
DCD_XYLFM       MSIKSDRWIRHMAKQHGMIAPFEPGQIKQNTGQRIVSYGTSSYGYDVRCSREFKIFTNINSTIVDPKQFD
DCD_XYLFA       MSIKSDRWIRHMAQQHGMIAPFEPGQIKQNTGQRIVSYGTSSYGYDVRCSREFKIFTNINSTIVDPKQFD
DCD_PSEPF       MSIKSDKWIRRMAQEHGMIEPFVERQVRGSDDSRVISYGVSSYGYDVRCTNHFKVFTNINSAIVDPKNFD
DCD_LEGPL       MSIKSDRWIEKMALEHGMISPFQAGQVRENQNGRIISYGVSSYGYDVRCSNEFKIFTNINSAIVDPKAFD
DCD_LEGPH       MSIKSDRWIEKMALEHGMISPFQAGQVRENQNGRIISYGVSSYGYDVRCSNEFKIFTNINSAIVDPKAFD
DCD_LEGPA       MSIKSDRWIEKMALEHGMISPFQAGQVRENQNGRIISYGVSSYGYDVRCSNEFKIFTNINSAIVDPKAFD
DCD_ACIF5       MSIKSDRWIRHMAEEHGMIEPFSPRQVRHVEXXXXXXXXXXXXXXXXRCAGEFKVFTNVRSVIVDPKNFS
DCD_ACIF2       MSIKSDRWIRHMAEEHGMIEPFSPRQVRHVEXXXXXXXXXXXXXXXXRCAGEFKVFTNVRSVIVDPKNFS
DCD_ACIBL       MAIKSDRWIRRMAQEHDMINPFYEKQMRQG----VISYGLSSYGYDLRVADEFKIFTNVNNAIVDPKHFD
DCD_DICNV       MSIKNDKWIRRMAEQHKMIEPFAPHLVSRCDERXXXXXXXXXXXXDVRCADEFKIFTNINSAIVDPKQFD
DCD_CHLFF       MSIKEDKWIRKMAQTHGMIEPFADGQVNAETGEKLISYGLSSYGYDLRLSREFKVFTNVYNSLVDPKHFT
DCD_CHLAB       MSIKEDKWIRKMALAHGMIEPFADGQVNPETGEKLISYGLSSYGYDLRLSREFKVFTNVYNSLVDPKRFT
DCD_CHLCV       MSIKEDKWIRKMALAHGMIEPFADGQVNAETGEKLISYGLSSYGYDLRLSREFKVFTNVYNSLVDPKHFT
DCD_NITSB       MGLKADCWIRQKAVEDGMIEPFCEDQI----GKGVVSYGLSSYGYDIRVSDEFKIFTNVNAEVVDPKHFD
DCD_CAMHC       MGLKSDKWIREQSIKNGMITPF----CEENMGVGVVSYGLSSYGYDIRVADEFKIFTNVGGTVVDPKNFD
DCD_GEMAT       MGLCSDRWITRMSREHGMIEPFEDRQVRQG----VISYGVSSYGYDMRVAREFKIFTNVLSSVVDPKAFD
DCD_ACIC5       MSIKSDRWIREQALK-GMIEPFSEKQVREG----VISYGLSSYGYDLRVSNEFKIFTNVNSAIIDPKNFD
DCD_RICBR       MSIMSDKWIREAVINHKMIEPFAEKQVRVKDSEKIISYGLSSYGYDARVSNEFKIFTNINSTMVDPKNFD
DCD_RICB8       MSIMSDKWIREAVINHKMIEPFAEKQVRVKDSEKIISYGLSSYGYDARVSNEFKIFTNINSTMVDPKNFD
DCD_WOLSU       MGLKEDRWITDMALPHNMIEPFCENQV----GKNVVSYGLSSYGYDIRVSNEFKIFTNINATVVDPKNFD
DCD_RICRS       MAIMSDKWIKEAVINHSMIRPFAEKQVRVHNKEKIISYGLSSYGYDARVSNEFKIFTNINSTTVDPKNFS
DCD_RICPU       MAIMSDKWIKEAVINHSMIRPFAEKQVRVHNKEKIISYGLSSYGYDARVSNEFKIFTNINSTTVDPKNFS
DCD_RICCN       MAIMSDKWIKEAVINHSMIRPFAEKQVRVHNKEKIISYGLSSYGYDARVSNEFKIFTNINSTTVDPKNFS
DCD_RICAE       MAIMSDKWIKEAVINHSMIRPFAEKQVRVHNKEKIISYGLSSYGYDARVSNEFKIFTNINSTTVDPKNFS
DCD_MAGSA       MSVMPDTWIREMAKTKGMIEPFTEKQQRAG----VISYGVSSYGYDARVSREFKIFTNVDSAVVDPKSFS
DCD_SPHAL       MAILSDRWIREAARTQGMIEPFVEAQRRDG----CISYGLSSYGYDARVAPEFKIFTNVDSTIVDPKDFD
DCD_CHLMU       MGIKEDNWIRKMAIEEGMIEPFADNQVKPETGEKLISYGLSSYGYDLRISREFKVFTNIYNSLVDPKCFT
DCD_CHLPN       MSIKEDKWIREMALNADMIHPFVNGQVNEETGEKLISYGLSSYGYDLRLSREFKVFTNVYNSVVDPKCFT
DCD_RICFE       MAIMSDKWIKEAVINQSMIRPFAEKQVRVHNKEKIISYGLSSYGYDARVSNEFKIFTNINSTTVDPKNFS
DCD_RICAH       MAIMSDKWIKEAVINQSMISPFAEKQVRVHNKEKIISYGLSSYGYDARVSNEFKIFTNINSTTVDPKNFS
DCD_CHLTR       MGIKEDNWIRKMAIEEGMIEPFADSQVKPETGEKLISYGLSSYGYDLRISREFKVFTNVYNSLVDPKCFT
DCD_CHLTB       MGIKEDNWIRKMAIEEGMIEPFADSQVKPETGEKLISYGLSSYGYDLRISREFKVFTNVYNSLVDPKCFT
DCD_CHLTA       MGIKEDNWIRKMAIEEGMIEPFADSQVKPETGEKLISYGLSSYGYDLRISREFKVFTNVYNSLVDPKCFT
DCD_CHLT2       MGIKEDNWIRKMAIEEGMIEPFADSQVKPETGEKLISYGLSSYGYDLRISREFKVFTNVYNSLVDPKCFT
DCD_METI4       MGVHSDDWIRQMVKKHRMIEPFEESQVRKKDGSQVISFGLSSYGYDLRVSREFKIFTNVFNSVVDPKAFD
DCD_NAUPA       MGVKSDIWIRNMAKNFNMISPFEEKQVRKG----IISYGVSSYGYDIRVSDEFMVFTNINSTVVDPKNFD
DCD_GRABC       MSIMPDHWIRQMATGHGMIEPFVETQKRDG----VISYGLSSYGYDARVADEFKIFTNVDSAVVDPKAFS
DCD_CAMFF       MGLKSDKWIREQSIENQMIEPF----CEENIGKGVVSYGLSSYGYDIRVGCEFKIFTNIGGTVVDPKNFD
DCD_RICCK       MAIMSDKWIKEAVINQSMIKPFVEKQVRVHNKDKIISYGLSSYGYDARVSNEFKIFTNINSTTVDPKNFS
DCD_SULNB       MGLKPDKWIREKSLNEAMITPFCEGLV----GEGVVSYGLSSYGYDIRVSDEFKIFTNINAEVVDPKDFN
DCD_SPHWW       MTIMSDKWIREQATKNGMIEPFVEAQRRDG----CISYGLSSYGYDARVAPEFKIFTNVDSATVDPKDFA
DCD_RICPR       MAIMSDKWIKDAVMNQNMIRPFAAKQVRVHNKEKIISYGLSSYGYDARVSNEFKIFTNINSTTVDPKNFS
DCD_RICTY       MTIMSDKWIKDAVIKQSMIRPFAEKQVRVHNKEKIISYGLSSYGYDARVSNEFKIFTNINSTTVDPKNFS
DCD_CAMJE       MGLKADNWIRKMALEHKMIEPFCEANI----GKGVVSYGLSSYGYDIRVGREFKIFTNVNSTVVDPKNFV
DCD_HERA2       MSIKADRWIKRMAQEHGMIEPFVDGQXXXXXXXXXXXXXXX----DIRIADEFKIFTNVNSAIIDPKNFD
DCD_CAMLR       MGLKADNWIKKMALEHNMIEPFCEANI----GKGIVSYGLSSYGYDIRVGREFKIFTNVNSTVVDPKNFV
DCD_NOVAD       MAILSDKWIRDKALNEGMIEPFVENQRRDG----CISYGLSSYGYDARVAPEFKIFTNVDSAVVDPKDFA
DCD_CAMJR       MGLKADNWIRKMALEHKMIEPFCEANI----GKGVVSYGLSSYGYDIRVGREFKIFTNVNSTVVDPKNFV
DCD_RHOCS       MPIMPDTWIREMATTKGMIEPFTEAQKREG----VISYGLSSYGYDARVADEFKIFTNVDNAIVDPKQFD
DCD_CAMJD       MGLKADNWIRKMALEHKMIEPFCEANI----GKGVVSYGLSSYGYDICVGREFKIFTNVNSTVVDPKNFV
DCD_CAMJ8       MGLKADNWIRKMALERKMIEPFCEANI----GKGVVSYGLSSYGYDIRVGREFKIFTNVNSTVVDPKNFV
DCD_ERYLH       MAILSDKWIREAAQTRGMIEPFEEAQRRDG----CISYGLSSFGYDARVAPEFKIFTNVNSAVVDPKDFD
DCD_CHLSY       MPIKSDRWIRRMALEHGMIEPFVDHQVR----RGVISYGLTSYGYDMRVTDHFKVFTNVYNALVDPKQFD
DCD_CHLAA       MPIKSDRWIRRMALEHGMIEPFVDHQVR----RGVISYGLTSYGYDMRVTDHFKVFTNVYNALVDPKQFD
DCD_CHLAD       MPVKSDRWIRRMALEHGMIEPFVDHQVRKG----VISYGLTSYGYDMRVTNHFKVFTNVYNALVDPKKFD
DCD_PARUW       MSICSDNWIIEKCLKEKMIEPFVDKQVRFENGEKIISYGVSSYGYDIRVSNQFQIFTNVYGSIVDPKQFD
DCD_ACICJ       MPVMPDHWIREQAVSNGMIDPFVETQKRDG----VISYGLSSYGYDARVADDFKIFTNVDSAVVDPKNFS
DCD_CAMC5       MGLKSDAWIRKMSHEKAMIVPFAEEQV----GRXXXXXXXXXXXXDIRVGDEFKIFTNIGGTVVDPKNFD
DCD_WOLWR       MAVMPDKWIREKAENFGMIEPF----VNHKSSKGVISFGLSSYGYDARVDNKFKIFTNVNSAIVDPKNFS
DCD_WOLPM       MAVMPDKWIREKAENFGMIEPF----VNHKSSKGVISFGLSSYGYDARVDNKFKIFTNVNSAIVDPKNFS
DCD_CAMC1       MGLKSDSWIRKMSVEKKMIVPFAEEQV----GRXXXXXXXXXXXXDIRVGDEFKIFTNIGGTVVDPKNFD
DCD_ORITB       MSIMSDNWIKKMAESKNMISPFVDKQVRARNNQQILSYGLSSYGYDARVSNEFKIFTNTKPSIIDPKKFD
DCD_WOLPP       MAVMPDKWIREKAENSRMIEPF----VNHKSSKGVVSFGLSSYGYDARVDNKFKVFTNVNSAIVDPKNFS
DCD_ORITI       MSIMSDNWIKKMAESENMISPFVDKQVRTHNNQHILSYGLSSYGYDARVSNEFKIFTNTKPSIIDPKKFD
DCD_GLUOX       MPIMPDTWIRQMAREKGMIEPFVEAQKREG----VISYGLSSYGYDARVAEEFKIFTDVDSAIVDPKNFA
DCD_WOLTR       MAVMPDKWIREKAESFGMIEPF----VDHKSSKGVMSFGLSSYGYDARVDNKFKIFTNVNSAVVDPKDFS
DCD_ANAPZ       MSVMPDHWIKERALKDGMISPF----VDHKEGTGVLSYGLSSYGYDARLDNKFKIFANTHSVVVDPKNFS
DCD_HELAH       MGLKADSWIKKMSLEHGMISPFCEKQV----GKNVISYGLSSYGYDIRVGGEFMLFDNKNA-LIDPKNFD
DCD_ROSCS       MTIKSDRWIQVMAREYGMIEPFVAEQVRXXXXXXXXXXXXX----DMRVADEFKVFTNVFNTLVDPKHFD
DCD_HELPJ       MGLKADSWIKKMSLEHGMINPFCEKQV----GKNVISYGLSSYGYDIRVGSEFMLFDNKNA-LIDPKNFD
DCD_NEOSM       MPVMPDQWIKSKALESRMIEPFVSSKISTG----VISYGLSSYGYDARVSNKFKIFTNLAVSQVDPKNFD
DCD_HELPY       MGLKADSWIKKMSLEHGMISPFCEKQV----GKNVISYGLSSYGYDIRVGSEFMLFDNKNA-LIDPKNFD
DCD_HELPS       MGLKADSWIKKMSLEHGMISPFCEKQI----GKDVISYGLSSYGYDIRVGSEFMLFDNKNA-LIDPKNFD
DCD_HELPG       MGLKADSWIKKMSLEHGMISPFCEKQV----GKNVISYGLSSYGYDIRVGSEFMLFDNKNA-LIDPKNFD
DCD_HELP2       MGLKADSWIKKMSLEHGMISPFCEKQV----GKNVISYGLSSYGYDIRVGSEFMLFDNKNA-LIDPKNFD
DCD_HELHP       MGLKSDTWIKKMSKK-GMIEPFCEKQV----GKNIVSYGLSSYGYDIRVGNEFMIFTNIGANLVDPKSFD
DCD_ANAMM       MSAMPDHWIKEKALKEGMISPF----VDHKEEAGVLSYGLSSYGYDARVDSKFKIFANTHSSIVDPKNFP
DCD_ANAMF       MSAMPDHWIKEKALKEGMISPF----VDHKEEAGVLSYGLSSYGYDARVDSKFKIFANTHSSIVDPKNFP
DCD_PELUB       MSVLSDKSIRKLAVEQSMISPFIDKQVR--DGK--ISYGLSSFGYDARVGDEFKIFHNVNSSIVDPKEFS
DCD_EHRCJ       MSVMPDHWIKDKAIQEKMIDPF----IDYKEXXXXXXXXXXXXXXDARIDNKFKIFTNINPVTVDPKNFP
DCD_CORK4       --ILSDRDIRSAIDSHLGISPFDPTMVQPSS-------------IDVRLDRYFRVFNNARYTHIDPKQEQ
DCD_METS3       MAILSDKTIKEYLEEGKIIDPLKDEQQIQPSS------------VDMRLGDEFKVFKVIRKPYIDPK--D
DCD_CORGL       ----SDRDIRKSIDAGDLIEPFDAELIQPSS-------------VDVRMDRYFRVFNNSKYTHIDPKNQD
DCD_CORGB       ----SDRDIRKSIDAGDLIEPFDAELIQPSS-------------VDVRMDRYFRVFNNSKYTHIDPKNQD
DCD_COREF       ----SDRDIRKSIDSGDLIDPFDPLLIQPSS-------------IDVRMDRYFRVFNNSKYTHIDPKNQD
DCD_BIFAA       ------------ADGHISLDPWTPEMVQPAS-------------IDVRLDRFFRLFNNHAYTYVDPAENQ
DCD_CLOTH       --ILSDKTILKMAEKTLIIEPLEKEQIQPAS-------------VDIRLGNTFSIVEDSCTGIINLEK--
DCD_KORCO       ----SDKAIRSLIREGKLIDPLYEDSIREN-------------GVDMRIGPEIA-FPIVRGEVMDPTKDD
DCD_CORDI       ----SDKDIRVAIDAGELIEPFDADLIQPSS-------------IDVRMDRLFRVFNNSKYTHIDPKQQQ
DCD_BIFLO       ---------------------------------------------DVRLDRYFRLFNNHAYTYVDPAENQ
DCD_BIFLI       ---------------------------------------------DVRLDRYFRLFNNHAYTYVDPAENQ
DCD_BIFLD       ---------------------------------------------DVRLDRYFRLFNNHAYTYVDPAENQ
DCD_CALMQ       ------------------IEPFTEDVVREN-------------GLDLRVGNEYAIYAFENQ-VIDPCELE
DCD_CORJK       ---------------------------------------------DVRLDGLFRVFNNSKYTHIDPKQPQ
DCD_BIFA0       ----SDRDIRAAAEGHISLDPWTDEMVQPAS-------------IDVRLDRFFRLFNNHAYTYVDPAENQ
DCD_LEIXX       ------------------LEPFEQGMIQPSS-------------VDVRLDRFFRLFDNHKYPFIDPAEDD
DCD_ARTCA       ----SDRDIREIDSQRIVLEPFEPAMVQPSS-------------VDVRIDKFFRLFDNHKYAHIDPAQEQ
DCD_METST       ---------------------------------------------DLRLGDQFKGFKIITKPYIDP--FD
DCD_PERMH       --ILNDRKIRELIESKELIDPLDAVQIQPSS-------------VDLRLGNDFLIYPE-DIEILDVRNPD
DCD_ACIC1       ----SDRDIRELASGRVTIDPFDPAMIQPSS-------------IDVRLDKYFRVFENHRYPHIDPEQPD
DCD_NOCSJ       ------------------LEPYDPGMLQPSS-------------IDVRLDRFFRVFENHKYPHIDPAQSD
DCD_METS5       ------KWI--------LVDPLTEDSVREN-------------GIDMRVGGEIARFKNVDRPFEEGMNPD
DCD_RENSM       ----SDRDIRTQIDSGRIVDPFEPSMVQPSS-------------VDVRIDKLFRLFDNHKYAHIDPAEEQ
DCD_THEFY       ----SDRDLRAAIESGRVLDPYDPELVQPSS-------------IDVRLDRYFRVFENHKYPHIDPEQPG
DCD_ACIAM       -------------------------------------------GVDLRVGGEIARFKKTDEIYEDGK--D
DCD_STRCO       ----SDKDIRAEIDNGRVIDPFDDSMVQPSS-------------IDVRLDRYFRVFENHRYPHIDPEQVD
DCD_MYCMM       ------------------IDPFDDSLVQPSS-------------VDVRLDCMFRVFNNTRYTHIDPQRQD
DCD_METMJ       ----------RIRRGHIRVDPFEPGLIQPNS-------------LDIRLGSHFVWYVP-GETVIDPYDSE
DCD_CLAMS       ------------------LDPYDPGMLQPAS-------------IDVRIDRFFRLFDNHKYPYIDPAEDQ
DCD_ARTAT       ----SDRDIREIDSQRIVLEPYDPAMVQPSS-------------VDVRIDRFFRLFDNHKYAHIDPAEEQ
DCD_STRAW       ----SDKDIRAEIDAGRVIDPYDESMVQPSS-------------IDVRLDRYFRVFENHRYPHIDPEQAD
DCD_MYCUA       ------------------IDPFDDSLVQPSS-------------VDVRLDCMFRVFNNTRYTHIDPAQRQ
DCD_METKA       MTVLSDRDIKRALEEGDIVKPLEEEYLEEALGPASL---------DLRLGNEFVVFKTLHKPCIDPTENT
DCD_SULSY       --ILNDKTIRKYISE-GLLEPLDDIQIQPSS-------------VDLRLGNEFLIYPE-DIEIIDVRDFS
DCD_SULAC       -------------------------------------YGDSENGIDLRVGNEIARFKKTDK-VFDPDNPD
DCD_PYRAR       MILANDELKRLISTGRLKVDPLYPDTVREN-------------GLDLRIGGEYAIYA-YESTVVRPCDLE
DCD_THENV       MILANDELKRLISLGRLKVEPLAPDTVREN-------------GLDLRIGGEYAIYA-YEGAVVKPCELD
DCD_STRGG       ----SDKDIRAEIDAGRVIDPYDPSMVQPSS-------------IDVRLDRYFRVFENHRYPHIDPEQPD
DCD_METTH       MAILSDRDIKRYIEEGLIIDPLDDPE------RQI-----QPSSVDLRIGNEFKGFRVIRKPCIDPKDSD
DCD_HALOH       --ILSDRTINQMIKNGELVEPLEEYQIQPAS-------------IDLRLGSSF---LKIDENLMEVMTLD
DCD_RHOE4       ------------------IDPFDDSMVQPSS-------------VDVRLDGLFRVFNNTRYTHIDPRQDE
DCD_METPE       ------------------VEPFEPGLIQPNS-------------LDIRLGDHFVWYVP-GDRVIDP--YD
DCD_MYCLE       ---------------------------------------------DVRLDCMFRVFNNTRYTHIDPARQQ
DCD_MYCLB       ---------------------------------------------DVRLDCMFRVFNNTRYTHIDPARQQ
DCD_COPPD       --ILSDGLIKELISYRALIEPLSETQIQPSS-------------VDLTLGSTFLAIDNINVPFLDPKRKE
DCD_CLAM3       ------------------LDPYDPGMLQPAS-------------IDVRIDRFFRLFDNHKYPYIDPAEDQ
DCD_PYRAE       MILANDELKKLISTGRLKVDPLYPDTIREN-------------GLDLRIGGEYAIYA-YEGVVIKPCELE
DCD_KOCRD       ----SDRDIRRHLDSGRVLEPSDPAMVQPAS-------------VDVRLDRWFRLFDNHKYAHIDPEQEQ
DCD_NOCFA       ---------------------------------------------DVRLDRMFRVFDNSRYTHIDPAQRQ
DCD_MYCTU       ---------------------------------------------DVRLDCLFRVFNNTRYTHIDPKQQD
DCD_MYCTA       ---------------------------------------------DVRLDCLFRVFNNTRYTHIDPKQQD
DCD_MYCBT       ---------------------------------------------DVRLDCLFRVFNNTRYTHIDPKQQD
DCD_MYCBP       ---------------------------------------------DVRLDCLFRVFNNTRYTHIDPKQQD
DCD_MYCBO       ---------------------------------------------DVRLDCLFRVFNNTRYTHIDPKQQD
DCD_SALAI       ------------------LEPFDPALVQPSS-------------IDVRLDKLFRVFNNHLYTHIDPQQDD
DCD_RHOSR       ------------------IDPFDDSMVQPSS-------------VDVRLDSLFRVFNNTRYTHIDPAQRQ
DCD_RHOOB       ------------------IDPFDDSMVQPSS-------------VDVRLDSLFRVFNNTRYTHIDPAQRQ
DCD_MYCVP       ---------------------------------------------DVRLDNLFRVFNNTRYTHIDPRQDD
DCD_MYCPA       ------------------IEPFDDALVQPSS-------------VDVRLDCMFRVFNNTRYTHIDPKQQD
DCD_MYCA1       ------------------IEPFDDALVQPSS-------------IDVRLDCMFRVFNNTRYTHIDPKQQD
DCD_HALMA       ---------------------------------------------DLRLGHEFLEFQHANIPCIHPNSED
DCD_SULSO       --ILSDRDLKYYLEKSWIIQPLREDTIREN-------------GVDLRVGNEIARFKKTDK-IFDPDNPD
DCD_PYRIL       MILANDELKKLISTGRLKVDPLAPDTVREN-------------GLDLRIGGEYAIYA-YEGAVVKPCELE
DCD_PYRCJ       ------------------VDPLYPDAVREN-------------GLDLRIGGEYAIYA-YEGAVVRPCDLD
DCD_MYCSS       ------------------IDPFEDSLVQPSS-------------VDVRLDTLFRVFNNTRYTHIDPKQQD
DCD_MYCSK       ------------------IDPFEDSLVQPSS-------------VDVRLDTLFRVFNNTRYTHIDPKQQD
DCD_MYCSJ       ------------------IDPFEDSLVQPSS-------------VDVRLDTLFRVFNNTRYTHIDPKQQD
DCD_MYCS2       ----SDRDIREIAAKRLALEPFDDALVQPSS-------------IDVRLDRMFRVFNNTRYTHIDPAMQQ
DCD_MYCGI       ---------------------------------------------DVRLDNLFRVFNNTRYTHIDPRQDD
DCD_DESK1       -------------------------------------------GVDLRFGDEFCRFKRENS-VVDTSRDG
DCD_FRASN       ------------------LDPYDEGLIQPSS-------------VDLRLDRAFRVFQNHRYSHIDPEQED
DCD_SALTO       ------------------LEPFDPALVQPSS-------------IDVRLDKLFRVFNNHLYTHIDPQQDD
DCD_HYDS0       ---------------------------------------------DLRLSNSIAFYEELD--IIDIKSPI
DCD_BEUC1       ------------------LDPFDDAMVQPSS-------------VDVRLDRYFRLFDNHKYAVIDPAEDQ
DCD_NANEQ       ---------------------------------------------DLRLGNRFRIFRKGEIEVIDPKDFD
DCD_AQUAE       --ILSDRSIRELIEKGELVEPYEPSHVQCSS-------------LDLRLGNQIALYEG--EGVIDVKKGT
DCD_DICTD       --ILSDKDIKKYLEERKLIHPIDDPQKQIQPS-----------SVDLRLGNSFLHFKVEGRAYIDPTKDN
DCD_HALLT       ----------RLAEGDLVVEPLDD-----------VDQQVQPASVDLRLGERFLEFQRTNIPCIHPTEAD
DUT_SIRV1       ---------------------------------------------------DIKTYINSKKLVINPLSED
DCD_IGNH4       ------------------IEPFDENQVREN-------------GVDLTIGHQYARFKNTEDVLDVTKEED
DCD_HALWD       MILSDDDILARLETQELVVEPIDDLDMQIQPA-----------SIDLRLGEEFLEFQRTNISCIHPNRKE
DCD_DICT6       ---------------------------------------------DLRLGNSFLHFKVEGRAYIDPTQDS
DCD_MICLC       ---------------------------------------------DVRLDRFFRLFDNHRYAHIDPRQEQ
DCD_METLZ       ------------------IDPFDPALVQPNS-------------LDIRLGNHFVWYEPCDD-VIDPKETL
DCD_PROMH       ---------------------------------------------DVRLGNQFRVFQGHTAAYIDPKNEV
DCD_TROWT       ------------------IDPFDPQMLQPAS-------------LDIRLSRYFRLFNNHTYAYIDPAEPQ
DCD_TROW8       ------------------IDPFDPQMLQPAS-------------LDIRLSRYFRLFNNHTYAYIDPAEPQ
DCD_METB6       ----------RIARGHIRIDPFDPALVQPNS-------------IDIRLGNHF-VWYAPGKQVIDP--YD
DCD_NATPD       --ILSDADIRRRLDEGDLIEPLDDPELQVQPA-----------SVDLRLGREFLEFQRANISCIHPTSXX
DCD_METHJ       ---------------------------------------------DIRLGNHFVWYTP-GDEIIDPYIRD
DCD_HAEIN       ---------------------------------------------DVRLGNSFRVFREHSAPFIDPKEEV
DCD_YERE8       ---------------------------------------------DVRLGNKFRVFLGHTAGFIDPKDEV
DCD_THERP       ---------------------------------------------DLHLGNTFMVFEHSRFSYIDPRQPQ
DCD_HAEIE       ---------------------------------------------DVRLGNSFRVFREHSAPFIDPKEEV
DCD_HAEI8       ---------------------------------------------DVRLGNSFRVFREHSAPFIDPKEEV
DCD_HAEIG       ---------------------------------------------DVRLGNSFRVFREHSAPFIDPKEEV
DCD_YERPY       ---------------------------------------------DVRLGNQFRVFRGHTAAFIDPKDSD
DCD_YERPS       ---------------------------------------------DVRLGNQFRVFRGHTAAFIDPKDSD
DCD_YERPP       ---------------------------------------------DVRLGNQFRVFRGHTAAFIDPKDSD
DCD_YERPN       ---------------------------------------------DVRLGNQFRVFRGHTAAFIDPKDSD
DCD_YERPG       ---------------------------------------------DVRLGNQFRVFRGHTAAFIDPKDSD
DCD_YERPE       ---------------------------------------------DVRLGNQFRVFRGHTAAFIDPKDSD
DCD_YERPB       ---------------------------------------------DVRLGNQFRVFRGHTAAFIDPKDSD
DCD_YERPA       ---------------------------------------------DVRLGNQFRVFRGHTAAFIDPKDSD
DCD_YERP3       ---------------------------------------------DVRLGNQFRVFRGHTAAFIDPKDSD
DCD_SULTO       ------------------IDPLREDTVREN-------------GVDLRVGGEIARFIKTDK-VFDPDNPD
DCD_PSEA6       ---------------------------------------------DIRLGNKFRVFTEHQAPYIDPKAQV
DCD_THEGJ       -------------EKEILIEPFSKESLQPA-------------GYDLRVGKE---------AYVEGKLID
DCD_PHOLL       ---------------------------------------------DVRLGNQFRVFCGHTAAYIDPKDEV
DCD_SERP5       ---------------------------------------------DVRLGNQFRVFRGHTAAFIDPKDEV
DCD_ERWT9       ---------------------------------------------DVRLGNQFRTFRGHTAAFIDPKRVM
DCD_COLP3       ----------------------------------------SGVSVDIRLGNEFRVFQDHTAPYIDPKGSD
DCD_HALSA       ----------------------------------------------------------------------
DCD_HALS3       ----------------------------------------------------------------------
DCD_SODGM       ---------------------------------------------DVRLGNQFRVFRGHTAAYIDPKDSD
DCD_PASMU       ---------------------------------------------DVRLGNSFRVFREHSAPYIDLSGPK
DCD_PYRKO       -------------------------------------------GYDLRVGGE----AYVNGKILDVKD--
DCD_BACHD       ----------------------------------------------------------------------
DCD_STAMF       -----------------VINPLFPDTIREN-------------GVDLRFGYQFCRFKKDQNIIVDTRDPV
DCD_PYRHO       -------------------------------------------GYDLRVGRE----AFVSGKLID-----
DCD_HAEPS       ---------------------------------------------DVRLGNSFRVFREHSTPYIDLSGPR
DCD_THESM       -------------------------------------------GYDLRVGKE----AMVNGKFIN-----
DCD_ERWCT       ---------------------------------------------DVRLGNQFRVFRGHTAAFIDPKDSD
DCD_ENT38       ---------------------------------------------DVRLGNKFRTFSGHTAAYIDPK--D
DCD_SHEAM       ----------------------------------------SGVSVDVRLGNQFRVFQDHTAPFIDLSGPS
DCD_PECCP       ---------------------------------------------DVRLGNQFRVFRGHTAPFIDPKDSD
DCD_PYRFU       -------------------------------------------GYDLRVGRE----AFVKGKLID-----
DCD_PSYIN       ----------------------------------------SGVSVDIRLGNEFRVFSEHTTPYIDLSGPK
DCD_HYPBU       -------------------------------------------GVDLRLDSEFCRFNPDAPELDTRKPFN
DCD_HAES2       ---------------------------------------------DVRLGNSFRVFREHTAPFIDLSGPK
DCD_HAES1       ---------------------------------------------DVRLGNSFRVFREHTAPFIDLSGPK
DCD_RHORT       ----SDTDIRRMAEGRIAIDPV-PGED-----------AIGAMSVDLQLGDSFRVFVPGKVSHVDPGGIK
DCD_MANSM       ---------------------------------------------DLRLGNSFRVFRDYSAPYIDPREEV
DCD_IDILO       ----------------------------------------------------------------------
DCD_HAMD5       ---------------------------------------------DIRLGHEFRVFVGHKAPFIDPKEEI
DCD_SHISS       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_SHIFL       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_SHIF8       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_SHIBS       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_SHIB3       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ESCF3       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ECOSE       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ECOLC       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ECOL5       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ECOHS       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ECO8A       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ECO81       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ECO55       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ECO27       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ECO24       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_CITK8       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ACTPJ       ---------------------------------------------DVRLGNSFRVFREHATPYIDLSGPR
DCD_ACTP7       ---------------------------------------------DVRLGNSFRVFREHATPYIDLSGPR
DCD_ACTP2       ---------------------------------------------DVRLGNSFRVFREHATPYIDLSGPR
DCD_EDWI9       ---------------------------------------------DVRLGNRFRVFQGHTAAYIDPKQEV
DCD_ECOLI       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ECODH       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ECOBW       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDMS
DCD_ACTSZ       ---------------------------------------------DLRLGNSFRVFREHSAPYIDPKEAV
DCD_SALTY       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALTI       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALSV       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALPK       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALPC       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALPB       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALPA       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALNS       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALHS       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALG2       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALEP       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALDC       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALCH       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_SALA4       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_HAEDU       ---------------------------------------------DVRLGNSFRVFREHATPYIDLSGPR
DCD_TOLAT       ----------------------------------------SGVSVDVLLGNEFRVFQAHTAPYIDPKESD
DCD_SHELP       ----------------------------------------SGVSVDVKLGNQFRVFQDHTAPYIDPSSEV
DCD_SALAR       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_BUCAP       ---------------------------------------------DIHLGNKFRFFYDHTTSCIDLSGSK
DCD_BAUCH       ---------------------------------------------DILLGDKFRVFRGHTTAFVDLSG-P
DCD_ALTMD       ---------------------------------------------DIRLGNKFRVFEDHQAPFIDPKAQV
DCD_KLEP7       ---------------------------------------------DVRLGNKFRTFRGHTAPFIDPKRVM
DCD_KLEP3       ---------------------------------------------DVRLGNKFRTFRGHTAPFIDPKRVM
DCD_ENTS8       ---------------------------------------------DVRLGNKFRTFRGHTAAYIDPK--D
DCD_SHIDS       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_ECOUT       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_ECOSM       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_ECOLU       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_ECOL6       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_ECOK1       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_ECO7I       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_ECO5E       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_ECO57       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_ECO45       ---------------------------------------------DVRLGNKFRTFRGHTAAFIDPKDEV
DCD_PYRAB       -------------------------------------------GYDLRVGKE----AYIQGKFID-----
DCD_SHESW       ----------------------------------------SGVSVDVRLGGQFRVFKDHTAPFIDPSGEM
DCD_SHESM       ----------------------------------------SGVSVDVRLGGQFRVFKDHTAPFIDPSTEV
DCD_SHESA       ----------------------------------------SGVSVDVRLGGQFRVFKDHTAPFIDPSTEV
DCD_SHEPC       ----------------------------------------SGVSVDVRLGGQFRVFKDHTAPFIDPSGEM
DCD_SHEON       ----------------------------------------SGVSVDVRLGGQFRVFKDHTAPFIDPSGEV
DCD_SHEFN       ----------------------------------------SGVSVDVRLGSQFRVFKDHTAPYIDLSGSD
DCD_SHEB9       ----------------------------------------SGVSVDVRLGGQFRVFKDHTAPYIDLSSVE
DCD_SHEB8       ----------------------------------------SGVSVDVRLGGQFRVFKDHTAPYIDLSSVE
DCD_SHEB5       ----------------------------------------SGVSVDVRLGGQFRVFKDHTAPYIDLSSVE
DCD_SHEB2       ----------------------------------------SGVSVDVRLGGQFRVFKDHTAPYIDLSSVE
DCD_AERHH       ----------------------------------------SGVSVDVLLGNEFRVFRDHTAPYIDLSGSD
DCD_PSEHT       ---------------------------------------------DLRLGNKFRTFHAHTAAYVDPKDQL
DCD_SHESR       ----------------------------------------SGVSVDVRLGGQFRVFKDHTAPFIDPSPEV
DCD_AERPE       --ILSDRDIRALAIGDLVVEPLSGDTVREN-------------GLDLRLGRGFCRFKR-SDRVLDPRGSP
DCD_AERS4       ----------------------------------------SGVSVDVLLGNEFRVFRDHTAPYIDLSNSE
DCD_BUCBP       ---------------------------------------------DVRLGNEFYTFCNFNKNIDLSKSRN
DCD_THEAC       ---------------------------------------------------------------VDAIDVE
DCD_CLOAB       --ILSGKQIKDSLGKDIVIEPFNEKQINPNS-------------YNLKLHNELLVY---DEEVLDMKKPN
DCD_BUCAI       ---------------------------------------------DIHLGNKFRFFYEHTGSCIDLSNSK
DCD_MARMS       ----------------------------------------------------------------------
DCD_WIGBR       ----------------------------------------------------------------------
DCD_METMP       --ILSDKDINYVTSKRVLIEPFNPCSYDVTLGSEFIKYNEDVY--DVKKTLNHSKFKIENSVMVCPKNYK
DCD_METM5       -----------------LIEPFNPCSYDVTLGSEFIKYKDDVY--DLKKSLSHNKFEIENSIMICPLNLD
DCD_METM7       -----------------LIEPFNPCSYDVTLGSEFIKYKEDVY--DLKKSLSHNKFEIENSIMVCPLNLD
DUT_METKA       ----------------------------------------------------------------DDKRLP
DCD_METM6       ---------------------------------------------------------HLDETIIE--NYK
DCD_METVS       -------------------------------GEEFITYNEDVY--DVKKQLSHRSFKIDNSIMVCPHHLD


                         .         .         *         .         .         .         .:140
query           EKSFVDFKGDVCIIPPNSFALARTMEYFRIPRSVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_RALME       EKSFVDFKGDVCIIPPNSFALARTMEYFRIPRSVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_CUPTR       EKSFVDFKGDVCIIPPNSFALARTMEYFRIPRSVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_RALEJ       EKSFVDFKGDVCIIPPNSFALARTMEYFRIPRSVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_RALEH       EKSFVDFKGDVCIIPPNSFALARTMEYFRIPRSVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_RALSO       EKSFVDFKGDVCIIPPNSFALARTMEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_RALPJ       EKSFVDFKGDVCIIPPNSFALARTMEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_JANMA       ENSFVDIKSDVCIIPPNSFALARTIEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_POLSJ       EKSFVDFHGDSCIIPPNSFALARTLEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_ACIAC       EKSFVDFHGDSCIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_VARPS       EKSFVDMHGDYCIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_HERAR       ENSFVDVKSDVCIIPPNSFALARTIEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURP8       EKSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVLTVCLGKSTYARCGIIVNVTPFEPEWEGHVTLEFSN
DCD_BURXL       EKSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVLTVCLGKSTYARCGIIVNVTPFEPEWEGHVTLEFSN
DCD_LEPCP       EKSFVDIESDVCIIPPNSFALARTMEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURPP       EKSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVLTVCLGKSTYARCGIIVNVTPFEPEWEGHVTLEFSN
DCD_DIAST       EKSFVDFEGDYCIIPPNSFALARTVEYFRIPRDVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_ACISJ       EKSFVDFEGDYCIIPPNSFALARTVEYFRIPRDVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURVG       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURS3       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURPS       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURP6       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURP0       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURMS       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURMA       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURM9       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURM7       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURM1       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURCM       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURCJ       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURCH       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURCC       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURCA       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURA4       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_RHOFD       EKSFVDFHGDSCIIPPNSFALARTMEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_BURTA       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRTVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_DECAR       PKSFVEIESDVCIIPPNSFALARTMEYFRIPRSVLTVCLGKSTYARCGIIVNVTPFEPEWEGHVTLEFSN
DCD_BORPA       EKSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_BORBR       EKSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_BORPE       EKSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_BORPD       EKSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_CELJU       EKSFVDIKSDVCIIPPNSFALARTVEYFRIPRSILTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_BORA1       EGSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_THISH       ARSFVDVKSDVCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_NITEC       SNSFVDLKNDICIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_NEIMB       PKNFVTVEDDCCIIPPNSFALARTVEYFRIPRNVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_NEIMA       PKNFVTVEDDCCIIPPNSFALARTVEYFRIPRNVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_NEIG2       PKNFVTVEDDCCIIPPNSFALARTVEYFRIPRNVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_NEIG1       PKNFVTVEDDCCIIPPNSFALARTVEYFRIPRNVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_NEIMF       PKNFVTVEDDCCIIPPNSFALARTVEYFRIPRNVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_NEIM0       PKNFVTVEDDCCIIPPNSFALARTVEYFRIPRNVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_NITMU       SNSFVDVKSNICLIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGFVTLEFSN
DCD_TERTT       EHSFVDISSDVCIIPPNSFALARTVEYFRIPRSVLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_NITEU       SNSFVDVKGDICIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_MARAV       ENSFVNYTGDVCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGIIVNVTPLEPEWEGQVTLEFSN
DCD_LARHH       EKCFVDVKGEYCIIPPNSFALARTVEYFRIPRNVLTVCLGKSTYARCGIVVNVTPFEPEWEGYVTLEFSN
DCD_NITOC       ASSFVDVQSDVCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGIIVNITPLEPEWEGHVTLEFSN
DCD_THIDA       PNSFVEVKGDSCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_AZOSB       ARNFVDFVGDVCIIPPNSFALARTVEFFRIPRNVLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_FRATW       DKNFVDFKGDVCIIPPNSFALARTVEKFKIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGYVTLEFSN
DCD_FRATT       DKNFVDFKGDVCIIPPNSFALARTVEKFKIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGYVTLEFSN
DCD_FRATO       DKNFVDFKGDVCIIPPNSFALARTVEKFKIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGYVTLEFSN
DCD_FRATN       DKNFVDFKGDVCIIPPNSFALARTVEKFKIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGYVTLEFSN
DCD_FRATM       DKNFVDFKGDVCIIPPNSFALARTVEKFKIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGYVTLEFSN
DCD_FRATH       DKNFVDFKGDVCIIPPNSFALARTVEKFKIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGYVTLEFSN
DCD_FRATF       DKNFVDFKGDVCIIPPNSFALARTVEKFKIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGYVTLEFSN
DCD_FRAT1       DKNFVDFKGDVCIIPPNSFALARTVEKFKIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGYVTLEFSN
DCD_FRAP2       DKNFVDFKGDVCIIPPNSFALARTVEKFKIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGYVTLEFSN
DCD_AZOSE       ARNFVDFVGDVCIIPPNSFALARTVEYFRIPRNVLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_CHRVO       PNSFVEVSGKYCIIPPNSFALARTVEYFRIPRSVLTVCLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_PSYA2       EKSFIDIIGDECIIPPNSFALARTMEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_CHRSD       EKSFVDVKGDVCVIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSYCK       EKSFIDVIGDECIIPPNSFALARTMEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEMY       EKSFVDIKSDVCIIPPNSFALARTVEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_XANC5       PGSFVDIESDVCIIPPNSFALARTVEYFRIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSYWF       ENSFIDIVGDECIIPPNSFALARTVEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_XANAC       PGSFVDIESDVCIIPPNSFALARTVEYFRIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSESM       EKSFVDIKSDVCIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_ACIBT       EKSFIDIESDVCIIPPNSFALARTIEYFRIPRNVLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_XANCP       PGSFVDIESDVCIIPPNSFALARTVEYFRIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGRVTLEFSN
DCD_XANCB       PGSFVDIESDVCIIPPNSFALARTVEYFRIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGRVTLEFSN
DCD_XANC8       PGSFVDIESDVCIIPPNSFALARTVEYFRIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGRVTLEFSN
DCD_ACIBY       EKSFIDIESDVCIIPPNSFALARTIEYFRIPRNVLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_ACIBS       EKSFIDIESDVCIIPPNSFALARTIEYFRIPRNVLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_ACIBC       EKSFIDIESDVCIIPPNSFALARTIEYFRIPRNVLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_ACIB5       EKSFIDIESDVCIIPPNSFALARTIEYFRIPRNVLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_ACIB3       EKSFIDIESDVCIIPPNSFALARTIEYFRIPRNVLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEU2       EKSFVDIKSDVCIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSE14       EKSFVDIKSDVCIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_STRM5       PGSFVDIVGDECIIPPNSFALARTVEYFRIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_METCA       QNSFVDLVSDVCIIPPNSFALARTVEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_XANOR       PGSFVDVESDVCIIPPNSFALARTVEYFRIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_XANOP       PGSFVDVESDVCIIPPNSFALARTVEYFRIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_XANOM       PGSFVDVESDVCIIPPNSFALARTVEYFRIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_STRMK       SGSFVDITADECIIPPNSFALARTVEYFRIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_ALCBS       ERSFVDVKGEYCIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_HALHL       AASFVDVHGDVCIIPPNSFALAYTLEYFRIPRNVLTICLGKSTYARCGIIVNVTPLEPEWEGRVTLEFSN
DCD_ACIAD       EKSFIDIHSDVCIIPPNSFALARTVEYFRIPRNVLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEFS       EKSFVDVKSDVCIIPPNSFALARTVEFFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEAE       EKSFVDINSDVCIIPPNSFALARTVEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEAB       EKSFVDINSDVCIIPPNSFALARTVEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEA8       EKSFVDINSDVCIIPPNSFALARTVEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEA7       EKSFVDINSDVCIIPPNSFALARTVEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEPW       AGSFVDVKSDVCIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEPK       AGSFVDIKSDVCIIPPNSFALARTVEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEP1       AGSFVDIKSDVCIIPPNSFALARTVEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEPG       AGSFVDIKSDVCIIPPNSFALARTVEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_AZOVD       ERSFVDVKGAVCIIPPNSFALARTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_COXBU       PNGFIDLKANVCIIPPNSFVLARTVEYFKIPRNILTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_COXBR       PNGFIDLKANVCIIPPNSFVLARTVEYFKIPRNILTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_COXBN       PNGFIDLKANVCIIPPNSFVLARTVEYFKIPRNILTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_COXB2       PNGFIDLKANVCIIPPNSFVLARTVEYFKIPRNILTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_COXB1       PNGFIDLKANVCIIPPNSFVLARTVEYFKIPRNILTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_XYLFT       NGSFIDVESDVCIIPPNSFALARTIEYFRIPRNVLVICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_XYLF2       NGSFIDVESDVCIIPPNSFALARTIEYFRIPRNVLVICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_SACD2       XXXXXXXXXXXCIIPPNSFALARTVEYFRIPRSVLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_XYLFM       NGSFIDVESDVCIIPPNSFALARTIEYFRIPRNVLVICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_XYLFA       NGSFIDVESDVCIIPPNSFALARTIEYFRIPRNVLVICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_PSEPF       AGSFVDVHSDVCIIPPNSFALATTVEYFRIPRNVLTICLGKSTYARCGIIVNVTPLEPEWEGQVTLEFSN
DCD_LEGPL       ENSFVDVQSDVCIIPPNSFALARTVEYFRIPRNILTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_LEGPH       ENSFVDVQSDVCIIPPNSFALARTVEYFRIPRNILTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_LEGPA       ENSFVDVQSDVCIIPPNSFALARTVEYFRIPRNILTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_ACIF5       EHSFVDFTGDTCIIPPNSFALARTLEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_ACIF2       EHSFVDFTGDTCIIPPNSFALARTLEYFRIPRNVLTICLGKSTYARCGIIVNVTPFEPEWEGYVTLEFSN
DCD_ACIBL       EKSFVTITSDVCIVPPNSFALARSVEYFKIPRDVLTICVGKSTYARCGIIVNVTPFEPEWEGYVTLEISN
DCD_DICNV       SKSFVDVQSDVCIIPPNSFALARTIEYFRIPRDVLTICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_CHLFF       EDTFISITDDVCIIPPNSFALAHSVEYFRIPRNVLTMCIGKSTYARCGLIVNVTPFEPEWEGYVTIEISN
DCD_CHLAB       EDTFISITDDVCIIPPNSFALAHSVEYFRIPRNVLTMCIGKSTYARCGLIVNVTPFEPEWEGYVTIEISN
DCD_CHLCV       EDTFISITDDVCIIPPNSFALAHSVEYFRIPRNILTMCIGKSTYARCGLIVNVTPFEPEWEGYVTIEISN
DCD_NITSB       ERNVVDFKGDVCIVPPNSFALARTVEYFRIPRNVLAICVGKSTYARCGIIVNVTPFEPEFEGHITIEISN
DCD_CAMHC       EKNIVDFKGDVCIVPPNSFALARTIEYFKMPRDVLAICLGKSTYARCGIIVNVTPFEPGFEGHITIEISN
DCD_GEMAT       PKSFVEFEGDVCIVPPNSFALARSVEYFRIPRNVLTLTVGKSTYARCGIITNVTPFEPEWEGYVTLEISN
DCD_ACIC5       ERSFVTVEADSVIVPPNSFALARSIEYFRIPRDVLTICVGKSTYARCGIIVNVTPFEPEWEGYVTLEISN
DCD_RICBR       KYNLVDREVDVCIIPPNSFALGRTVEYFKIPRDVLVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_RICB8       KYNLVDREVDVCIIPPNSFALGRTVEYFKIPRDVLVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_WOLSU       EANVVDFIGDICIVPPNSFALARTVEYFRIPRDVLAICLGKSTYARCGIIVNVTPFEPEFEGHITIEISN
DCD_RICRS       EYNLVDREVDVCIIPPNSFALGRTIEYFKIPRDVLVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_RICPU       EYNLVDREVDVCIIPPNSFALGRTIEYFKIPRDVLVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_RICCN       EYNLVDREVDVCIIPPNSFALGRTIEYFKIPRDVLVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_RICAE       EYNLVDREVDVCIIPPNSFALGRTIEYFKIPRDVLVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_MAGSA       PNSLVDRETDICVIPPNSFALARTVEYFRIPRDVLVICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_SPHAL       PKNFVDRETDVCIIPPNSFALARTVEYFRIPRDVLVICLGKSTYARCGIIVNVTPLEPGWEGHVTLEFSN
DCD_CHLMU       EDALISIVDDVCIIPPNSFALARSVEYFRIPRNVLTVCIGKSTYARCGLIVNVTPFEPEWEGYVTIEISN
DCD_CHLPN       EDIFISITDDVCIVPPNSFALARSVEYFRIPRNVLTMCIGKSTYARCGIIVNVTPFEPEWEGHVTIEISN
DCD_RICFE       EYNLVDREVDVCIIPPNSFALGRTIEYFKIPRDVLVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_RICAH       EYNLVDREVDVCIIPPNSFALGRTIEYFKIPRDVLVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_CHLTR       EDALISIVDDVCIIPPNSFALARSVEYFRIPRNVLTVCIGKSTYARCGLIVNVTPFEPEWEGYVTIEISN
DCD_CHLTB       EDALISIVDDVCIIPPNSFALARSVEYFRIPRNVLTVCIGKSTYARCGLIVNVTPFEPEWEGYVTIEISN
DCD_CHLTA       EDALISIVDDVCIIPPNSFALARSVEYFRIPRNVLTVCIGKSTYARCGLIVNVTPFEPEWEGYVTIEISN
DCD_CHLT2       EDALISIVDDVCIIPPNSFALARSVEYFRIPRNVLTVCIGKSTYARCGLIVNVTPFEPEWEGYVTIEISN
DCD_METI4       PRSFVEMESDCCIIPPNSFALARSVEYFRIPRDVITICLGKSTYARCGIIVNVTPFEPEWEGYATLEISN
DCD_NAUPA       ERNVVNIKGD-CIIPPNSFALCRSVEYFKMPRDVLAICVGKSTYARCGIIVNVTPIEPEWEGHITIEISN
DCD_GRABC       PASFVDRKGPVCIIPPNSFALAHTVEYFRIPRNVLVICLGKSTYARCGIIVNVTPLEPEWEGQVTIEISN
DCD_CAMFF       EKNVVDFIGDICIVPPNSFALARTVEYFKMPHDVLAICLGKSTYARCGIIVNVTPFEPGFNGHITIEISN
DCD_RICCK       EYNLVDREVDVCIIPPNSFALGRTIEYFKVPRDILVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_SULNB       ENNVVDFKGDICIVPPNSFALARTVEYFRMPKDTLAICLGKSTYARCGIIVNVTPFEPGFEGHITIEISN
DCD_SPHWW       SNSFVDRETDVCIIPPNSFALARTVEYFRVPRDVLVICLGKSTYARCGIIVNVTPLEPGWEGHVTLEFSN
DCD_RICPR       EYNLVDREVDACIIPPNSFALGRTIEYFKIPRDVLVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_RICTY       EDNLVDREVDECIIPPNSFALGRTIEYFKIPRDVLVICVGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_CAMJE       EENVVDFEGDVCIVPANSFALARTIEYFKMPDNVLAICLGKSTYARCGIIVNVTPFEPGFEGHITIEISN
DCD_HERA2       PRSFVDVKADVCIIPPNSFVLCRTIEYFRIPRNVLCVCVGKSTYARCGLIANVTPFEPGWEGYVTIEISN
DCD_CAMLR       EENVVDFVGDVCIVPANSFALARTVEYFKMPNDVLAICLGKSTYARCGIIVNVTPFEPGFEGHITIEISN
DCD_NOVAD       SNSFVDRETDVCVIPPNSFALARTVEYFRVPRDVLVICLGKSTYARCGIIVNVTPLEPGWEGHVTLEFSN
DCD_CAMJR       EENVVDFEGDVCIVPANSFTLARTIEYFKMPDDVLAICLGKSTYARCGIIVNVTPFEPGFEGHITIEISN
DCD_RHOCS       ATSFVDRKTDVCIIPANSFALARTVEYFRIPRDVLVICLGKSTYARCGLIVNVTPLEPEWEGHVTLEISN
DCD_CAMJD       EENVVDFEGDVCIVPANSFALARTIEYFKMPDDVLAICLGKSTYARCGIIVNVTPFEPGFEGHITIEISN
DCD_CAMJ8       EENVVDFEGDVCIVPANSFALARTIEYFKMPDDVLAICLGKSTYARCGIIVNVTPFEPGFEGHITIEISN
DCD_ERYLH       GDSLVDRETEVCIIPPNSFALARTVEYFRIPEDVLVICLGKSTYARCGIIVNVTPLEPGWEGHVTLEFSN
DCD_CHLSY       PRSFVDIRADYVDIPPNSFALAQSLEYFRIPRTVSCIVIGKSSYARCGIIINVTPLEPEWEGHVTIEISN
DCD_CHLAA       PRSFVDIRADYVDIPPNSFALAQSLEYFRIPRTVSCIVIGKSSYARCGIIINVTPLEPEWEGHVTIEISN
DCD_CHLAD       PRSFVDIEADYVDIPPNSFALAQSLEYFRIPRTVSCIVIGKSSYARCGIIINVTPLEPEWEGHVTIEISN
DCD_PARUW       TKSLVKIEDDVCVIPPNSFALAITLEYFRIPENVLTICVGKSTYARCGIIVNVTPFEPGWEGYAVLEISN
DCD_ACICJ       SDSFVDRKGPVCIIPPNSFALAHTVEYFRIPRDVLVICLGKSTYARCGIIVNVTPLEPEWEGQVTIEISN
DCD_CAMC5       EKNVVDFKGDVCIVPPNSFALARTIEYFNMPDNVLAICLGKSTYARCGIIVNVTPFEPGFKGHITIEISN
DCD_WOLWR       ENSFIDKETDVCIIPPNSFVLASTVEYFRIPRNVLVICVGKSTYARCGIIVNVTPLEPGWEGHVTLEFSN
DCD_WOLPM       ENSFIDKETDVCIIPPNSFVLASTVEYFRIPRNVLVICVGKSTYARCGIIVNVTPLEPGWEGHVTLEFSN
DCD_CAMC1       EKNVVDFKGDVCIVPPNSFALARTIEYFNMPDNVLAICLGKSTYARCGIIVNVTPFEPGFKGHITIEISN
DCD_ORITB       QDCLITKISDICIIPPNSFALGTTIEYFKMPRDVIAICIGKSTYARCGIIINVTPLEPECEGHITLEFSN
DCD_WOLPP       ENSFIDKETDVCIIPPNSFVLASTVEYFRIPRNVLVICVGKSTYARCGIIVNVTPLEPGWEGHVTLEFSN
DCD_ORITI       QDCLITKISDICIIPPNSFALGTTIEYFKMPRDVIAICIGKSTYARCGIIINVTPLEPECEGHITLEFSN
DCD_GLUOX       SNSFVTRTGDITI-PPNSFALAHTVEYFRIPRDTLVVCLGKSTYARCGIIVNVTPLEPEWEGQVTIEISN
DCD_WOLTR       KNSFIDKETDVCIIPPNSFALASTVEYFHIPRDVLAICVGKSTYARCGIIVNVTPLEPGWKGHVTLEFSN
DCD_ANAPZ       QDSFVDREGDFCIIPPNSFMLAKTVEYFNIPRDVMVVCVGKSTYARCGIVVNVTPLEPGWSGYVTLEFSN
DCD_HELAH       PNNAT--KIDACILPANAFALAHTIEYFKMPKDTLAICLGKSTYARCGIIVNVTPFEPEFEGYITIEISN
DCD_ROSCS       PRSFVDIRGDYCDIPPNSFALARSVEYFRIPRNVLCIVLGKSTIARCGIIVNVTPLEPEWCGYVTIEISN
DCD_HELPJ       PNNATKIKEGFFILPANAFALAHTIEYFKMPKDTLAICLGKSTYARCGIIVNVTPFEPEFEGYITIEISN
DCD_NEOSM       ESMLIERTGDFCIIPPNSFALGCTIEYFRVPRGVIVICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSN
DCD_HELPY       PNNATKIKEGYFILPANAFALAHTIEYFKMPKDTLAICLGKSTYARCGIIVNVTPFEPEFEGYITIEISN
DCD_HELPS       PNNTTKIKEGFFILPANAFALAHTIEYFKMPKDTLAICLGKSTYARCGIIVNVTPFEPEFEGYITIEISN
DCD_HELPG       PNNATKIKEGFFILPANAFALAHTIEYFKMPKDTLAICLGKSTYARCGIIVNVTPFEPEFEGYITIEISN
DCD_HELP2       PNNATKIKEGYFILPANAFALAHTIEYFKMPKDTLAICLGKSTYARCGIIVNVTPFEPEFEGYITIEISN
DCD_HELHP       ERNVVEIENGYCLVPPNSFALARTIEYFRIPRNVLAICLGKSTYARCGIIVNVTPFEPEFEGHITIEISN
DCD_ANAMM       QDSFIDKETDVCIMPPNSFMLAKTVEYFRIPKDVIVICVGKSTYARCGIVVSVTPLEPGWEGYVTLEFSN
DCD_ANAMF       QDSFIDKETDVCIMPPNSFMLAKTVEYFRIPKDVIVICVGKSTYARCGIVVSVTPLEPGWEGYVTLEFSN
DCD_PELUB       SDNFVTKKSDYIIIPPNSFALGTTIEVFKIPRDIMCIVVGKSTYARTGIIVNVTPIESEFFGTVTLEFSN
DCD_EHRCJ       LGSFIDKEEDICIIPPNSFVLAKTVEYFKIPKDILVMCVGKSTYARCGIVVNVTPLEPGWEGYVTLEFSN
DCD_CORK4       EDSLVEVKGDAFILHPGEFVLGSTLEEFALPADLAGRLEGKSSLGRLGLLTHSTAIDPGFNGYITFELSN
DCD_METS3       EEDIAEYEGEAFIIHPNEFALATTQEYVKVPDDLVARVEGRSSMGRLGVTMHVTAVDPGFEGRITLEISN
DCD_CORGL       ETSLVEVEGEGFVLHPGEFVLASTLEKFTLPAHLAGRLEGKSSLGRLGLLTHSTAIDPGFSGYITLELSN
DCD_CORGB       ETSLVEVEGEGFVLHPGEFVLASTLEKFTLPAHLAGRLEGKSSLGRLGLLTHSTAIDPGFSGYITLELSN
DCD_COREF       ETSLVEVAGDPFVLHPGEFVLAATLEKFTLPHHLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_BIFAA       GELTEQFEDEPWILHPGEFALGSTWEYVKLDASIAARLEGKSSLGRLGILTHSTAIDPGFEGHITLELSN
DCD_CLOTH       EVKYKTITSDTYILLPNQFVLATTMEYFELPNNLTAFVEGRSSLGRLGLFINAGWVDPGFKGEITLELFN
DCD_KORCO       PSLHFTFSDEGIIIPGNTSILLVTEEYIKMPDDVAALCGLRSSIARWGFIAAPTLVDAGFEGQLTIEVMW
DCD_CORDI       DESLVEVEGEPFVLHPGEFVLGSTLEKFTLPAHIAGRLEGKSSLGRLGLLTHSTAIDPGFSGYITLELSN
DCD_BIFLO       GALTEQFEDEPWILHPGEFALGSTWEYVKLDPSIAARLEGKSSLGRLGILTHSTAIDPGFEGHITLELSN
DCD_BIFLI       GALTEQFEDEPWILHPGEFALGSTWEYVKLDPSIAARLEGKSSLGRLGILTHSTAIDPGFEGHITLELSN
DCD_BIFLD       GALTEQFEDEPWILHPGEFALGSTWEYVKLDPSIAARLEGKSSLGRLGILTHSTAIDPGFEGHITLELSN
DCD_CALMQ       STSIVEAKDGRIIIPPRSFALLTTMEYVKFPRDVIGFCNLRSTLARYGLGVPPTIIDTGFEGNITIEVIN
DCD_CORJK       EETLVEVPDDEAILHPGEFVLGATLECFGIPAHLAGRLEGKSSLGRLGLLTHSTAIDPGFTGHITLELSN
DCD_BIFA0       GELTEQFEDEPWILHPGEFALGSTWEYVKIDETLAARLEGKSSLGRLGILTHSTAIDPGFEGHITLELSN
DCD_LEIXX       LTRFVEVVADQFILHPGEFVLGSTFELVSLPDDVAARLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_ARTCA       PERLVEVEQDEAILHPGEFVLGSTYETVTLPDDIAARLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_METST       NTDLESYMSSITIIHPGEFTLATTYENVKLPDDIVARVEGRSSMGRLGITMHVTAIDPGFEGNITLEISN
DCD_PERMH       KKVVADDEG--FIIQPKQFILATTREYIKLPDYLTAFVEGRSSLGRLGLFINAGWVDAGFEGNITLEFYN
DCD_ACIC1       LTRLVETEGDEFILHPGEFVLASTYEVIALPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFTGHVTLELSN
DCD_NOCSJ       LTRMVEPEGDEFILHPGEFVLGSTYEVVTLPDDIAARVEGKSSLGRLGLLTHATAVDPGFSGHVTLELAN
DCD_METS5       D-FFVRERGNEFVIWPNEHVLMVTEEYLRLPQDIMAFVNMRSSFARLGLLVPPTIVDAGFEGQLTIEVMG
DCD_RENSM       PERLVEVAADEFILHPGEFVLGSTYEAVTLPDDVAARLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_THEFY       LTRLVEPEGDEFILHPGEFVLASTYEMVTLPNDIASRLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_ACIAM       PRSFYEIKGDEFIIYPNEHVLLVTEEYVKLPNDVMAFVNLRSSFARLGLFVPPTIVDAGFEGQLTIEVLG
DCD_STRCO       LTRLVEPEGDEFILHPGEFVLASTYEVVSLPDDLASRLEGKSSLGRLGLVTHSTAIDPGFSGHVTLELSN
DCD_MYCMM       ELTSVPTKGDPFVLHPGEFVLGSTLEIFSLPGDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_METMJ       TRDTEEMVADSIVLAPGRFLLAETLEAIELPDDIVASIEGKSSIARLGVELHQTGIDAGFRGTITLEMCN
DCD_CLAMS       PERLIEAKGDPFILHPGEFVLGSTFEMVTLPDDVAARLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_ARTAT       PERLVEVEGDEFILHPGEFVLGSTYETVSLADDIAARLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_STRAW       LTRLVEPEGDEFILHPGEFVLASTYEVISLPDDLASRLEGKSSLGRLGLVTHSTAIDPGFSGHVTLELSN
DCD_MYCUA       DEAVEPTKGDPFVLHPGEFVLGSTLEIFSLPGDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_METKA       ERIVID-EDEEFVINPGELVLAVTHEWIEINAPDITGVLGRSSLGRLGIQAHVEAVDPGWRGRLTLELVN
DCD_SULSY       NRLIKEIATEEFIIKPKQFVLATTIEYIKLPDFLTAFVEGRSSLGRLGLFINAGWVDAGFEGNITLEFYN
DCD_SULAC       YSFFDVQRGEEFIISPHEHVLLVTEEYMKLPNDVMAFVNLRSTFARLGLFIPPTIVDAGFEGQLTIEVVG
DCD_PYRAR       TAKFRIVKSDEVVIPPRNFVLLTTEEYVKMPDDVVGFANLRSTLARYGLVIPPTIVDAGFEGNITIEVVN
DCD_THENV       SARFRVVKADEVVIPPRNFVLLTTEEYVKMPDDVVGLANLRSTLARYGLVIPPTVVDAGFEGNITIEVVN
DCD_STRGG       LTRTVEPEGDEAILHPGEFVLASTYEVISLPDDLASRLEGKSSLGRLGLVTHSTAIDPGFSGHVTLELSN
DCD_METTH       IESYMEVEDGPFIIHPGEFALATTHEYIALPEDLVARVEGRSSIGRLGITMHVTAIDPGFHGRITLEISN
DCD_HALOH       EIKYVNLERKEIIVPPNSFLLATTREYIKLPPDITAFVEGRSSIGRMGLFINAGWVDPGFEGQITLELYN
DCD_RHOE4       LTSLVEAEGEPFVLHPGEFVLGSTLEVCSLPNDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_METPE       KESVTEMNANEVILYPGQFMLAETKEVLSLPDNVVASIEGKSSIARLGIELHQTGIDAGFIGSITLEMCN
DCD_MYCLE       DESLVELDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEGKSSLGRLGLLTHSTAIDPGFCGHITLELSN
DCD_MYCLB       DESLVELDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEGKSSLGRLGLLTHSTAIDPGFCGHITLELSN
DCD_COPPD       TIKYREIKGGQLILQPGFFLLGTTTERLMLPNFLVARVEGRSSLGRMGILIHATAVDPGFCGQITLEISN
DCD_CLAM3       PERLIESKGEPFILHPGEFVLGSTFELVTLPDDVAARLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_PYRAE       SARFRVVKADEVVIPPRNFALLTTEEYVKMPDDVVGFANLRSTLARYGLVIPPTIVDAGFEGNITIEVVN
DCD_KOCRD       PERLVEVAPDEFVLHPGEFVLGATYEKVTLPDDIAARLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_NOCFA       DESLVEGEGEPFVLHPGEFVLGSTLEVCTLPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_MYCTU       ELTSLPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_MYCTA       ELTSLPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_MYCBT       ELTSLPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_MYCBP       ELTSLPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_MYCBO       ELTSLPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_SALAI       LTSTVEVPGEPFVLHPGEFVLASTLEVISLGDQLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_RHOSR       DETLVEAEGEPFVLHPGEFVLGSTLEVCSLPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFNGHITLELSN
DCD_RHOOB       DETLVEAEGEPFVLHPGEFVLGSTLEVCSLPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFNGHITLELSN
DCD_MYCVP       LTSLVEPKGEPFVLHPGEFVLGATLERCTLPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_MYCPA       ETSLVEPQGEPFVLHPGEFVLGSTLELITLPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_MYCA1       ETSLVEPQGEPFVLHPGEFVLGSTLELITLPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_HALMA       EVSTVIEEGGEFILHPGDFVLGTTHERVAIPDDLIAHVEGRSSLGRLAIVVHATACDPGYEGQITLELSN
DCD_SULSO       PSFFQTEKGEEFIIQPYEHVLLTTEEYIELNNDVMAFVNLRSTFARLGLFIPPTIVDAGFKGQVTIEVVG
DCD_PYRIL       NARFRIVKADEVVIPPRNFVLLTTEEYVKMPDDVVGLANLRSTLARYGLVIPPTVVDAGFEGNITIEVVN
DCD_PYRCJ       DAKFRVVKADEVVIPPRNFVLLTTEEYVKMPEDVAGLANLRSTLARYGLSIPPTVVDVGFEGNITIEVVN
DCD_MYCSS       ETSLVESPGEPFVLHPGEFVLGSTLETCTLPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_MYCSK       ETSLVESPGEPFVLHPGEFVLGSTLETCTLPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_MYCSJ       ETSLVESPGEPFVLHPGEFVLGSTLETCTLPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_MYCS2       DETLVEAEGEPFVLHPGEFVLGSTLELCTLPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_MYCGI       LTSLVEPKGEPFVLHPGEFVLGATLERCTLPDDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHITLELSN
DCD_DESK1       VDNVLEVRGDGFVINPLEHVLTTTLEYVEFPHDLVGLVNLRSTFARFGLYIPPTVIDAGFKGNITIELVG
DCD_FRASN       LTELVAPEGDEFVLHPGEFVLGSTLEVVTLPEDLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_SALTO       LTSAVEVPGEPFVLHPGEFVLASTLEVISLGDQLAGRLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_HYDS0       QAKTVTFE-EYFIINPGEFLLASTMEYIKLPEFITAFVEGRSSLGRLGLFINAGWVDAGFEGQITLELYN
DCD_BEUC1       PERLVEVDPDEAVLHPGEFVLGSTHETITLPDDVAARLEGKSSLGRLGLLTHSTAIDPGFTGHVTLELSN
DCD_NANEQ       ENKIIEITENPFIIYPGDFVLASIYEYIKLPRYIAAQLHGKSSIARLGLIIHTSAIDPGYEGHLTLEIFN
DCD_AQUAE       KGVRILEFEEYFDIMPKQFLLATTLEYISLPPYVTAFVEGRSSLGRLGLFINAGWVDAGFEGQITLELFN
DCD_DICTD       PQDLMEIEGKPFFLRPGEFVLGTTIETVKLPDDLVARVDGRSSLGRLGIIVHATAVDPGFCGQITLELSN
DCD_HALLT       EVG--DYEGEEFILHPGDFVLGTTTERVEIPPDLLATVQGRSSLGRLAIVIHATAVDPGYKGQITLELSN
DUT_SIRV1       RENGVDLKGDEFIIYPNEHVLLTTKEYIKLSNDIIAFCNLRSTFARKGLLIPPTIVDAGFEGQLTIELVG
DCD_IGNH4       ELGFMDDEG--IVIKPYEHVLLHTREYIEMPADLVGLVNLKSSFARLGLYIPPTVVDAGFKGEIVIEIIG
DCD_HALWD       EVSTIVSEGDEFILHPGDFVLGTTKERVEIPSDLLATVEGRSSLGRLAVVIHATAVDPGYCGQITLELSN
DCD_DICT6       PQELMEIEGKPFFLRPGEFVLGTTIETVKLPDDLVARVDGRSSLGRLGIIVHATAVDPGFCGQITLELSN
DCD_MICLC       DERLVEVDPDEAILHPGEFVLGSTYEQVTLPDDLAARLEGKSSLGRLGLLTHSTAIDPGFSGHVTLELSN
DCD_METLZ       HTHTQERKGSYFDIQPGQFVLAETLETVTLPDNIVSSIEGKSSVARLGIALHQTGIDAGFSGTITLEMCN
DCD_PROMH       NEALERVMSDEIVLPPGELALAVTLESVTLPDNVVGWLDGRSSLARLGLMVHVTAIDPGWHGHIVLEFFN
DCD_TROWT       EARLVEVENQAFVLHPGEFILGSTCETVSLSNDLAARLEGKSSLGRLGLLTHSTAIDPGFSGQITLELGN
DCD_TROW8       EARLVEVENQAFVLHPGEFILGSTCETVSLSNDLAARLEGKSSLGRLGLLTHSTAIDPGFSGQITLELGN
DCD_METB6       KTSGVEGKADFFDLLPGQFVLAETLECISLPDNIVATIEGKSSIARLGVTLHQTGIDAGFRGSITLEMAN
DCD_NATPD       XXXXXXXXXXXXXLHPGDFVLGTTKERVEIPPDLIAHVEGRSSLGRLAIVVHATACDPGYQGQITLELSN
DCD_METHJ       TVTTEEMTAESIVLHPGQFVLAETMEAIRLPDNIVASIEGKSSIARLGIELHQTGIDAGFAGSITLEMCN
DCD_HAEIN       SAQLESVMSDEIIIPPGTLALATTLESVKLPANIIGWLDGRSSLARLGLMVHVTAIDPGWEGKIVLEFYN
DCD_YERE8       SAALERVMSDEIILPPGELALAVTLESVTIPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_THERP       SRTIVVPDGEPFIMQAGDFALASTREYIELADDLVGRLEGRSSIARLGITVHSTAFEPGWAGTATMELSN
DCD_HAEIE       SAQLESVMSDEILIPPGTLALATTLESVKLPANIIGWLDGRSSLARLGLMVHVTAIDPGWEGKIVLEFYN
DCD_HAEI8       SAQLESVMSDEILIPPGTLALATTLESVKLPANIIGWLDGRSSLARLGLMVHVTAIDPGWEGKIVLEFYN
DCD_HAEIG       SAQLESVMSDEIIIPPGTLALATTLESVKLPANIIGWLDGRSSLARLGLMVHVTAIDPGWEGKIVLEFYN
DCD_YERPY       EINLPE--GEAFFLHPGELALAVTLESVTIPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_YERPS       EINLPE--GEAFFLHPGELALAVTLESVTIPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_YERPP       EINLPE--GEAFFLHPGELALAVTLESVTIPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_YERPN       EINLPE--GEAFFLHPGELALAVTLESVTIPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_YERPG       EINLPE--GEAFFLHPGELALAVTLESVTIPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_YERPE       EINLPE--GEAFFLHPGELALAVTLESVTIPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_YERPB       EINLPE--GEAFFLHPGELALAVTLESVTIPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_YERPA       EINLPE--GEAFFLHPGELALAVTLESVTIPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_YERP3       EINLPE--GEAFFLHPGELALAVTLESVTIPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_SULTO       PAXXXXXXXXXXXXQPYEHVLLTTEEYIELPNDVMAFVNLRSSFARLGLFIPPTIVDAGFKGQITIEVVG
DCD_PSEA6       QEALNTVMSDEISVGPGELALAVTLESVTLPGNIVGWLDGRSSLARLGLMVHVTAIDPGWSGNIVLEFFN
DCD_THEGJ       ----VEEAGNV-IIPPKKHALILTLERVKLPDDVMGDMKIRSSLAREGILGSFAWVDPGWDGNLTLMLFN
DCD_PHOLL       SAALDRVMSDEIILPPGELALAVTLESVTLPDDLVGWLDGRSSLARLGLMVHVTAIDPGWHGQIVLEFYN
DCD_SERP5       SAALDRVMSDEIVLPPGELALAVTLESVTLPNDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_ERWT9       SDEIVLPEGDAFFLHPGELALAVTLESVTLPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_COLP3       EIFIAD--GDAFFLHPGELALAVTYESVTLPDNIVGWLDGRSSLARLGLMVHVTAIDPGWSGQIVLEFYN
DCD_HALSA       ------------ILHPGDFVLGTTKERVEVPRDLVAQVEGRSSLGRLAVVVHATAIDPGFNGRVTLELSN
DCD_HALS3       ------------ILHPGDFVLGTTKERVEVPRDLVAQVEGRSSLGRLAVVVHATAIDPGFNGRVTLELSN
DCD_SODGM       EIQLVE--GEAFFLHPGELALAVTLESVTLPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_PASMU       EQVSAQLESDAFFLHPGELALATTLESVKLPANIIGWLDGRSSLARLGLMVHVTAIDPGWEGRIVLEFFN
DCD_PYRKO       -------SGGVTI-PPKTYALVLTLERIKLPDDVMGDMKLRSSLAREGLIGSFAWVDPGWDGNLTLALFN
DCD_BACHD       ---------ETIVLPPHTFLLATTMETVKLPNHLTAFVEGRSSVGRLGLFINAGWVDPGFNGQITLELFN
DCD_STAMF       DKTLVCEETDEIIINPLEHVLATTLEWVEMPNDLIGFVNLRSTFARYSLYIPPTIIDAGFKGNITIELIG
DCD_PYRHO       ----VEKEGKV-VIPPREYALILTLERVKLPDDVMGDMKIRSSLAREGILGSFAWVDPGWDGNLTLMLYN
DCD_HAEPS       EEMTAQLNDEAFFLHPGELALATTLESVKLPANIVGWLDGRSSLARLGLMVHVTAIDPGWEGKIVLEFFN
DCD_THESM       ----VEEEGKL-VIPPKGHALILTLERVKLPDDVMGDMRLRSTFAREGLLGSFAWVDPGWDGNLTLAFFN
DCD_ERWCT       EINLPE--GEAFFLHPGELALAVTLESVTLPDNLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_ENT38       EVSIVLAEGEAFYLHPGELALAVTFESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGHIVLEFFN
DCD_SHEAM       AEDKIDIKGNAFFLHPGELALAVTLESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFYN
DCD_PECCP       EINLPE--GEAFFLHPGELALAVTLESVTLPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGRIVLEFYN
DCD_PYRFU       ----VEKEGKV-VIPPREYALILTLERIKLPDDVMGDMKIRSSLAREGVIGSFAWVDPGWDGNLTLMLYN
DCD_PSYIN       EEPIIIAKNESFFLHPGELALAVTYENVTLPDDIVGWLDGRSSLARLGLMVHVTAIDPGWSGKIVLEFYN
DCD_HYPBU       REIYYN-----CVVKPYEHVLATTMETVCLPDDLVGLVNVRSTFARYGIFVPPTVIDAGFCGQITIEIIG
DCD_HAES2       EEEIIIGENEAFFLHPGELALATTLEAVKLPANIIGWLDGRSSLARLGLMVHVTAIDPGWEGKIVLEFFN
DCD_HAES1       EEEIIIGENEAFFLHPGELALATTLEAVKLPANIIGWLDGRSSLARLGLMVHVTAIDPGWEGKIVLEFFN
DCD_RHORT       GRDIEALMGHVEVLHPGEFALGITIQRVRLPADVAGRLDGRSSLARLGLMVHATAIDPGWDGRITLEFFN
DCD_MANSM       SAQLDRVMSDEIIIRPGVLALATTLESVRLPDNIIGWLDGRSSLARLGLMVHVTAIDPGWEGRIVLEFYN
DCD_IDILO       -------------IHPGEFALAVTHESITLPADMVGWLDGRSSLARLGLMVHVTAIDPGWSGQIVLEFFN
DCD_HAMD5       NHALDQIMSDKIVLKPGELALAVTLESVTIPDDLVGWLDGRSSLARLGLMVHVTAIDPGWRGQIVLEFYN
DCD_SHISS       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SHIFL       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SHIF8       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SHIBS       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SHIB3       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ESCF3       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECOSE       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECOLC       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECOL5       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECOHS       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECO8A       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECO81       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECO55       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECO27       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECO24       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_CITK8       DEIVLD-EGDAFYLHPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ACTPJ       EEEIIIADGEAFFLHPGELALATTLESVTLPDNVVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFFN
DCD_ACTP7       EEEIIIADGEAFFLHPGELALATTLESVTLPDNVVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFFN
DCD_ACTP2       EEEIIIADGEAFFLHPGELALATTLESVTLPDNVVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFFN
DCD_EDWI9       AEALERVMSDAFFLHPGELALAVTYESVTLPDDLVGWLDGRSSLARLGLMVHVTAIDPGWQGCIVLEFFN
DCD_ECOLI       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECODH       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECOBW       DEIVLD-EGEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ACTSZ       AEQLERVMSDEIIVADNELALATTLESVKLPADIIGWLDGRSSLARLGLMVHVTAIDPGWEGKIVLEFYN
DCD_SALTY       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALTI       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALSV       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALPK       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALPC       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALPB       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALPA       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALNS       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALHS       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALG2       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALEP       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALDC       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALCH       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_SALA4       SAALDRVMSDEIVLPPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_HAEDU       EQEIILAEGEAFFLHPGELALATTLESVKLPDNIVGWLDGRSSLARLGLMVHVTAIDPGWHGKIVLEFFN
DCD_TOLAT       EIYIKD--SEVFILHPGELALAVTHESVTLPDNIVGWLDGRSSLARLGLMVHVTAIDPGWSGRIVLEFYN
DCD_SHELP       QEALDRVMSDKIVIPPGELALAVTHESLTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFFN
DCD_SALAR       SAALDRVMSDEIVLPPGELALAVTYESVTLPPDLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_BUCAP       EKIALDLKKEPFFLKPGALALFSTLENITLPNNLVGWLDGRSSLARLGLMVHVTSIDPGWHGNIVLEFFN
DCD_BAUCH       KKNVTDAEDDTFFLHPGELALAVTMESITLPNNLIGWLDGRSSLARLGLMVHITAIDPGWQGKIVLEIYN
DCD_ALTMD       QEALDHVEGKAFFLHPGELALAITHESVTLPDNIVGWLDGRSSLARLGLMVHVTAIDPGWSGNIVLEFYN
DCD_KLEP7       SEEIVLPEGEAFFLHPGELALAVTYESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_KLEP3       SEEIVLPEGEAFFLHPGELALAVTYESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ENTS8       EVSIVLNDGEAFFLHPGELALAVTYESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWQGCIVLEFYN
DCD_SHIDS       SAALDRVMSDEIVLDPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECOUT       SAALDRVMSDEIVLDPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECOSM       SAALDRVMSDEIVLDPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECOLU       SAALDRVMSDEIVLDPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECOL6       SAALDRVMSDEIVLDPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECOK1       SAALDRVMSDEIVLDPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECO7I       SAALDRVMSDEIVLDPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECO5E       SAALDRVMSDEIVLDPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECO57       SAALDRVMSDEIVLDPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_ECO45       SAALDRVMSDEIVLDPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAIDPGWSGCIVLEFYN
DCD_PYRAB       ----VEKEGKV-IIPPKEYALILTLERIKLPDDIMGDMKIRSSLAREGVLGSFAWVDPGWDGNLTLMLYN
DCD_SHESW       QAALDRVMSEIIEIPPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFYN
DCD_SHESM       QAALDRVMSEIIEIPPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFYN
DCD_SHESA       QAALDRVMSEIIEIPPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFYN
DCD_SHEPC       QAALDRVMSEIIEIPPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFYN
DCD_SHEON       QAALDRVMSEIIEIPPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFYN
DCD_SHEFN       KIEIAD--DQAFFLHPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFFN
DCD_SHEB9       MQAALDRDGEAFFLHPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFYN
DCD_SHEB8       MQAALDRDGEAFFLHPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFYN
DCD_SHEB5       MQAALDRDGEAFFLHPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFYN
DCD_SHEB2       MQAALDRDGEAFFLHPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFYN
DCD_AERHH       EIHVPD--GEAFYLHPGQLALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWSGRIVLEFYN
DCD_PSEHT       NKAMESIEGEAFFLHPGELALAITYEKVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWSGNIVLEFYN
DCD_SHESR       QAALDRVMSEIIEIPPGELALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWQGKIVLEFYN
DCD_AERPE       GEFYECGEGDEIIVGPGEHMLLHTQEYIRLPGYVAGLVNLRSTWARTGIYIPATVVDAGFEGQLTIEVVG
DCD_AERS4       MADAIDRDGEAFYLHPGQLALAVTYESVTLPADIVGWLDGRSSLARLGLMVHVTAIDPGWSGRIVLEFYN
DCD_BUCBP       EKKHIIPNDHVFLLKPGMFVLAITLEKIFLPNNLVGWLDGRSSLARLGLMIHATSIDPGWGGNIVLEFFN
DCD_THEAC       GRQYSEFE-----IGKNVHFLVSTIEILKIPDDVVGMIWTRSSFARKGIFGSFGAIDAGYHGNLTLSFFN
DCD_CLOAB       KTKKLIIPEEGIVLEPRKLYLGRTLEYTETDKYV-PMLEGRSSIGRLGVFIHVTAGDVGFKGYWTLEIFC
DCD_BUCAI       SNEIIFSKEQPCFLQPGSLVLCSTFESIKMPNNLVGWLDGRSSLARLGLMIHATAIDPGWNGNIVLEMFN
DCD_MARMS       EEILVD-DGKPFFIHPGELVLGVTKESVTLPDNLVGWLDGRSSLARLGLMVHVTAIDPGWSGGIVLEFLN
DCD_WIGBR       ---------------PGELVLALTLESITIPDNLIGWLDGRSSLARFGLMVHATSIDPGWSGNIVLEFYN
DCD_METMP       EKYNVD-----CVV--SGGLLGTTNEYVELPNDVCAQYQGRSSFGRVFLQTHQTAIDSGFKGKITLEIV-
DCD_METM5       ETIIKNYKEKYCVV--SGGLLGTTNEYVELPNDVCAQYQGRSSFGRVFLQTHQTAIDSGFKGKITLEIV-
DCD_METM7       ETIIENYKEKYCIV--SGGLLGTTNEYVELPNDVCAQYQGRSSFGRVFLQTHQTAIDSGFRGKITLEIV-
DUT_METKA       EYREVETEGGVFELEPNVPYVLELAPELEIPEDTAVLFLPRSTLLRSGVSVHTALGDPGFRGKIRVLAVN
DCD_METM6       EKYNVD-----CVV--SGGLLGTTNEYVELPNDVCAQYQGRSSFGRVFLQTHQTAIDSGFKGKITLEIV-
DCD_METVS       EKIIERYKEKYCVV--SGGLLGTTNEYVELPNDVCAQYQGRSSFGRVFLQSHQTAIDSGFKGKITLEIV-


                         +         .         .         .         .         *         .:210
query           TTPLPAKIYAGEGCAQVLFFESDEICETSYADRGGKYQGQQGVTLPKT
DCD_RALME       TTPLPAKIYAGEGCAQVLFFESDEICETSYADRGGKYQGQQGVTLPKT
DCD_CUPTR       TTPLPAKIYAGEGCAQVLFFESDEICETSYADRGGKYQGQHGVTLPKT
DCD_RALEJ       TTPLPAKIYAGEGCAQVLFFESDEVCETSYADRGGKYQGQHGVTLPK-
DCD_RALEH       TTPLPAKIYAGEGCAQVLFFESDEVCETSYRDRGGKYQGQHGVTLPKT
DCD_RALSO       TTPLPAKIYAGEGCAQVLFFESDEPCETSYRDRGGKYQGQHGVTLPKT
DCD_RALPJ       TTPLPAKIYAGEGCAQVLFFESDEECETSYKDRGGKYQGQHGVTLPKT
DCD_JANMA       TTPLPAKIYAGEGCAQVLFFESDEVCETSYKDRGGKYQGQHGVTLPKT
DCD_POLSJ       TTPLPAKIYAGEGCAQVLFFESDEVCETSYKDRGGKYQGQQGVTLPK-
DCD_ACIAC       TTPLPARIYAGEGCAQVLFFESDEVCEVSYRDRGGKYQGQVGVTLPK-
DCD_VARPS       TTPLPAKIYAGEGCAQVLFFESDEVCETSYKDRGGKYQGQRGVTLPKT
DCD_HERAR       TTPLPAKIYAGEGCAQVLFFESDEVCEVSYKDRGGKYQGQHGVTLPK-
DCD_BURP8       TTPLPAKIYANEGVAQVLFFESDEICDVSYADRGGKYQGQHGVTLPKT
DCD_BURXL       TTPLPAKIYANEGVAQVLFFESDEICETSYADRGGKYQGQHGVTLPRT
DCD_LEPCP       TTPLPAKIYAGEGCAQVLFFESDEVCETSYRDRGGKYQGQTGVTLPKT
DCD_BURPP       TTPLPAKIYANEGVAQVLFFESDEICETSYADRGGKYQGQHGVTLPKT
DCD_DIAST       TTPLPAKIYAGEGCAQVLFFQGDEECAVSYKDRNGKYQGQHGVTLPK-
DCD_ACISJ       TTPLPAKIYAGEGCAQVLFFQGDEECAVSYKDRNGKYQGQHGVTLPK-
DCD_BURVG       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURS3       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURPS       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURP6       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURP0       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURMS       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURMA       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURM9       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURM7       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURM1       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURCM       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURCJ       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURCH       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURCC       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURCA       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_BURA4       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_RHOFD       TTPLPAKIYAGEGCAQVLFFESDEECETSYKDRGGKYQGQVGVTLPR-
DCD_BURTA       TTPLPAKIYANEGVAQVLFFESDEVCDVSYADRGGKYQGQRGVTLPKT
DCD_DECAR       TTPLPAKIYAGEGCAQVLFFESDEICETSYKDRGGKYQGQEGVTLPK-
DCD_BORPA       TTPLPAKIYAGEGCAQMLFLESDEVCETSYRDRGGKYQGQRGVTLPRT
DCD_BORBR       TTPLPAKIYAGEGCAQMLFLESDEVCETSYRDRGGKYQGQRGVTLPRT
DCD_BORPE       TTPLPAKVYAGEGCAQMLFLESDEVCETSYRDRGGKYQGQRGVTLPRT
DCD_BORPD       TTPLPAKIYAGEGCAQMLFLESDEVCETSYRDRGGKYQGQRGVTLPRT
DCD_CELJU       TTPLPAKIYANEGVAQMLFFESDEICETSYRDRGGKYQGQRGVTLPRT
DCD_BORA1       TTPLPAKIYAGEGCAQMLFLESDEVCETSYRDRGGKYQGQRGVTLPRT
DCD_THISH       TTPLPAKIYANEGVAQMLFLESDEVCETSYKDRGGKYQGQVGVTLPKT
DCD_NITEC       TTPLPAKIYANEGVAQVIFFEADEVCETSYKDRKGKYQFQQGVTLPK-
DCD_NEIMB       TTPLPAKIYAGEGVAQVLFFESDEICETSYKDRNGKYMGQTGVTLPK-
DCD_NEIMA       TTPLPAKIYAGEGVAQVLFFESDEICETSYKDRNGKYMGQTGVTLPK-
DCD_NEIG2       TTPLPAKIYAGEGVAQVLFFESDEVCETSYKDRNGKYMGQTGVTLPK-
DCD_NEIG1       TTPLPAKIYAGEGVAQVLFFESDEVCETSYKDRNGKYMGQTGVTLPK-
DCD_NEIMF       TTPLPAKIYAGEGVAQVLFFESDEICKTSYKDRNGKYMGQTGVTLPK-
DCD_NEIM0       TTPLPAKIYAGEGVAQVLFFESDEICKTSYKDRNGKYMGQTGVTLPK-
DCD_NITMU       TTPLPAKIYANEGVAQVIFFESDEICETSYKDRGGKYQGQHGVTLPK-
DCD_TERTT       TTPLPAKIYANEGIAQMLFFESDEICDTSYRDRGGKYQGQTGVTLPKT
DCD_NITEU       TTPLPAKIYANEGVAQVIFFESDEVCETSYKDRNGKYQFQQGVTLPK-
DCD_MARAV       TTNLPAKIYANEGVAQMLFFESDEICETSYKDRGGKYLGQTGVTLPRT
DCD_LARHH       TTPLPAKIYANEGVAQVLFFESDEVCEVSYRDRGGKYMGQVGVTLPRS
DCD_NITOC       TTPLPAKVYANEGVAQVVFFESDELCETSYRDRSGKYQGQTGVTLPK-
DCD_THIDA       TTPLPARIYANEGVAQMLFLESDEVCETSYRDRGGKYQGQVGVTLPK-
DCD_AZOSB       TTPLPAKIYANEGVAQMLFFESDEECETSYKDRGGKYFGQTGVTLPK-
DCD_FRATW       TTPLPAKIYANEGVAQMLFFQSDEECETSYADKGGKYQGQVGVTLPK-
DCD_FRATT       TTPLPAKIYANEGVAQMLFFQSDEECETSYADKGGKYQGQVGVTLPK-
DCD_FRATO       TTPLPAKIYANEGVAQMLFFQSDEECETSYADKGGKYQGQVGVTLPK-
DCD_FRATN       TTPLPAKIYANEGVAQMLFFQSDEECETSYADKGGKYQGQVGVTLPK-
DCD_FRATM       TTPLPAKIYANEGVAQMLFFQSDEECETSYADKGGKYQGQVGVTLPK-
DCD_FRATH       TTPLPAKIYANEGVAQMLFFQSDEECETSYADKGGKYQGQVGVTLPK-
DCD_FRATF       TTPLPAKIYANEGVAQMLFFQSDEECETSYADKGGKYQGQVGVTLPK-
DCD_FRAT1       TTPLPAKIYANEGVAQMLFFQSDEECETSYADKGGKYQGQVGVTLPK-
DCD_FRAP2       TTPLPAKIYANEGVAQMLFFQSDEECETSYADKGGKYQGQVGVTLPK-
DCD_AZOSE       TTPLPAKIYANEGIAQMLFFEADEVCETSYKDRGGKYLGQTGVTLPK-
DCD_CHRVO       TTPLPAKIYANEGVAQVLFFESDEECDVSYKDRAGKYQGQVGVTLPR-
DCD_PSYA2       TTNLPARIYAGEGVAQMLFFQSDDVCETSYKDRGGKYQGQRGVTLPRT
DCD_CHRSD       TTNLPARIYANEGVAQMLFLESDEVCDVSYKDRGGKYMGQRGVTLPRT
DCD_PSYCK       TTNLPARIYAGEGVAQMLFFQSDDVCETSYKDRGGKYQGQRGVTLPRT
DCD_PSEMY       TTNLPAKIYANEGVAQMLFLQSDEACEVSYKDRGGKYQGQTGVTLPRT
DCD_XANC5       TTPLPARIYANEGVAQMLFFQSDEVCETSYKDRGGKYQGQTGVTLPRT
DCD_PSYWF       TTTLPARIYAGEGVAQMLFFQSDDICETSYKDRGGKYQGQRGVTLPRT
DCD_XANAC       TTPLPARIYANEGVAQMLFFQSDEVCETSYKDRGGKYQGQTGVTLPRT
DCD_PSESM       TTTLPAKIYANEGVAQMLFLESDEECEVSYKDRGGKYQGQRGVTLPRT
DCD_ACIBT       TTNLPARIYAGEGVAQMLFFESDEICETSYKDRGGKYQGQTGVTLPKT
DCD_XANCP       TTPLPARIYANEGVAQMLFFQSDEVCETSYKDRGGKYQGQTGVTLPRT
DCD_XANCB       TTPLPARIYANEGVAQMLFFQSDEVCETSYKDRGGKYQGQTGVTLPRT
DCD_XANC8       TTPLPARIYANEGVAQMLFFQSDEVCETSYKDRGGKYQGQTGVTLPRT
DCD_ACIBY       TTNLPARIYAGEGVAQMLFFESDEVCETSYKDRGGKYQGQTGVTLPKT
DCD_ACIBS       TTNLPARIYAGEGVAQMLFFESDEVCETSYKDRGGKYQGQTGV