[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF09694.1

[Show Plain Result]


## Summary of Sequence Search
    1::289
    3::285     3e-54  40%  292 aa  GLXR_ECOLI RecName: Full=2-hydroxy-3-oxopropionate reductase;      
    3::280     5e-52  38%  294 aa  GARR_ECOLI RecName: Full=2-hydroxy-3-oxopropionate reductase;      
    3::280     5e-52  38%  294 aa  GARR_ECOL6 RecName: Full=2-hydroxy-3-oxopropionate reductase;      
    1::287     4e-50  39%  291 aa  Y1503_SHEFN RecName: Full=Uncharacterized oxidoreductase Sfri_1503;
    4::285     1e-42  34%  288 aa  YKWC_BACSU RecName: Full=Uncharacterized oxidoreductase ykwC;      
    3::279     2e-41  38%  290 aa  Y229_SYNY3 RecName: Full=Uncharacterized oxidoreductase slr0229;   
    1::263     5e-41  36%  298 aa  MMSB_PSEAE RecName: Full=3-hydroxyisobutyrate dehydrogenase;       
   40::338     6e-41  36%  347 aa  3HIDH_ARATH RecName: Full=Probable 3-hydroxyisobutyrate
   24::307     4e-40  35%  321 aa  3HIDH_DICDI RecName: Full=Probable 3-hydroxyisobutyrate
   31::318     1e-38  36%  324 aa  3HIDH_DROME RecName: Full=Probable 3-hydroxyisobutyrate
   39::329     3e-37  34%  335 aa  3HIDH_MOUSE RecName: Full=3-hydroxyisobutyrate dehydrogenase,
    1::247     4e-36  40%  294 aa  MMSB_MYCTU RecName: Full=Probable 3-hydroxyisobutyrate
    1::247     4e-36  40%  294 aa  MMSB_MYCBO RecName: Full=Probable 3-hydroxyisobutyrate
   39::329     4e-36  34%  335 aa  3HIDH_RAT RecName: Full=3-hydroxyisobutyrate dehydrogenase,
   40::330     2e-35  35%  336 aa  3HIDH_BOVIN RecName: Full=3-hydroxyisobutyrate dehydrogenase,
   40::330     3e-35  34%  336 aa  3HIDH_PONAB RecName: Full=3-hydroxyisobutyrate dehydrogenase,
   40::330     3e-35  34%  336 aa  3HIDH_HUMAN RecName: Full=3-hydroxyisobutyrate dehydrogenase,
    1::264     1e-33  33%  299 aa  3HIDH_CAEEL RecName: Full=Probable 3-hydroxyisobutyrate
    1::288     1e-30  29%  298 aa  YIHU_SALTY RecName: Full=Uncharacterized oxidoreductase yihU;      
    1::284     7e-27  28%  298 aa  YIHU_SHIFL RecName: Full=Uncharacterized oxidoreductase yihU;      
    1::284     7e-27  28%  298 aa  YIHU_ECOLI RecName: Full=Uncharacterized oxidoreductase yihU;      
  251::509     7e-27  29%  534 aa  GLYR1_XENTR RecName: Full=Putative oxidoreductase GLYR1;       
    3::286     2e-26  28%  286 aa  YFJR_BACSU RecName: Full=Uncharacterized oxidoreductase yfjR;      
  270::528     6e-26  27%  553 aa  GLYR1_CHICK RecName: Full=Putative oxidoreductase GLYR1;       
  269::527     8e-26  27%  552 aa  GLYR1_RAT RecName: Full=Putative oxidoreductase GLYR1;       
  270::528     8e-26  27%  553 aa  GLYR1_HUMAN RecName: Full=Putative oxidoreductase GLYR1;       
  270::528     8e-26  27%  553 aa  GLYR1_BOVIN RecName: Full=Putative oxidoreductase GLYR1;       
  285::560     2e-25  25%  566 aa  GLYR1_ANOGA RecName: Full=Putative oxidoreductase GLYR1 homolog;   
  270::528     6e-25  27%  553 aa  GLYR1_PONAB RecName: Full=Putative oxidoreductase GLYR1;       
  278::553     8e-25  25%  559 aa  GLYR1_AEDAE RecName: Full=Putative oxidoreductase GLYR1 homolog;   
    9::291     1e-23  26%  302 aa  YGBJ_ECOLI RecName: Full=Uncharacterized oxidoreductase ygbJ;      
  269::521     1e-23  28%  546 aa  GLYR1_MOUSE RecName: Full=Putative oxidoreductase GLYR1;       
  317::596     1e-21  25%  602 aa  GLYR1_DROME RecName: Full=Putative oxidoreductase GLYR1 homolog;   
   82::290     3e-21  27%  301 aa  Y1010_HAEIN RecName: Full=Uncharacterized oxidoreductase HI1010;   
  196::437     2e-19  27%  462 aa  GLYR1_DANRE RecName: Full=Putative oxidoreductase GLYR1;       
  340::606     3e-17  23%  612 aa  GLYR1_DROPS RecName: Full=Putative oxidoreductase GLYR1 homolog;   
    6::234     3e-10  30%  468 aa  6PGD_KLEPN RecName: Full=6-phosphogluconate dehydrogenase,
    6::200     1e-09  33%  468 aa  6PGD9_ECOLX RecName: Full=6-phosphogluconate dehydrogenase,
    6::234     2e-09  30%  468 aa  6PGD_SHIFL RecName: Full=6-phosphogluconate dehydrogenase,
    6::234     3e-09  30%  468 aa  6PGD_ECOLI RecName: Full=6-phosphogluconate dehydrogenase,
   10::186     4e-09  24%  295 aa  Y770_MYCTU RecName: Full=Uncharacterized oxidoreductase
    6::234     5e-09  29%  468 aa  6PGD_SALTY RecName: Full=6-phosphogluconate dehydrogenase,
    6::246     2e-08  28%  469 aa  6PGD2_BACSU RecName: Full=6-phosphogluconate dehydrogenase,
    3::223     5e-08  30%  445 aa  6PGD_KLETE RecName: Full=6-phosphogluconate dehydrogenase,
    3::223     7e-08  31%  445 aa  6PGD_SHISO RecName: Full=6-phosphogluconate dehydrogenase,
    3::223     7e-08  31%  445 aa  6PGD_SHIDY RecName: Full=6-phosphogluconate dehydrogenase,
    3::223     7e-08  31%  445 aa  6PGD_SHIBO RecName: Full=6-phosphogluconate dehydrogenase,
    3::223     7e-08  30%  445 aa  6PGD_KLEPL RecName: Full=6-phosphogluconate dehydrogenase,
    3::223     7e-08  31%  445 aa  6PGD_CITDI RecName: Full=6-phosphogluconate dehydrogenase,
    3::223     7e-08  31%  445 aa  6PGD_CITAM RecName: Full=6-phosphogluconate dehydrogenase,
    3::223     9e-08  31%  445 aa  6PGD_ESCVU RecName: Full=6-phosphogluconate dehydrogenase,
    7::284     5e-07  26%  484 aa  6PGD_HAEIN RecName: Full=6-phosphogluconate dehydrogenase,
    3::223     6e-07  30%  445 aa  6PGD_CITFR RecName: Full=6-phosphogluconate dehydrogenase,
  115::283     8e-07  29%  479 aa  6PGD_TRYBB RecName: Full=6-phosphogluconate dehydrogenase,
  112::235     8e-07  28%  468 aa  6PGD_STAES RecName: Full=6-phosphogluconate dehydrogenase,
  112::235     8e-07  28%  468 aa  6PGD_STAEQ RecName: Full=6-phosphogluconate dehydrogenase,
    8::238     8e-07  26%  493 aa  6PGD_DICDI RecName: Full=6-phosphogluconate dehydrogenase,
   94::244     1e-06  30%  472 aa  6PGD_LACLA RecName: Full=6-phosphogluconate dehydrogenase,
    6::200     1e-06  25%  484 aa  6PGD_CAEEL RecName: Full=6-phosphogluconate dehydrogenase,
    7::205     1e-06  27%  484 aa  6PGD_ACTAC RecName: Full=6-phosphogluconate dehydrogenase,
  115::244     2e-06  30%  472 aa  6PGD_LACLM RecName: Full=6-phosphogluconate dehydrogenase,
    3::199     3e-06  25%  479 aa  6PGD_CHLPN RecName: Full=6-phosphogluconate dehydrogenase,
    5::243     5e-06  27%  488 aa  6PGD_TREPA RecName: Full=6-phosphogluconate dehydrogenase,
  112::235     5e-06  29%  468 aa  6PGD_STAAW RecName: Full=6-phosphogluconate dehydrogenase,
  112::235     5e-06  29%  468 aa  6PGD_STAAS RecName: Full=6-phosphogluconate dehydrogenase,
  112::235     5e-06  29%  468 aa  6PGD_STAAR RecName: Full=6-phosphogluconate dehydrogenase,
  112::235     5e-06  29%  468 aa  6PGD_STAAN RecName: Full=6-phosphogluconate dehydrogenase,
  112::235     5e-06  29%  468 aa  6PGD_STAAM RecName: Full=6-phosphogluconate dehydrogenase,
  112::235     5e-06  29%  468 aa  6PGD_STAAC RecName: Full=6-phosphogluconate dehydrogenase,
    1::74      7e-06  27%  341 aa  GPDA1_SALRD RecName: Full=Glycerol-3-phosphate dehydrogenase
    7::205     9e-06  27%  484 aa  6PGD_HAEDU RecName: Full=6-phosphogluconate dehydrogenase,
    5::200     1e-05  27%  480 aa  6PGD_CHLTR RecName: Full=6-phosphogluconate dehydrogenase,
    6::199     1e-05  28%  479 aa  6PGD_CHLMU RecName: Full=6-phosphogluconate dehydrogenase,
    4::245     1e-05  23%  467 aa  6PGD_BACLI RecName: Full=6-phosphogluconate dehydrogenase,
    6::199     3e-05  24%  473 aa  6PGD_BUCAP RecName: Full=6-phosphogluconate dehydrogenase,
    8::108     3e-05  38%  349 aa  GPDA_RHORT RecName: Full=Glycerol-3-phosphate dehydrogenase
    6::113     3e-05  29%  334 aa  GPDA_MYCTU RecName: Full=Glycerol-3-phosphate dehydrogenase
    6::113     3e-05  29%  334 aa  GPDA_MYCBO RecName: Full=Glycerol-3-phosphate dehydrogenase
    7::296     4e-05  25%  340 aa  GPDA_AZOVD RecName: Full=Glycerol-3-phosphate dehydrogenase
   94::199     7e-05  29%  468 aa  6PGD_BUCBP RecName: Full=6-phosphogluconate dehydrogenase,
    1::168     1e-04  28%  340 aa  GPDA_BACCR RecName: Full=Glycerol-3-phosphate dehydrogenase
    1::168     1e-04  28%  340 aa  GPDA_BACC4 RecName: Full=Glycerol-3-phosphate dehydrogenase
    4::308     1e-04  26%  335 aa  GPDA_MOOTA RecName: Full=Glycerol-3-phosphate dehydrogenase
    1::78      1e-04  35%  332 aa  GPDA_CORK4 RecName: Full=Glycerol-3-phosphate dehydrogenase
    4::245     1e-04  22%  468 aa  6PGD_BACSU RecName: Full=6-phosphogluconate dehydrogenase,
    1::112     2e-04  33%  341 aa  GPDA_PSESM RecName: Full=Glycerol-3-phosphate dehydrogenase
    1::168     2e-04  27%  341 aa  GPDA_BACCN RecName: Full=Glycerol-3-phosphate dehydrogenase
  113::199     2e-04  32%  468 aa  6PGD_BUCAI RecName: Full=6-phosphogluconate dehydrogenase,
    4::109     2e-04  28%  334 aa  GPDA_CHLMU RecName: Full=Glycerol-3-phosphate dehydrogenase
    1::112     4e-04  34%  341 aa  GPDA_PSEU2 RecName: Full=Glycerol-3-phosphate dehydrogenase
    1::292     4e-04  26%  337 aa  GPDA_LACF3 RecName: Full=Glycerol-3-phosphate dehydrogenase
    1::169     4e-04  30%  341 aa  GPDA_EXISA RecName: Full=Glycerol-3-phosphate dehydrogenase
    1::53      5e-04  36%  313 aa  FMT_ENTFA RecName: Full=Methionyl-tRNA formyltransferase;        
    9::104     6e-04  33%  344 aa  GPDA_THICR RecName: Full=Glycerol-3-phosphate dehydrogenase
 1107::1290    8e-04  31% 2541 aa  TLN1_MOUSE RecName: Full=Talin-1;
    1::168     8e-04  27%  340 aa  GPDA_BACC2 RecName: Full=Glycerol-3-phosphate dehydrogenase
    1::289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTTVAFIGLGAMGAPMVGHLIRAGHTVRAFVRRPEAADAARQLGAEPFFTPAEAAQGAAVVFTNVTSSED
GLXR_ECOLI      ---LGFIGLGIMGTPMAINLARAGHQLHVTTIGP-VADELLSLGAVSVETARQVTEASDIIFIMVPDTPQ
GARR_ECOLI      ---VGFIGLGIMGKPMSKNLLKAGYSLVVADRNPEAIADVXXXXXXXXXXXXXXXXQCDVIITMLPNSPH
GARR_ECOL6      ---VGFIGLGIMGKPMSKNLLKAGYSLVVADRNPEAIADVXXXXXXXXXXXXXXXXQCDVIITMLPNSPH
Y1503_SHEFN     MAKVAFIGLGVMGFPMAGHLVKQGHDVTVYNRTAKATQWVEQYGGKKADTPKDAAQGQDIVFTCVGNDDD
YKWC_BACSU      --TIGFIGLGVMGKSMASHILNDGHPVLVYTRTKEKAESILQKGAIWKDTVKDLSKEADVIITMVGYPSD
Y229_SYNY3      VSKIAVFGLGVMGSPMAQNLVKNGYQTVGYNRRPSVQEAAKA-GVKVVTSIAVAAANADIILTCVGDEKD
MMSB_PSEAE      MTDIAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEVVISMLPAGQH
3HIDH_ARATH     ---VGFIGLGNMGFRMVNNLIRAGYKVTVHDINRDVMKMFTEMGVSSRETPYEVAQDSEVVITMLPSSSH
3HIDH_DICDI     --TVGFIGLGNMGGHQAINLIKKGHNLIVFDMSKDNMNRLKEKGAKIANSPAEVAKEADVIVTMLPASAH
3HIDH_DROME     ---IGFVGLGNMGANMASNLIKAGHKLHVFDISKPACDGLAAKGATVYAKTSELAKNSDFVITMLPNNAI
3HIDH_MOUSE     -TPVGFIGLGNMGNPMAKNLMKHGYPLILYDVFPDVCKEFKEAGEQVASSPAEVAEKADRIITMLPSSMN
MMSB_MYCTU      MTTIAFLGLGNMGAPMSANLVGAGHVVRGFDXXXXXXXXXXXXXXXXFRSAPEAVAEADVVITMLPTGEV
MMSB_MYCBO      MTTIAFLGLGNMGAPMSANLVGAGHVVRGFDXXXXXXXXXXXXXXXXFRSAPEAVAEADVVITMLPTGEV
3HIDH_RAT       -TPVGFIGLGNMGNPMAKNLIKHGYPLILYDVFPDVCKEFKEAGEQVASSPADVAEKADRIITMLPSSMN
3HIDH_BOVIN     -TPVGFIGVGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFLDAGEQVVSSPADVAEKADRIITMLPTSIN
3HIDH_PONAB     -TPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSIN
3HIDH_HUMAN     -TPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSIN
3HIDH_CAEEL     MSLTGFIGLGNMGGHMARNLIKNGKKLIVYDVNKAVVQEFKAEGCEVAAHPADIAAASKEIITVLPSSPH
YIHU_SALTY      MAVIAFIGLGQMGSPMASNLLKQGHQLSVFDVNPDAVQRLVDKGAQPASSPAQATIGAEFVITMLPNGDL
YIHU_SHIFL      MAAIAFIGLGQMGSPMASNLLQQGHQLRVFDVNAEAVRHLVDKGXXXXXXXXXXXXXXEFIITMLPNGDL
YIHU_ECOLI      MAAIAFIGLGQMGSPMASNLLQQGHQLRVFDVNAEAVRHLVDKGXXXXXXXXXXXXXXEFIITMLPNGDL
GLYR1_XENTR     ---IGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGAHMGRTPAEVVSTCDITFACVADPKA
YFJR_BACSU      ---IAVIGLGNMGQPIARNVLQAGYELTVYNRTKQKTEDLVTEGAQAADTPRLAAKSADIVITMLADDDS
GLYR1_CHICK     ---IGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKA
GLYR1_RAT       ---IGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKA
GLYR1_HUMAN     ---IGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKA
GLYR1_BOVIN     ---IGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKA
GLYR1_ANOGA     -----FLGLGVMGCGIVKNLIKSGHSVVVWNRSAHKCRKFQEVGAEVADTPSDVVEMTDVTYSCVSDPQV
GLYR1_PONAB     ---IGFLGLGLMGSGIVSNLLKMGHTVTVWDRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKA
GLYR1_AEDAE     -----FLGLGIMGCGMVKNLLNSGHSVVVWNRTATKCRKFQEAGAEVADTPSDVIEMTDVTFSCVADPQV
YGBJ_ECOLI      ---VGIVGLGSMGMGAALSYVRAGLSTWGADLNSNACATLKEAGACGVSDNAATAEXXXXXXXXXXXXXX
GLYR1_MOUSE     ---IGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKEGA--RLGR----TPAEVVSTCDITFACVSDPKA
GLYR1_DROME     --TFGFLGLGMMGSTIVKDLIYTGHKVVVWNRTIDKCQPFAEAGAEVKDTPMDVVEAADVIFCCVSDPKG
Y1010_HAEIN     ----------------------------------------------------------------------
GLYR1_DANRE     ---------------------KMGHVVTVWNRTAEKCDLFIQEGARLGRTPAEVVSMCDITFSCVSDPKA
GLYR1_DROPS     ---------------IVKDLIYTGHKVVVWNRTIDKCQPFVEAGAEVKDTPMDVVEAADIIFCCVSDPKG
6PGD_KLEPN      ---IGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEAENTGKKPYYTVQEF----------VESLET
6PGD9_ECOLX     ---IGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEAENPGKKPYYTVQEF----------VESLET
6PGD_SHIFL      ---IGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEAENPGKKPYYTVKEF----------VESLET
6PGD_ECOLI      ---IGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEAENPGKKPYYTVKEF----------VESLET
Y770_MYCTU      ---LGYIGLGNQGAPMAKRLLDWPGGLTVFDVRVEAM-APFVEGGXXXXXXXXXXXXXXIISITVFDDAQ
6PGD_SALTY      ---IGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEAENPGKKPYYTVKEF----------VESLET
6PGD2_BACSU     ---IGVIGLAVMGKNLALNIESRGFSVSVYNRSSSKTEEFLQ-----------EAKGKNVVGTYVQSLET
6PGD_KLETE      -----------MGRNLALNIESRGYTVSVFNRSREKTE---EVIAE---NPGKKLVPHYTVKEFVESLET
6PGD_SHISO      -----------MGRNLALNIESRGYTVSIFNRSREKTEEAENPGKKPYYTVKEF----------VESLET
6PGD_SHIDY      -----------MGRNLALNIESRGYTVSIFNRSREKTEEAENPGKKPYYTVKEF----------VESLET
6PGD_SHIBO      -----------MGRNLALNIESRGYTVSIFNRSREKTEEAENPGKKPYYTVKEF----------VESLET
6PGD_KLEPL      -----------MGRNLALNIESRGYTVSVFNRSREKTE---EVIAE---NPGKKLVPHYTVKEFVESLET
6PGD_CITDI      -----------MGRNLALNIESRGYTVSVFNRSREKTEEAENPGKKPYYTVKEF----------VESLET
6PGD_CITAM      -----------MGRNLALNIESRGYTVSVFNRSREKTEEAENPGKKPYYTVQEF----------VESLET
6PGD_ESCVU      -----------MGRNLALNIESRGYTVSVFNRSREKTEVAENPGKKPYYTVQEF----------VESLET
6PGD_HAEIN      ---IGVIGLAVMGQNLILNMNDHGFKVVAYNRTTSKVDEFLQIGAYSLEDLAAKLEKPRKVMLMVRAGDV
6PGD_CITFR      -----------MGRNLALNIESRGYTVSIFNRSREKTEVAENPGKKPYYTVKEF----------VESLET
6PGD_TRYBB      ----------------------------------------------------------------------
6PGD_STAES      ----------------------------------------------------------------------
6PGD_STAEQ      ----------------------------------------------------------------------
6PGD_DICDI      ---IGLIGLAVMGENLVLNMESRGFTCSVYNRTTSKVDEFVQIGCHSLETLVQSLKTPRRVMLMVKAGEV
6PGD_LACLA      ----------------------------------------------------------------------
6PGD_CAEEL      ---IAVIGLAVMGQNLILNMNDHGFTVCAFNRTVKLVDGTKIIGAHSIEEMCKKLKRPRRVMMLIKAGTP
6PGD_ACTAC      ---IGVIGLAVMGQNLILNMNDHGFKVVAYNRTTSAAKGTNIIGAYSLEDLANKLEKPRKVMLMVRAGEV
6PGD_LACLM      ----------------------------------------------------------------------
6PGD_CHLPN      -TNIGLIGLAVMGKNLVLNMIDHGFSVSVYNRTPEKTNHRELVGFESLEDFVNSLERPRKIMLMIQAGKP
6PGD_TREPA      ---IGFIGLAVMGENLVLNIERNGFSVAVFNRTTTVVDAGRAHG--------KRITGAHSIAELVSLLAR
6PGD_STAAW      ----------------------------------------------------------------------
6PGD_STAAS      ----------------------------------------------------------------------
6PGD_STAAR      ----------------------------------------------------------------------
6PGD_STAAN      ----------------------------------------------------------------------
6PGD_STAAM      ----------------------------------------------------------------------
6PGD_STAAC      ----------------------------------------------------------------------
GPDA1_SALRD     MSSITLFGAGSWGTAMSVHLASAGRDVVLWARRPEVADEIRRTSHNPTYLPELLIPSSVYITTDLEKAAE
6PGD_HAEDU      ---IGVIGLAVMGQNLILNMNDNGFKVVAYNRTASKVDETNIIGAYSLEDLAAKLEKPRKIMLMVRAGEV
6PGD_CHLTR      -TDIGLIGLAVMGKNLVLNMVDHGFSVSVYNRSPAKTEEFLKDHGE-----SGALQGFTTIQEFVQSLKR
6PGD_CHLMU      ---IGLIGLAVMGKNLVLNMIDHGFAVSVYNRSPEKTEEFLKEHGENI-----SLQGFTAIEEFVQSLKR
6PGD_BACLI      --TIGVIGLGVMGSNIALNMASKGEQVAVYNYTRDLTDQLVQKTGKPYYELEDFVQSLEKIFLMVTAGKP
6PGD_BUCAP      ---VGVIGMAVMGRNLALNIESKKYTVSIFNRTQSVTEEVINNNKEPYFSIKDSLRKPRCILLMVKSGQP
GPDA_RHORT      ---IAVIGGGAWGTALAQTSRRAGRRVTLWAREPEVARAINATHENPDFLPAEALRGAEAVLV-VCPAQA
GPDA_MYCTU      -STVAVMGAGAWGTALAKVLADAGGEVTLWARRAEVADQINTTRYNPDYLP------GALLPPSIHATAD
GPDA_MYCBO      -STVAVMGAGAWGTALAKVLADAGGEVTLWARRAEVADQINTTRYNPDYLP------GALLPPSIHATAD
GPDA_AZOVD      ---IAVLGGGSFGTALANLLAENGHVVRLWMRDPEQAEAIRTRGIEPVTDLAATVSASELIFV-VLPSSA
6PGD_BUCBP      ----------------------------------------------------------------------
GPDA_BACCR      MTKITVVGAGSWGTALAMVLADNGHDVRIWGNRPELMDEINTKHENSRYLPGITLPSTIVAYSSVVPTKA
GPDA_BACC4      MTKITVVGAGSWGTALAMVLADNGHDVRIWGNRPELMDEINTKHENSRYLPGITLPSTIVAYSSVVPTKA
GPDA_MOOTA      --SIAVLGAGSWGTALAVLLAHKGFRVNLWARRPELATALRETGENKTYLPGAAVKGAGLVVLSVRSTAR
GPDA_CORK4      MVAVAVMGAGSWGTTMTKVFADAGNTVRLWARRDEVADEIQSTRRNQCYLP------GVVIPDAVTATSD
6PGD_BACSU      --SIGVIGLGVMGSNIALNMANKGENVAVYNYTRDLTDQLIQKSLSPYYELEDFVQSLEKIFLMVTAGKP
GPDA_PSESM      MTTVAVLGGGSFGTAIANLLAENGHQVRQWMRDPEQAEAIRVNRENPRYLKGIKVRPEVEPVTDLTAALE
GPDA_BACCN      MTKITVIGAGSWGTALAMVLADNGHDVRIWGNRPELMDEINTKHENKRYLPGITLPSTIVAYSSVVPTKA
6PGD_BUCAI      ----------------------------------------------------------------------
GPDA_CHLMU      --TIAYLGMGMWGFSLANLLANNGHRVVGWARNPEQLSTQRQHPAAPHVT----------IPSNLSFTSS
GPDA_PSEU2      MTTVAVLGGGSFGTAIANLLAENGHQVRQWMRDPEQAEAIRVNRENPRYLKGIRIRPEVEPVTDLTAVLD
GPDA_LACF3      MKKVAVLGAGSWGSVLANLLVENGHQVMLWSRNQAQVDQLNQEHKNPHYSDMQAAVSGAAVILMVIPTKG
GPDA_EXISA      MANVAVIGAGSWGTAISLVLADNGHDVLLYGREQEHVDEINSSHTNSFYLKKEALDGRSIVFLVVPSSA-
FMT_ENTFA       MTKIVFMGTPAFSVPILESLIEAGYDVQAVVTQPD-----RPVGRKKVITPTPVKEAA------------
GPDA_THICR      --TIAVLGAGAWGSALAIHLSRIGHQVKLWDHNPEARENVRYLKGVPFPDALSVQSDLKVTLADVDASQA
TLN1_MOUSE      ----------------------------------------------------------------------
GPDA_BACC2      MTKITVVGAGSWGTALAMVLADNGHDVRIWGNRSELMDEMNTKHENSRYLPGITLPSTIVAYSSVVPTKA


                         .         .         *         .         .         .         .:140
query           VREVLLGRNGVVEGAAPGTICVDHSTISPIVTREIAQALAACGIEALDCPVSGGTVGAQAATLTIMVGGK
GLXR_ECOLI      VEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVSGGEIGAREGTLSIMVGGD
GARR_ECOLI      VKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISEALKAKGIDMLDAPVSGGEPKAIDGTLSVMVGGD
GARR_ECOL6      VKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISEALKAKGIDMLDAPVSGGEPKAIDGTLSVMVGGD
Y1503_SHEFN     LRQVVLGEHGIVHGMHAGAILVDHTTASADVAREIAAYIEPLNIAFLDAPVSGGQAGAENGALTVMMGGD
YKWC_BACSU      VEEVYFGSNGIIENAKEGAYLIDMTTSKPSXXXXXXXXXXXXXXXXXXXPVSGGDIGAQNGTLAIMVGGE
Y229_SYNY3      VQQLILGSGGIAEYAKPQALIIDCSTIGKTAAYELATNLKLQGLRFLDAPVTGGDVGAINGTLTIMVGGD
MMSB_PSEAE      VESLYLGDDGLLARVAGKPLLIDCSTIXXXXXXXXXXXXXXXGLTLLDAPVSGGVGGARAGTLSFIVGGP
3HIDH_ARATH     VMDVYTGTNGLLENDIRPALFIDSSTIDPQTTRKISLAVSNCNLKELDAPVSGGVLAAEAGTLTFMVGGP
3HIDH_DICDI     VKNVYCGENGIFQTVRPGTLLLDSSTIDPATAREVASIAKKHQSTMLDCPVSXXXXXXXXXXLTFMVGGS
3HIDH_DROME     VDASY--DEMTADGVNKDTIFIDSSTISPDLVKSLQKKISAKGARFIDAPVSGGVPGAEQATLTFMVGGT
3HIDH_MOUSE     AVEVYSGANGILKKVKKGSLLIDSSTIDPSVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGV
MMSB_MYCTU      VRRCY---TDVLAAARPATLFIDSSTISVTDAREVHALAESHGMLQLDAPVSGGVKGAAAATLAFMVGGD
MMSB_MYCBO      VRRCY---TDVLAAARPATLFIDSSTISVTDAREVHALAESHGMLQLDAPVSGGVKGAAAATLAFMVGGD
3HIDH_RAT       SIEVYSGANGILKKVKKGSLLIDSSTIDPSVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGV
3HIDH_BOVIN     AIEAYSGANGILKKVKKGSLLIDSSTIDPMVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGV
3HIDH_PONAB     AIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGV
3HIDH_HUMAN     AIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGV
3HIDH_CAEEL     VKAVYQGEAGIFKTIQPGTLCMDSSTIDQIVSLEVAQAAALLKAEYIDAPISGGVTGAQQATLTFMVGGN
YIHU_SALTY      VRSVLFGEQGVCETLSREALVIDMSTIHPLQTDNLIADMQSKGFSMMDVPIGRTSDNXXXXXXXXXXXXX
YIHU_SHIFL      VRNVLFGENGVCEGLSTDALVIDMSTIHPLQTDKLIADMQAKGFSMMDVPVGRTSANXXXXXXXXXXXXX
YIHU_ECOLI      VRNVLFGENGVCEGLSTDALVIDMSTIHPLQTDKLIADMQAKGFSMMDVPVGRTSANXXXXXXXXXXXXX
GLYR1_XENTR     AKDLVLGPSGVLQGIRPGKCYVDMSTVDPETVAELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGD
YFJR_BACSU      VSTVTFGEDGLLEGLAENGIHISMSTISVEFSEKLAAAHAEKGQFFLAAPVLGRPDXXXXXXLRIITAGP
GLYR1_CHICK     AKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGD
GLYR1_RAT       AKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGD
GLYR1_HUMAN     AKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGD
GLYR1_BOVIN     AKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGD
GLYR1_ANOGA     AKDMVFGNCGVMSANLAGKGYVEMTGVDPETSNDINEAIISKGGRYLEAQIQGSKNQAEEGTLIILASGD
GLYR1_PONAB     AKDLVLGPSGVLQGIRPRKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGD
GLYR1_AEDAE     AKELVFGNCGVMSANLVGKGYVEMTGVDPETSHDIAEQIIAKGGRYLEAQIQGSKNQAEEGTLIILAAGE
YGBJ_ECOLI      XXXXXFGETGVAQHLKPGTAVMVSSTIASADAQEIATALAGFDLEMLDAPVSGGAVKAANGEMTVMASGS
GLYR1_MOUSE     AKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGD
GLYR1_DROME     AKDLVFGNCGVLQKDLNNKAYVEMSTIDPDTSLDIGEGIKQCNGRYLEAQIHGSRQEAAEGMLIILAGGD
Y1010_HAEIN     ------GENGIAKKLKAGTAVMVSSTMAAQDAQIISQKLTELGLIMLDAPVSGGAAKALKGEMTVMASGS
GLYR1_DANRE     ARDLVLGPSGVLQGIRPGKCYVEMSTVDPETITELSQVITSRGGRFLEAPVSGSQQLSNDGMLVIVAAGD
GLYR1_DROPS     AKDLVFGNCGVLQKDLRNKAYVEMSTVDPDTSLDIGEGIKQCNGRYLEAQIHGSRQEAADGMLIILAGGD
6PGD_KLEPN      PRRILLGTDSAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD9_ECOLX     PRRILLGTDSAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_SHIFL      PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_ECOLI      PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
Y770_MYCTU      VSSVITADNGLATHAKPGTIVAIHSTIADTTAVDLAEKLKPQGIHIXXXXXXXXXXXXXXXXXXXXXGAD
6PGD_SALTY      PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD2_BACSU     PRKILLATDATIQSLLPDDILIDGGNTYYKDTQRRNKELAESGIHFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_KLETE      PRRILLGTDSAIDSLKPGDIIIDGGNTFFQDTIRRNRELSADGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_SHISO      PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_SHIDY      PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_SHIBO      PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_KLEPL      PRRILLGTDSAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_CITDI      PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_CITAM      PRRILLGTDSAIDSLKPGDIIIDGGNTFFQDTIRRNRELSEEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_ESCVU      PRRILLGTDAAINSLKPGDIIIDGGNTFFHDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_HAEIN      VDQFI---EALLPHLEEGDIIIDGGNSNYPDTNRRVKALAEKGIRFIGSGVSGGEEGARHGP-SIMPGGN
6PGD_CITFR      PRRILLGTDAAIDSLKPGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGP-SIMPGGQ
6PGD_TRYBB      -----------------------------------AQQLEAAGLRFLGMGISGGEEGARKGP-AFFPGGT
6PGD_STAES      ------------------------------------KALAESSINFIGMGVSGGEIGALTGP-SLMPGGQ
6PGD_STAEQ      ------------------------------------KALAESSINFIGMGVSGGEIGALTGP-SLMPGGQ
6PGD_DICDI      VDHFIQLLLPLLE---KGDIIIDGGNSLYTDSDRRTKDLDAKGILFIGTGVSGGEEGALLGP-SIMPGGN
6PGD_LACLA      -----------------GDILIDGNTHFPDTMRRNAE-LADSGINFIGTGVSGGEKGALLGP-SMMPGGQ
6PGD_CAEEL      VDMMI---DAIVPHLEEGDIIIDGGNSEYTDSNRRSEQLAAKGIMFVGCGVSGGEEGARFGP-SLMPGGN
6PGD_ACTAC      VDHFI---DALLPHLEAGDIIIDGGNSNYPDTNRRVAALREKGIRFIGTGVSGGEEGARHGP-SIMPGGN
6PGD_LACLM      --------------------------------------LADSGINFIGTGVSGGEKGALLGP-SMMPGGQ
6PGD_CHLPN      VDQSI---HALLPFLEPGDVIIDGGNSYFKDSERRCKELQEKGILFLGVGISGGEEGARHGP-SIMPGGN
6PGD_TREPA      PRKIMLAVDAVIDQILPGDLVIDGGNSHYQDTIRRMHALEAAGIHFIGTGVSGGEEGALRGP-SLMPGGS
6PGD_STAAW      ------------------------------------KALAQSAINFIGMGVSGGEIGALTGP-SLMPGGQ
6PGD_STAAS      ------------------------------------KALAQSAINFIGMGVSGGEIGALTGP-SLMPGGQ
6PGD_STAAR      ------------------------------------KALAQSAINFIGMGVSGGEIGALTGP-SLMPGGQ
6PGD_STAAN      ------------------------------------KALAQSAINFIGMGVSGGEIGALTGP-SLMPGGQ
6PGD_STAAM      ------------------------------------KALAQSAINFIGMGVSGGEIGALTGP-SLMPGGQ
6PGD_STAAC      ------------------------------------KALAQSAINFIGMGVSGGEIGALTGP-SLMPGGQ
GPDA1_SALRD     ASDL------------------------------------------------------------------
6PGD_HAEDU      VDQFI---DALLPHLEAGDIIIDGGNSNYPDTNRRTITLAEKGIRFIGTGVSGGEEGARHGP-SIMPGGN
6PGD_CHLTR      PRKIMI----MIKAGAPGDILIDGGNSYYLDSEQRYVDLKKEGILFVGMGVSGGEEGARKGP-SIMPGGN
6PGD_CHLMU      PRKIMI----MIKAGAPGDILIDGGNSYYLDSERRYIDLKKKGILFVGMGVSGGEEGARKGP-SIMPGGN
6PGD_BACLI      VDSVI---DSLVPLLEEGDVIMDGGNSHYEDTERRYDSLKAKXXXXXXXXXXXXXXXALKGP-SIMPGGD
6PGD_BUCAP      TDETI---QFILPYLNKGDILIDGGNTFYKDSIRRSNDLMKCGINFIGMGVSGGELGALNGP-SIMPGGS
GPDA_RHORT      LRPVLTTARPLWPGRAPMVIC-------------------------------------------------
GPDA_MYCTU      AEEALGGASTVLLGVPAQTMRANLERWAPLLPEGATLVSLAKGIE-------------------------
GPDA_MYCBO      AEEALGGASTVLLGVPAQTMRANLERWAPLLPEGATLVSLAKGIE-------------------------
GPDA_AZOVD      LRQVLQPVSALLDGMLVSTTKGIEAQSFKLMSQIIEEIAPRARIGVLSGPNLAREIAEHALTASVIASED
6PGD_BUCBP      -----------------GDIIIDGGNTFYKDTIQRGYELLKIGVNLIGAGFSGGEKGALYGP-SIMPGGR
GPDA_BACCR      YRDVLQEMKEIVKGIEPGT----SKRISEVIEEEIPEHLIK-DVVVLSGPSHAEEVGLRQATTVTSAAKR
GPDA_BACC4      YRDVLQEMKEIVKGIEPGT----SKRISEVIEEEIPEHLIK-DVVVLSGPSHAEEVGLRQATTVTSAAKR
GPDA_MOOTA      LLKPFLPKGTVVVNTAKGLELETKKRLSQVLVEEGLDRVA-----VLSGPSHAEEVGRGLPTTVVVAAAD
GPDA_CORK4      PRVALTDADIVVLG--------------------------------------------------------
6PGD_BACSU      VDSVIQSLKPLLE---EGDVIMDGGNSHYEDTERRYDELKEKXXXXXXXXXXXXXXXALTGP-SIMPGGD
GPDA_PSESM      VSELIF-------VALPSSAL--RSVLSPHIERLSGKMLVSLGIEA------------------------
GPDA_BACCN      YREVLQDMKKVISGASKGIEPGTSKRISEMIEEEIPEHLIR-DVVVLSGPSHAEEVALRQATTVTSAAKR
6PGD_BUCAI      ------------------------------------EKLSKYEINFIGMGVSGGELGALNGP-SIMPGGQ
GPDA_CHLMU      MEEALDGATMIVEGVTSAGMRPVLNQLKSITDLQIPLVITSKGIE-------------------------
GPDA_PSEU2      ASELIF-------VALPSSAL--RSVLSPHVARLNGKMLVSLGIEA------------------------
GPDA_LACF3      VRQVAGQLAELLNGVTPAPLLV-HATVSEMLAEEI-PAASRRGIVVLSGPSHAEDVAIKDVTAVTAACGD
GPDA_EXISA      IRPVLLTEPVTIVHAAKGIEPKTHERLSEIIAEEIEPAKRR-AIGVLTGPTHAEEVAVRKPTTITIACAD
FMT_ENTFA       ----------------------------------------------------------------------
GPDA_THICR      FREVLQKMHHIMMGS-------------------------------------------------------
TLN1_MOUSE      -----------------GEIAQGNENYAGIAARDVAGGLAARGVAALT---------SDPAVQAIVLDTA
GPDA_BACC2      YRDVLQEMKEIVKGIEPGT----SKRISEVIEEEIPENLIK-DVVVLSGPSHAEEVGLRQATTVTSAAKR


                         +         .         .         .         .         *         .:210
query           AEVLEKVRPLLEQIGKTITHIGDSGAGQVAKLCNQIAQVVNIEGIAEAMRFAGAQGVDTAKVFQAMSTGM
GLXR_ECOLI      EAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVALNIEAVSEALLFASKAGADPVRVRQALMGGF
GARR_ECOLI      KAIFDKYYDLMKAMAGSVVHTGEIGAGNVTKLANQVIVALNIAAMSEALTLATKAGVNPDLVYQAIRGGL
GARR_ECOL6      KAIFDKYYDLMKAMAGSVVHTGEIGAGNVTKLANQVIVALNIAAMSEALTLATKAGVNPDLVYQAIRGGL
Y1503_SHEFN     QAHFDTVKPVISAYSRCAELLGPVGAGQLTKMVNQICIAGVVQGLAEGLHFAKSAGLDGLKVIEVISKGA
YKWC_BACSU      KEAFEACMPIFSLMGENIQYQGPAGSGQHTKMCNQIAIAAGMIGVAEAMAYAQKSGLEPENVLKSITTGA
Y229_SYNY3      ISDFEEALPVLKSIGEKIVHCGPSGSGQAVKLCNQVLCGIHAIAAAEAIQLSEQLGIAPELVIDTCGSGA
MMSB_PSEAE      AEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLGILMAGTAEALALGVKNGLDPAVLSEVMKQSS
3HIDH_ARATH     EDAYLAARPILQSMGRTSIYCGGSGNGSAAKICNNLAMAVSMLGTSEALALGQSLGISASTLTEVLNTSS
3HIDH_DICDI     EQDFNTAKTYLECMGKNIVHCGDVGTGQVAKVCNNLVLGISMIAVSEAMNLGVKQGMDPKKLAGIFNTSS
3HIDH_DROME     EAEYNAVKAVLECMGKKITHCGVYGMGQAAKLCNNMMLAISMIGVSEAMNLAVRQGLD-ANVFAEISTGR
3HIDH_MOUSE     EDEFAAAQELLECMGSNVVYCGAVGTGQSAKICNNMLLAISMIGTAEAMNLGIRSGLDLAKILN-MSSGR
MMSB_MYCTU      ESTLRRARPVLEPMAGKIIHCGAAGAGQAAKVCNNMVLAVQQIAIAEAFVLAEKLGLSAQSLFDVI-TGA
MMSB_MYCBO      ESTLRRARPVLEPMAGKIIHCGAAGAGQAAKVCNNMVLAVQQIAIAEAFVLAEKLGLSAQSLFDVI-TGA
3HIDH_RAT       ENEFAAAQELLGCMGSNVLYCGAVGSGQSAKICNNMLLAISMIGTAEAMNLGIRSGLDLAKILN-MSSGR
3HIDH_BOVIN     EEEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNLLLAISMIGTAEAMNLGIRLGLDLAKILN-MSSGR
3HIDH_PONAB     EDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDLAKILN-MSSGR
3HIDH_HUMAN     EDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDLAKILN-MSSGR
3HIDH_CAEEL     DATFKRAEAVLSLMGKNIVNLGAVGNGTAAKICNNMLLGIQMVAVAETMNLGISMGLDAKALAGIVNTSS
YIHU_SALTY      XEQVERATPVLMAMGNELVNTGGPGMGIRVKLINNYMSIALNALSAEAAVLCEALGLSFDVALKVMSGTA
YIHU_SHIFL      XEQVERATPILMAMGSELINAGGPGMGIRVKLINNYMSIALNALSAEAAVLCEALNLPFDVAVKVMSGTA
YIHU_ECOLI      XEQVERATPILMAMGSELINAGGPGMGIRVKLINNYMSIALNALSAEAAVLCEALNLPFDVAVKVMSGTA
GLYR1_XENTR     QGVYEDCSSCFLAMGKTSFFLGEVGNAARMMLILNMVQGSFMATIAEGMTLAQVTGQSQQTLLDILNQGQ
YFJR_BACSU      AEAKQAAKPLLDSLSQQIFDVGESKTANAAKISINFLLVSMLEALSESFLMMEKYGLE-QKQFLEIASAL
GLYR1_CHICK     RGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQ
GLYR1_RAT       RGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQ
GLYR1_HUMAN     RGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQ
GLYR1_BOVIN     RGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQ
GLYR1_ANOGA     RLLFEECQSCFEAISRNSFYLGDVGNATKMNLILQMISGITLAGVAEAMALADRAGLQQKDVLEVLELTN
GLYR1_PONAB     RGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQ
GLYR1_AEDAE     RLLFEECQTCFEAISRNSFYMGDVGNATKMNLVLQMISGVMLAGIAEGLALADRAGLQQKDVLEVLELTS
YGBJ_ECOLI      DIAFERLAPVLEAVAGKVYRIGEPGLGSTVKIIHQLLAGVHIXXXXXXXXXXXXXGIPLDVMYDVVTNAA
GLYR1_MOUSE     RGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQ
GLYR1_DROME     RSVFEECHSCFKTIAKNTFFLGNIGNACKVNLILQTILGVSLVGLAEALALADRFSISLNDIIDIFDLTS
Y1010_HAEIN     KQAFELLQPVLDATAAKVYNIGEEGLGATVKIVHQLLAGVHIAAGAEAMALASKAGIPLDVMYDVVTNAA
GLYR1_DANRE     RSVYEDCSSCFQAMGKTSFFIGEAGNAARMMLILNMVQGSFMATIAEGLTLAQATGQSQQTFLDILCQGQ
GLYR1_DROPS     RTVFEECHSCFKTIAKNTFFLGNVGNACKVNLILQTIQAVSLVGLAEALALADRFSISLNDIIDIFDLTS
6PGD_KLEPN      KEAYELVAPILKQIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLALSNEELAQTFTEWNEGE
6PGD9_ECOLX     KEAYELVAPILKQIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEA----------------------
6PGD_SHIFL      KEAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLSNEELAQTFTEWNNGE
6PGD_ECOLI      KEAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLTNEELAQTFTEWNNGE
Y770_MYCTU      DEAFQRIKEPFSRWASLLIHAGEPGAGTRMKLARNMLTFVS-----------------------------
6PGD_SALTY      KDAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLSNEELANTFTEWNNGE
6PGD2_BACSU     KEAHELVKPILEAISAKVTYIGPDGAGHYVKMVHNGIEYGDMQLISESKQVLGLSADELHEVFAEWNKGE
6PGD_KLETE      KEAYELVAPILEQIAPCVAYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLALSNEELATTFTEWNQGE
6PGD_SHISO      KEAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLSNEELAQTFTEWNNGE
6PGD_SHIDY      KEAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLSNEELAQTFTEWNNGE
6PGD_SHIBO      KEAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLSNEELAQTFTEWNNGE
6PGD_KLEPL      KEAYELVAPILEQIAPCVAYIGADGAGHYVKMVHNGIEYGDMQLIAEAYALLALSNEELATTFTKWNEGE
6PGD_CITDI      KEAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLSNEELAETFTEWNKGE
6PGD_CITAM      KEAYELVAPILKQIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLSNEELATTFSEWNKGE
6PGD_ESCVU      KEAYELVAPILTKIAAVVTYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLSNEELAQTFTEWNKGE
6PGD_HAEIN      QEAWQYVKPIFQAISAKTEQVGGEGAGHFVKMVHNGIEYGDMQLICEAYQFLGLSYEEMQAIFAEWKNTE
6PGD_CITFR      KEAYELVAPILTKIAAVVIYIGADGAGHYVKMVHNGIEYGDMQLIAEAYSLLNLSNEELATTFTEWNEGE
6PGD_TRYBB      LSVWEEIRPIVEAAAPCVTMNGSGGAGSCVKMYHNSGEYAILQIWGEVFDILRAMGLNNDEVAAVLSKNF
6PGD_STAES      KDAYNKVSDILDAIASCVTYIGPNGAGHYVKMVHNGIEYADMQLIAESYALLGMSHKEISQTFKEWNAGE
6PGD_STAEQ      KDAYNKVSDILDAIASCVTYIGPNGAGHYVKMVHNGIEYADMQLIAESYALLGMSHKEISQTFKEWNAGE
6PGD_DICDI      PKAWEHVKPIFQAISAKVQPVGDGGAGHYVKMVHNGIEYGDMQLISEAKHYLGLSNDELQKTFAKWNTGD
6PGD_LACLA      KEAYDLVAPIFEQIGKCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESKRVLGLSNAEIQAIFEEWNEGE
6PGD_CAEEL      PKAWPHLKDIFQKIAPCCDWVGNAGSGHFVKMVHNGIEYGDMQLIAEA----------------------
6PGD_ACTAC      EEAWQFVKPVLQAISAKTEQVGKDGAGHFVKMVHNGIEYGDMQLICEAYQF-------------------
6PGD_LACLM      KEAYDLVAPIFEQIGKCVAYMGANGAGHYVKMVHNGIEYGDMQLIAESKRILGLSNAEIQAIFEEWNEGE
6PGD_CHLPN      PEAWPLVAPIFQSIAAKVSWVGTGGAGHYVKAVHNGIEYGDIQLICEA----------------------
6PGD_TREPA      AQAWPLVSPIFCAIAAKADDVGSDGAGHYVKMIHNGIEYGDMQIIAEGYWFLGMSYEHMHHTFTRWNTGR
6PGD_STAAW      EEAYNKVXXXXXXXXSCVTYIGPNGAGHYVKMVHNGIEYADMQLIAESKELLGMSHEDIAQTFKDWNAGE
6PGD_STAAS      EEAYNKVXXXXXXXXSCVTYIGPNGAGHYVKMVHNGIEYADMQLIAESKELLGMSHEDIAQTFKDWNAGE
6PGD_STAAR      EEAYNKVXXXXXXXXSCVTYIGPNGAGHYVKMVHNGIEYADMQLIAESKELLGMSHEDIAQTFKDWNAGE
6PGD_STAAN      EEAYNKVXXXXXXXXSCVTYIGPNGAGHYVKMVHNGIEYADMQLIAESKELLGMSHEDIAQTFKDWNAGE
6PGD_STAAM      EEAYNKVXXXXXXXXSCVTYIGPNGAGHYVKMVHNGIEYADMQLIAESKELLGMSHEDIAQTFKDWNAGE
6PGD_STAAC      EEAYNKVXXXXXXXXSCVTYIGPNGAGHYVKMVHNGIEYADMQLIAESKELLGMSHEDIAQTFKDWNAGE
GPDA1_SALRD     ----------------------------------------------------------------------
6PGD_HAEDU      EEAWPFVKPILQAIAKTCDWVGKEGAGHFVKMVHNGIEYGDMQLICEAYQF-------------------
6PGD_CHLTR      IDAWPAIAPIFQSIAAQVSWIGTGGAGHFVKAVHNGIEYGDIQLICE-----------------------
6PGD_CHLMU      IEAWPVIAPIFQSIAAQVSWIGTGGAGHFVKAVHNGIEYGDIQLICE-----------------------
6PGD_BACLI      RDVYEKAAPILTKIAAQVVYIGPKGAGHFVKMVHNGIEYADMQLIAEAYTFLREKLLEIADIFDTWNQGE
6PGD_BUCAP      REAYDLVSSMLKKISPCVSYIGPNGAGHYVKMIHNGIEYGDMQLISES----------------------
GPDA_RHORT      ----------------------------------------------------------------------
GPDA_MYCTU      ----------------------------------------------------------------------
GPDA_MYCBO      ----------------------------------------------------------------------
GPDA_AZOVD      EALCQAVQAVLHELGGALKNVYAIMAGMAASLGENTKSMLITRALAEMTRFAARLGANPMTFL-----GL
6PGD_BUCBP      QEAYNYVSPILKKIASNVTYIGPDGSGHYVKMVHNGIEYGDMQLIAES----------------------
GPDA_BACCR      MEAAEEVQDL------------------------------------------------------------
GPDA_BACC4      MEAAEEVQDL------------------------------------------------------------
GPDA_MOOTA      RETAEYVQDVMDPTFRVYTNPDIIGVEFGGALKNIIALATGMRGMAEIARLGVALG---GKVL--TFAGL
GPDA_CORK4      ----------------------------------------------------------------------
6PGD_BACSU      RDVYEKAAPILTKIAAQVVYIGPKGAGHFTKMVHNGIEYADMQLIAEAYTFLRLPLDEIASIFETWNQGE
GPDA_PSESM      ----------------------------------------------------------------------
GPDA_BACCN      MEAAEEVQDL------------------------------------------------------------
6PGD_BUCAI      KEAYKLVLPMLEKISPCVSYIGPNGAGHYVKMVHNGIEYGDMQLISES----------------------
GPDA_CHLMU      ----------------------------------------------------------------------
GPDA_PSEU2      ----------------------------------------------------------------------
GPDA_LACF3      LACAKEIQELFNHYFRVYTNDDVIGAEFGAALKNIIRAALITRGLAEIRRLGVAFGADPMTFI-----GL
GPDA_EXISA      LDVADEVQELL-----------------------------------------------------------
FMT_ENTFA       ----------------------------------------------------------------------
GPDA_THICR      ----------------------------------------------------------------------
TLN1_MOUSE      SDVLDKASSLIEEAKKASGHPGDPESQQLAQVAKAVTQALN----RCVSCLPGQRDVDNA----LRAVGD
GPDA_BACC2      MEAAEEVQDL------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGSRMLDMLGPKMVTRDFSAGIESRLHAKDFGLAADIATEIGLELPAMRATSAQLGELMDQGWGKDDTSS
GLXR_ECOLI      ASSRILEVHGERMIKRTFNPGFKIALHQKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSA
GARR_ECOLI      AGSTVLDAKAPMVMDRNFKPGFRIDLHIKDLANALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSA
GARR_ECOL6      AGSTVLDAKAPMVMDRNFKPGFRIDLHIKDLANALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSA
Y1503_SHEFN     AQSWQMENRYKTMWQGQYDFGFAIDWMRKDLGIALDEARRNGSHLPVAALVDQFYSEVQAMKGNRWDTSS
YKWC_BACSU      AGSWSLSNLAPRMLQGNFEPGFYVKHFIKDMGIXXXXXXXXXXXXXXLSLAKSLYDKLAAQGEENSGTQS
Y229_SYNY3      AGSWALTNLAPKMSEADFAPGFMVKHLLKDLRLAAENGPLPGVTLAESLFTSVQLLGGEDQG--------
MMSB_PSEAE      GGNWALNLYNPAPASNGYAGGFQVRLMNKDLGLALANAQAVQASTP------------------------
3HIDH_ARATH     GRCWSSDAYNPKGVSRDYNGGFASKLMAKDLNLAAASAEEVGHKSPLISKAQEIYKKMCEEGHETKDFSC
3HIDH_DICDI     ARCWTSELYNPSPASRGYTGGFGSALMTKDLGLAVDSAKSIGEPLLLGNSAHQLYTLLVAKGDGQKDFS-
3HIDH_DROME     CWASEIYNPVPGVANRDYAGGFSSALITKDLGLASGVANASNSPIPLGSLAHKVYQSLCDKGLGNKDFSV
3HIDH_MOUSE     CWSSDTYNPVPGVMSNNYQGGFGTTLMAKDLGLAQDSATSTKTPI-LLGSLAHQIYRMMSKGYSKKDFSS
MMSB_MYCTU      TGNTNCPVPGPSPANNDFKPGFSTALMNKDLGL-------------------------------------
MMSB_MYCBO      TGNTNCPVPGPSPANNDFKPGFSTALMNKDLGL-------------------------------------
3HIDH_RAT       CWSSDTYNPVPGVMSNNYQGGFGTTLMAKDLGLAQDSATSTKTPI-LLGSVAHQIYRMMSKGYSKKDFSS
3HIDH_BOVIN     CWSS--DTYNPVPGVMDYQGGFGTTLMAKDLGLAQDSAT--STKSPILLGSQAQIYRMMAKGYSKKDFSS
3HIDH_PONAB     CWSS--DTYNPVPGVMDYQGGFGATLMAKDLGLAQDSATSTKSPI-LLGSLAHQIYRMMAKGYSKKDFSS
3HIDH_HUMAN     CWSS--DTYNPVPGVMDYQGGFGTTLMAKDLGLAQDSATSTKSPI-LLGSLAHQIYRMMAKGYSKKDFSS
3HIDH_CAEEL     GRCWSSDTYNPVPSCRGYAGGFGTTLMAKDLSLAQNASTNTQAPTP------------------------
YIHU_SALTY      AGKGHFTTTWPKVMKGDLSPAFMIDLAHKDLGIALDVANQLHVPMPLGAASREVYNLARAAGRGREDWSA
YIHU_SHIFL      AGKGHFTTSWPKVLSGDLSPAFMIDLAHKDLGIALDVANQLHVPMPLGAASREVYSQARAAGRGRQDWSA
YIHU_ECOLI      AGKGHFTTSWPKVLSGDLSPAFMIDLAHKDLGIALDVANQLHVPMPLGAASREVYSQARAAGRGRQDWSA
GLYR1_XENTR     LASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDSVNHPTPMAAAAN------------------
YFJR_BACSU      FGSPVYQNYGTIMAEQKFEAGFKMSLGLKDTNLALAAAKRVSANLPLAELAKSHFESGIEKGFGDLDWAA
GLYR1_CHICK     LASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDSVNHPTPMAAAAN------------------
GLYR1_RAT       LASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAAN------------------
GLYR1_HUMAN     LASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAAN------------------
GLYR1_BOVIN     LASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAAN------------------
GLYR1_ANOGA     MSSEMMLQKGNAIIKGEFPTHHALKHMQKDLKLALSLADGLEQSLPITAASNEVYKHAKRLGYGSHDASA
GLYR1_PONAB     LASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAAN------------------
GLYR1_AEDAE     MSSELVMQKGNAIIKGEFPPQQALKHMQKDLKLALNMAEGLEQPLPITAASNEVYKHAKRLGYGSHDSSA
YGBJ_ECOLI      GNSWMFENRMRHVVDGDYTPHSAVDIFVKDLGLVADTAKALHFPLPLASTALNMFTSASNAGYGKEDDSA
GLYR1_MOUSE     LASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAAN------------------
GLYR1_DROME     MKSPMLLAKGKEMAKGDFNPQQPLSHMQRDLRLVLNMAENLDQSMPVTSITNEVFKHTKRLGYSEHDSSA
Y1010_HAEIN     GNSWMFENRMKHVVEGDYTPLSMVDIFVKDLGLVNDTAKSLHFPLHLASTAYSMFTEASNAGYGKEDDSA
GLYR1_DANRE     MASTFVDQKCQNILQGNFKPDYYLKHIQKDLRLAISMGDSVNHPTPMAAAAN------------------
GLYR1_DROPS     MKSPLLLAKGKEMAKGDFNPQQPLSHMQRDLRLVLNMAENLDQSMPVTSITNEVFKHTKRLGYSEHDSSA
6PGD_KLEPN      LSSYLIDI--------------------------------------------------------------
6PGD9_ECOLX     ----------------------------------------------------------------------
6PGD_SHIFL      LSSYLIDI--------------------------------------------------------------
6PGD_ECOLI      LSSYLIDI--------------------------------------------------------------
Y770_MYCTU      ----------------------------------------------------------------------
6PGD_SALTY      LSSYLIDI--------------------------------------------------------------
6PGD2_BACSU     LDSYLIEITADIFTKKDEETG-------------------------------------------------
6PGD_KLETE      LSSYLIDI--------------------------------------------------------------
6PGD_SHISO      LSSYLIDI--------------------------------------------------------------
6PGD_SHIDY      LSSYLIDI--------------------------------------------------------------
6PGD_SHIBO      LSSYLIDI--------------------------------------------------------------
6PGD_KLEPL      LSSYLIDI--------------------------------------------------------------
6PGD_CITDI      LNSYLIDI--------------------------------------------------------------
6PGD_CITAM      LSSYLIDI--------------------------------------------------------------
6PGD_ESCVU      LSSYLIDI--------------------------------------------------------------
6PGD_HAEIN      LDSYLIDITTDILGYKDASTGKWTGINALDFGIPLTLITE------------------------------
6PGD_CITFR      LSSYLIDI--------------------------------------------------------------
6PGD_TRYBB      LKSYMLDISIAAARAKDLTEHVMDRIGSKGTGLSAQEALEIGVPAPSL----------------------
6PGD_STAES      LESYLIEITG------------------------------------------------------------
6PGD_STAEQ      LESYLIEITG------------------------------------------------------------
6PGD_DICDI      LDSYLIEI--------------------------------------------------------------
6PGD_LACLA      LDSYLIEITKEVLKRKD-----------------------------------------------------
6PGD_CAEEL      ----------------------------------------------------------------------
6PGD_ACTAC      ----------------------------------------------------------------------
6PGD_LACLM      LDSYLIEITKEVLKRKD-----------------------------------------------------
6PGD_CHLPN      ----------------------------------------------------------------------
6PGD_TREPA      LHSYLIEITAAILAHQD-----------------------------------------------------
6PGD_STAAW      LESYLIEITG------------------------------------------------------------
6PGD_STAAS      LESYLIEITG------------------------------------------------------------
6PGD_STAAR      LESYLIEITG------------------------------------------------------------
6PGD_STAAN      LESYLIEITG------------------------------------------------------------
6PGD_STAAM      LESYLIEITG------------------------------------------------------------
6PGD_STAAC      LESYLIEITG------------------------------------------------------------
GPDA1_SALRD     ----------------------------------------------------------------------
6PGD_HAEDU      ----------------------------------------------------------------------
6PGD_CHLTR      ----------------------------------------------------------------------
6PGD_CHLMU      ----------------------------------------------------------------------
6PGD_BACLI      LKSYLIEITAEILRKKDERTG-------------------------------------------------
6PGD_BUCAP      ----------------------------------------------------------------------
GPDA_RHORT      ----------------------------------------------------------------------
GPDA_MYCTU      ----------------------------------------------------------------------
GPDA_MYCBO      ----------------------------------------------------------------------
GPDA_AZOVD      AGVGDLIVTCTSPKSRNYQVG-----HALGQGLALEEAVEVAEGVNTLRVLKAKAEEL------------
6PGD_BUCBP      ----------------------------------------------------------------------
GPDA_BACCR      ----------------------------------------------------------------------
GPDA_BACC4      ----------------------------------------------------------------------
GPDA_MOOTA      SGIGDLIVTCTSMYSRNRRAGI---LLGKGQSL-EEVLDAVGMVVEGVRTTAAARELACQHGIKMPITEE
GPDA_CORK4      ----------------------------------------------------------------------
6PGD_BACSU      LKSYLIEITAEILRKKDEKTG-------------------------------------------------
GPDA_PSESM      ----------------------------------------------------------------------
GPDA_BACCN      ----------------------------------------------------------------------
6PGD_BUCAI      ----------------------------------------------------------------------
GPDA_CHLMU      ----------------------------------------------------------------------
GPDA_PSEU2      ----------------------------------------------------------------------
GPDA_LACF3      SGVGDLVVTATSKNSRNWRAGYQLGQGQK----LADVVENMGMVIEGVATTKA-----------------
GPDA_EXISA      ----------------------------------------------------------------------
FMT_ENTFA       ----------------------------------------------------------------------
GPDA_THICR      ----------------------------------------------------------------------
TLN1_MOUSE      ASKRLLDLLPPSTGTFQEA---QSRLNEAAAGL-NQAATEL---VQASRGTPQDLARASGR-FGQDFSTF
GPDA_BACC2      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LLKVLELKG
GLXR_ECOLI      LVQALEL--
GARR_ECOLI      L--------
GARR_ECOL6      L--------
Y1503_SHEFN     LLARLE---
YKWC_BACSU      IYKL-----
Y229_SYNY3      ---------
MMSB_PSEAE      ---------
3HIDH_ARATH     VFR------
3HIDH_DICDI     ---------
3HIDH_DROME     VYDLMK---
3HIDH_MOUSE     VFQYL----
MMSB_MYCTU      ---------
MMSB_MYCBO      ---------
3HIDH_RAT       VFQYL----
3HIDH_BOVIN     VFQFL----
3HIDH_PONAB     VFQFL----
3HIDH_HUMAN     VFQFL----
3HIDH_CAEEL     ---------
YIHU_SALTY      ILEQVRI--
YIHU_SHIFL      ILE------
YIHU_ECOLI      ILE------
GLYR1_XENTR     ---------
YFJR_BACSU      LIKCIK---
GLYR1_CHICK     ---------
GLYR1_RAT       ---------
GLYR1_HUMAN     ---------
GLYR1_BOVIN     ---------
GLYR1_ANOGA     V--------
GLYR1_PONAB     ---------
GLYR1_AEDAE     V--------
YGBJ_ECOLI      VIKI-----
GLYR1_MOUSE     ---------
GLYR1_DROME     V--------
Y1010_HAEIN     VIKI-----
GLYR1_DANRE     ---------
GLYR1_DROPS     V--------
6PGD_KLEPN      ---------
6PGD9_ECOLX     ---------
6PGD_SHIFL      ---------
6PGD_ECOLI      ---------
Y770_MYCTU      ---------
6PGD_SALTY      ---------
6PGD2_BACSU     ---------
6PGD_KLETE      ---------
6PGD_SHISO      ---------
6PGD_SHIDY      ---------
6PGD_SHIBO      ---------
6PGD_KLEPL      ---------
6PGD_CITDI      ---------
6PGD_CITAM      ---------
6PGD_ESCVU      ---------
6PGD_HAEIN      ---------
6PGD_CITFR      ---------
6PGD_TRYBB      ---------
6PGD_STAES      ---------
6PGD_STAEQ      ---------
6PGD_DICDI      ---------
6PGD_LACLA      ---------
6PGD_CAEEL      ---------
6PGD_ACTAC      ---------
6PGD_LACLM      ---------
6PGD_CHLPN      ---------
6PGD_TREPA      ---------
6PGD_STAAW      ---------
6PGD_STAAS      ---------
6PGD_STAAR      ---------
6PGD_STAAN      ---------
6PGD_STAAM      ---------
6PGD_STAAC      ---------
GPDA1_SALRD     ---------
6PGD_HAEDU      ---------
6PGD_CHLTR      ---------
6PGD_CHLMU      ---------
6PGD_BACLI      ---------
6PGD_BUCAP      ---------
GPDA_RHORT      ---------
GPDA_MYCTU      ---------
GPDA_MYCBO      ---------
GPDA_AZOVD      ---------
6PGD_BUCBP      ---------
GPDA_BACCR      ---------
GPDA_BACC4      ---------
GPDA_MOOTA      IYQVL----
GPDA_CORK4      ---------
6PGD_BACSU      ---------
GPDA_PSESM      ---------
GPDA_BACCN      ---------
6PGD_BUCAI      ---------
GPDA_CHLMU      ---------
GPDA_PSEU2      ---------
GPDA_LACF3      ---------
GPDA_EXISA      ---------
FMT_ENTFA       ---------
GPDA_THICR      ---------
TLN1_MOUSE      LEAGVEMAG
GPDA_BACC2      ---------