[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF09846.1

[Show Plain Result]


## Summary of Sequence Search
    1::873
    1::861       0.0 100%  873 aa  SYL_RALME RecName: Full=Leucyl-tRNA synthetase;       
    1::861       0.0  86%  873 aa  SYL_RALEJ RecName: Full=Leucyl-tRNA synthetase;       
    1::865       0.0  86%  877 aa  SYL_RALPJ RecName: Full=Leucyl-tRNA synthetase;       
    1::865       0.0  83%  877 aa  SYL_RALSO RecName: Full=Leucyl-tRNA synthetase;       
    1::852       0.0  73%  864 aa  SYL_BURP8 RecName: Full=Leucyl-tRNA synthetase;       
    1::851       0.0  73%  863 aa  SYL_BURXL RecName: Full=Leucyl-tRNA synthetase;       
    1::852       0.0  74%  864 aa  SYL_BURVG RecName: Full=Leucyl-tRNA synthetase;       
    1::821       0.0  75%  864 aa  SYL_BURCJ RecName: Full=Leucyl-tRNA synthetase;       
    1::821       0.0  74%  864 aa  SYL_BURCC RecName: Full=Leucyl-tRNA synthetase;       
    1::821       0.0  74%  864 aa  SYL_BURCH RecName: Full=Leucyl-tRNA synthetase;       
    1::821       0.0  74%  864 aa  SYL_BURCA RecName: Full=Leucyl-tRNA synthetase;       
    1::852       0.0  78%  864 aa  SYL_BURM1 RecName: Full=Leucyl-tRNA synthetase;       
    1::869       0.0  72%  881 aa  SYL_HERAR RecName: Full=Leucyl-tRNA synthetase;       
    1::852       0.0  77%  864 aa  SYL_BURA4 RecName: Full=Leucyl-tRNA synthetase;       
    1::869       0.0  72%  881 aa  SYL_JANMA RecName: Full=Leucyl-tRNA synthetase;       
    1::821       0.0  77%  864 aa  SYL_BURCM RecName: Full=Leucyl-tRNA synthetase;       
    1::852       0.0  75%  864 aa  SYL_BURPS RecName: Full=Leucyl-tRNA synthetase;       
    1::852       0.0  75%  864 aa  SYL_BURP0 RecName: Full=Leucyl-tRNA synthetase;       
    1::821       0.0  75%  864 aa  SYL_BURTA RecName: Full=Leucyl-tRNA synthetase;       
    1::852       0.0  75%  864 aa  SYL_BURM9 RecName: Full=Leucyl-tRNA synthetase;       
    1::852       0.0  75%  864 aa  SYL_BURM7 RecName: Full=Leucyl-tRNA synthetase;       
    1::852       0.0  75%  864 aa  SYL_BURMS RecName: Full=Leucyl-tRNA synthetase;       
    1::852       0.0  75%  864 aa  SYL_BURMA RecName: Full=Leucyl-tRNA synthetase;       
    1::821       0.0  75%  864 aa  SYL_BURS3 RecName: Full=Leucyl-tRNA synthetase;       
    1::821       0.0  75%  864 aa  SYL_BURP6 RecName: Full=Leucyl-tRNA synthetase;       
    1::821       0.0  75%  864 aa  SYL_BURP1 RecName: Full=Leucyl-tRNA synthetase;       
    1::873       0.0  72%  885 aa  SYL_BORBR RecName: Full=Leucyl-tRNA synthetase;       
    1::873       0.0  71%  885 aa  SYL_BORPA RecName: Full=Leucyl-tRNA synthetase;       
    1::873       0.0  72%  885 aa  SYL_BORPE RecName: Full=Leucyl-tRNA synthetase;       
    1::878       0.0  70%  890 aa  SYL_POLSQ RecName: Full=Leucyl-tRNA synthetase;       
    1::873       0.0  73%  885 aa  SYL_BORPD RecName: Full=Leucyl-tRNA synthetase;       
    1::878       0.0  69%  890 aa  SYL_POLNS RecName: Full=Leucyl-tRNA synthetase;       
    1::876       0.0  72%  888 aa  SYL_POLNA RecName: Full=Leucyl-tRNA synthetase;       
    1::873       0.0  66%  885 aa  SYL_BORA1 RecName: Full=Leucyl-tRNA synthetase;       
    1::898       0.0  70%  910 aa  SYL_DIAST RecName: Full=Leucyl-tRNA synthetase;       
    1::855       0.0  69%  897 aa  SYL_ACIAC RecName: Full=Leucyl-tRNA synthetase;       
    1::898       0.0  69%  910 aa  SYL_ACISJ RecName: Full=Leucyl-tRNA synthetase;       
    1::880       0.0  66%  892 aa  SYL_RHOFD RecName: Full=Leucyl-tRNA synthetase;       
    1::844       0.0  70%  886 aa  SYL_POLSJ RecName: Full=Leucyl-tRNA synthetase;       
    1::845       0.0  66%  887 aa  SYL_LEPCP RecName: Full=Leucyl-tRNA synthetase;       
    1::899       0.0  66%  911 aa  SYL_DELAS RecName: Full=Leucyl-tRNA synthetase;       
   39::854       0.0  69%  897 aa  SYL_METPP RecName: Full=Leucyl-tRNA synthetase;       
    1::864       0.0  67%  876 aa  SYL_VARPS RecName: Full=Leucyl-tRNA synthetase;       
    1::830       0.0  69%  873 aa  SYL_AZOSB RecName: Full=Leucyl-tRNA synthetase;       
    1::867       0.0  66%  907 aa  SYL_VEREI RecName: Full=Leucyl-tRNA synthetase;       
    1::830       0.0  65%  873 aa  SYL_AZOSE RecName: Full=Leucyl-tRNA synthetase;       
    1::858       0.0  64%  870 aa  SYL_DECAR RecName: Full=Leucyl-tRNA synthetase;       
    1::854       0.0  61%  866 aa  SYL_NITMU RecName: Full=Leucyl-tRNA synthetase;       
    1::845       0.0  64%  857 aa  SYL_THIDA RecName: Full=Leucyl-tRNA synthetase;       
    1::826       0.0  62%  869 aa  SYL_NITEU RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  61%  868 aa  SYL_PSEPG RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  61%  868 aa  SYL_PSEPK RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  60%  868 aa  SYL_PSEP1 RecName: Full=Leucyl-tRNA synthetase;       
    1::875       0.0  62%  887 aa  SYL_METCA RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  61%  868 aa  SYL_NITEC RecName: Full=Leucyl-tRNA synthetase;       
    1::857       0.0  58%  870 aa  SYL_PSEMY RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  60%  868 aa  SYL_PSESM RecName: Full=Leucyl-tRNA synthetase;       
    1::829       0.0  60%  873 aa  SYL_PSEAB RecName: Full=Leucyl-tRNA synthetase;       
    1::829       0.0  59%  873 aa  SYL_PSEA7 RecName: Full=Leucyl-tRNA synthetase;       
    1::832       0.0  61%  876 aa  SYL_NEIM0 RecName: Full=Leucyl-tRNA synthetase;       
    1::829       0.0  60%  873 aa  SYL_PSEAE RecName: Full=Leucyl-tRNA synthetase;       
    1::829       0.0  60%  873 aa  SYL_PSEA8 RecName: Full=Leucyl-tRNA synthetase;       
    1::854       0.0  62%  866 aa  SYL_LARHH RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  59%  868 aa  SYL_PSEPW RecName: Full=Leucyl-tRNA synthetase;       
    1::832       0.0  61%  876 aa  SYL_NEIMB RecName: Full=Leucyl-tRNA synthetase;       
    1::832       0.0  61%  876 aa  SYL_NEIG1 RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  60%  868 aa  SYL_PSEE4 RecName: Full=Leucyl-tRNA synthetase;       
    1::832       0.0  61%  876 aa  SYL_NEIG2 RecName: Full=Leucyl-tRNA synthetase;       
    1::832       0.0  61%  876 aa  SYL_NEIMF RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  60%  868 aa  SYL_PSEU5 RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  58%  868 aa  SYL_PSEFS RecName: Full=Leucyl-tRNA synthetase;       
    1::860       0.0  60%  872 aa  SYL_CHRVO RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  58%  868 aa  SYL_PSEF5 RecName: Full=Leucyl-tRNA synthetase;       
    1::857       0.0  60%  870 aa  SYL_AZOVD RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  58%  868 aa  SYL_PSE14 RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  58%  868 aa  SYL_PSEU2 RecName: Full=Leucyl-tRNA synthetase;       
    1::825       0.0  57%  868 aa  SYL_PSEPF RecName: Full=Leucyl-tRNA synthetase;       
    1::866       0.0  60%  910 aa  SYL_NEIMA RecName: Full=Leucyl-tRNA synthetase;       
    9::831       0.0  59%  873 aa  SYL_ACIAD RecName: Full=Leucyl-tRNA synthetase;       
    1::823       0.0  59%  867 aa  SYL_DICNV RecName: Full=Leucyl-tRNA synthetase;       
    8::835       0.0  59%  879 aa  SYL_XYLFA RecName: Full=Leucyl-tRNA synthetase;       
    9::866       0.0  55%  879 aa  SYL_XANC8 RecName: Full=Leucyl-tRNA synthetase;       
    9::867       0.0  56%  880 aa  SYL_XANAC RecName: Full=Leucyl-tRNA synthetase;       
    9::867       0.0  56%  880 aa  SYL_XANC5 RecName: Full=Leucyl-tRNA synthetase;       
    9::872       0.0  55%  885 aa  SYL_XANCB RecName: Full=Leucyl-tRNA synthetase;       
    9::867       0.0  56%  880 aa  SYL_XANOR RecName: Full=Leucyl-tRNA synthetase;       
    9::867       0.0  56%  880 aa  SYL_XANOP RecName: Full=Leucyl-tRNA synthetase;       
   13::832       0.0  57%  877 aa  SYL_THICR RecName: Full=Leucyl-tRNA synthetase;       
    9::867       0.0  56%  880 aa  SYL_XANOM RecName: Full=Leucyl-tRNA synthetase;       
    8::835       0.0  59%  879 aa  SYL_XYLFT RecName: Full=Leucyl-tRNA synthetase;       
    8::835       0.0  59%  879 aa  SYL_XYLF2 RecName: Full=Leucyl-tRNA synthetase;       
    9::832       0.0  58%  874 aa  SYL_ACIBY RecName: Full=Leucyl-tRNA synthetase;       
    9::832       0.0  58%  874 aa  SYL_ACIBC RecName: Full=Leucyl-tRNA synthetase;       
    9::832       0.0  58%  874 aa  SYL_ACIB5 RecName: Full=Leucyl-tRNA synthetase;       
    9::832       0.0  58%  874 aa  SYL_ACIB3 RecName: Full=Leucyl-tRNA synthetase;       
    8::835       0.0  59%  879 aa  SYL_XYLFM RecName: Full=Leucyl-tRNA synthetase;       
    9::832       0.0  57%  874 aa  SYL_ACIBS RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  57%  861 aa  SYL_HAHCH RecName: Full=Leucyl-tRNA synthetase;       
    9::812       0.0  57%  816 aa  SYL_XANCP RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  56%  858 aa  SYL_IDILO RecName: Full=Leucyl-tRNA synthetase;       
    1::813       0.0  57%  856 aa  SYL_CHRSD RecName: Full=Leucyl-tRNA synthetase;       
    9::867       0.0  54%  880 aa  SYL_STRMK RecName: Full=Leucyl-tRNA synthetase;       
    9::867       0.0  54%  880 aa  SYL_STRM5 RecName: Full=Leucyl-tRNA synthetase;       
    1::818       0.0  55%  861 aa  SYL_MARAV RecName: Full=Leucyl-tRNA synthetase;       
    1::773       0.0  60%  817 aa  SYL_METFK RecName: Full=Leucyl-tRNA synthetase;       
    4::823       0.0  55%  867 aa  SYL_ALTMD RecName: Full=Leucyl-tRNA synthetase;       
    1::851       0.0  56%  864 aa  SYL_ALHEH RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  55%  860 aa  SYL_SERP5 RecName: Full=Leucyl-tRNA synthetase;       
   14::841       0.0  56%  885 aa  SYL_PSYWF RecName: Full=Leucyl-tRNA synthetase;       
    2::767       0.0  57%  813 aa  SYL_FRATN RecName: Full=Leucyl-tRNA synthetase;       
   41::908       0.0  53%  921 aa  SYL_PSYA2 RecName: Full=Leucyl-tRNA synthetase;       
    2::767       0.0  57%  813 aa  SYL_FRATW RecName: Full=Leucyl-tRNA synthetase;       
    1::851       0.0  53%  864 aa  SYL_CELJU RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  55%  860 aa  SYL_SODGM RecName: Full=Leucyl-tRNA synthetase;       
    2::767       0.0  57%  813 aa  SYL_FRATT RecName: Full=Leucyl-tRNA synthetase;       
    2::767       0.0  57%  813 aa  SYL_FRAT1 RecName: Full=Leucyl-tRNA synthetase;       
    1::846       0.0  51%  859 aa  SYL_PSYIN RecName: Full=Leucyl-tRNA synthetase;       
    2::767       0.0  57%  813 aa  SYL_FRATO RecName: Full=Leucyl-tRNA synthetase;       
    2::767       0.0  57%  813 aa  SYL_FRATH RecName: Full=Leucyl-tRNA synthetase;       
    2::767       0.0  57%  813 aa  SYL_FRATF RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  54%  860 aa  SYL_YERE8 RecName: Full=Leucyl-tRNA synthetase;       
    2::767       0.0  57%  813 aa  SYL_FRATM RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_YERPS RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_YERPP RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_YERPN RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_YERPG RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_YERPE RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_YERPB RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_YERPA RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_YERP3 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_YERPY RecName: Full=Leucyl-tRNA synthetase;       
    1::818       0.0  53%  862 aa  SYL_PSEHT RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  54%  860 aa  SYL_ERWCT RecName: Full=Leucyl-tRNA synthetase;       
    1::846       0.0  53%  859 aa  SYL_AERHH RecName: Full=Leucyl-tRNA synthetase;       
   44::906       0.0  51%  919 aa  SYL_PSYCK RecName: Full=Leucyl-tRNA synthetase;       
    6::826       0.0  53%  870 aa  SYL_PSEA6 RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  53%  859 aa  SYL_SHEAM RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  53%  859 aa  SYL_SHESA RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  53%  859 aa  SYL_SHESR RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  53%  859 aa  SYL_SHEB8 RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  52%  859 aa  SYL_SHESM RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  53%  859 aa  SYL_SHEON RecName: Full=Leucyl-tRNA synthetase;       
   32::775       0.0  58%  819 aa  SYL_NITOC RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  52%  859 aa  SYL_SHEB9 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ACTSZ RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  52%  859 aa  SYL_SHESW RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  52%  859 aa  SYL_SHEB5 RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  52%  859 aa  SYL_SHEB2 RecName: Full=Leucyl-tRNA synthetase;       
    3::767       0.0  56%  813 aa  SYL_FRAP2 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_SALAR RecName: Full=Leucyl-tRNA synthetase;       
    1::844       0.0  53%  857 aa  SYL_VIBPA RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  52%  859 aa  SYL_SHEPC RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_CITK8 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECO24 RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  53%  860 aa  SYL_EDWI9 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECOUT RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECOK1 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECO45 RecName: Full=Leucyl-tRNA synthetase;       
    1::849       0.0  52%  862 aa  SYL_VIBHB RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_SHIFL RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECOSM RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ESCF3 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECOL6 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECOL5 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECO8A RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECO81 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECO5E RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECO57 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECO55 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_SHIBS RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_SHIB3 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_SHIDS RecName: Full=Leucyl-tRNA synthetase;       
    1::819       0.0  53%  863 aa  SYL_SHEDO RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECOSE RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECOLI RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECOHS RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECOBW RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECO27 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECOLC RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECO7I RecName: Full=Leucyl-tRNA synthetase;       
    1::845       0.0  51%  858 aa  SYL_AERS4 RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  53%  860 aa  SYL_SHISS RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_ECOLU RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  53%  860 aa  SYL_ERWT9 RecName: Full=Leucyl-tRNA synthetase;       
    1::819       0.0  52%  863 aa  SYL_COLP3 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  53%  860 aa  SYL_SHIF8 RecName: Full=Leucyl-tRNA synthetase;       
    1::819       0.0  53%  863 aa  SYL_SHEFN RecName: Full=Leucyl-tRNA synthetase;       
    1::813       0.0  54%  857 aa  SYL_VIBVU RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  859 aa  SYL_SHEWM RecName: Full=Leucyl-tRNA synthetase;       
    1::802       0.0  55%  815 aa  SYL_ALCBS RecName: Full=Leucyl-tRNA synthetase;       
    1::813       0.0  54%  857 aa  SYL_VIBVY RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  51%  859 aa  SYL_SHEPA RecName: Full=Leucyl-tRNA synthetase;       
    1::820       0.0  52%  863 aa  SYL_SHESH RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  52%  860 aa  SYL_MANSM RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  52%  860 aa  SYL_SALTY RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALG2 RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALEP RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  52%  860 aa  SYL_SALDC RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALCH RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALPK RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALPA RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALSV RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALPB RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALPC RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALNS RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALHS RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALA4 RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  53%  861 aa  SYL_HAEIG RecName: Full=Leucyl-tRNA synthetase;       
    1::814       0.0  54%  858 aa  SYL_VIBSL RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_SALTI RecName: Full=Leucyl-tRNA synthetase;       
    1::814       0.0  52%  863 aa  SYL_SHELP RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  861 aa  SYL_HAEI8 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  52%  861 aa  SYL_HAEDU RecName: Full=Leucyl-tRNA synthetase;       
    1::766       0.0  57%  817 aa  SYL_THISH RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  52%  860 aa  SYL_PHOLL RecName: Full=Leucyl-tRNA synthetase;       
    1::815       0.0  51%  859 aa  SYL_SHEHH RecName: Full=Leucyl-tRNA synthetase;       
   32::774       0.0  55%  817 aa  SYL_HALHL RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  51%  860 aa  SYL_HAES2 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  52%  860 aa  SYL_HAES1 RecName: Full=Leucyl-tRNA synthetase;       
    1::778       0.0  54%  820 aa  SYL_COXB1 RecName: Full=Leucyl-tRNA synthetase;       
    1::814       0.0  54%  858 aa  SYL_VIBFM RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  861 aa  SYL_HAEIN RecName: Full=Leucyl-tRNA synthetase;       
    1::778       0.0  54%  820 aa  SYL_COXBR RecName: Full=Leucyl-tRNA synthetase;       
    1::847       0.0  50%  860 aa  SYL_ENTS8 RecName: Full=Leucyl-tRNA synthetase;       
    1::778       0.0  54%  820 aa  SYL_COXBU RecName: Full=Leucyl-tRNA synthetase;       
    1::778       0.0  54%  820 aa  SYL_COXBN RecName: Full=Leucyl-tRNA synthetase;       
    1::778       0.0  54%  820 aa  SYL_COXB2 RecName: Full=Leucyl-tRNA synthetase;       
    1::814       0.0  54%  858 aa  SYL_VIBF1 RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  861 aa  SYL_HAEIE RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  860 aa  SYL_PECCP RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  861 aa  SYL_ACTPJ RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  52%  861 aa  SYL_ACTP2 RecName: Full=Leucyl-tRNA synthetase;       
    1::771       0.0  55%  815 aa  SYL_MARMS RecName: Full=Leucyl-tRNA synthetase;       
    1::814       0.0  52%  858 aa  SYL_ALISL RecName: Full=Leucyl-tRNA synthetase;       
    1::776       0.0  55%  819 aa  SYL_SACD2 RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  51%  860 aa  SYL_KLEP7 RecName: Full=Leucyl-tRNA synthetase;       
    1::814       0.0  53%  858 aa  SYL_PHOPR RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  51%  860 aa  SYL_PROMH RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  51%  860 aa  SYL_KLEP3 RecName: Full=Leucyl-tRNA synthetase;       
    1::850       0.0  52%  894 aa  SYL_ENT38 RecName: Full=Leucyl-tRNA synthetase;       
    1::845       0.0  52%  858 aa  SYL_VIBCH RecName: Full=Leucyl-tRNA synthetase;       
    1::845       0.0  52%  858 aa  SYL_VIBC3 RecName: Full=Leucyl-tRNA synthetase;       
    1::799       0.0  52%  834 aa  SYL_ACTP7 RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  50%  860 aa  SYL_PASMU RecName: Full=Leucyl-tRNA synthetase;       
    1::824       0.0  49%  869 aa  SYL_HAMD5 RecName: Full=Leucyl-tRNA synthetase;       
    1::841       0.0  52%  855 aa  SYL_ACAM1 RecName: Full=Leucyl-tRNA synthetase;       
    1::804       0.0  52%  847 aa  SYL_GLOVI RecName: Full=Leucyl-tRNA synthetase;       
   17::820       0.0  55%  865 aa  SYL_SYNE7 RecName: Full=Leucyl-tRNA synthetase;       
    1::828       0.0  52%  871 aa  SYL_NOSP7 RecName: Full=Leucyl-tRNA synthetase;       
    1::770       0.0  51%  816 aa  SYL_RUTMC RecName: Full=Leucyl-tRNA synthetase;       
   17::820       0.0  55%  865 aa  SYL_SYNP6 RecName: Full=Leucyl-tRNA synthetase;       
    1::813       0.0  52%  858 aa  SYL_CYAP4 RecName: Full=Leucyl-tRNA synthetase;       
    1::809       0.0  52%  853 aa  SYL_CYAA5 RecName: Full=Leucyl-tRNA synthetase;       
    1::827       0.0  49%  870 aa  SYL_PARL1 RecName: Full=Leucyl-tRNA synthetase;       
    1::829       0.0  51%  872 aa  SYL_ANAVT RecName: Full=Leucyl-tRNA synthetase;       
    1::811       0.0  51%  856 aa  SYL_CYAP8 RecName: Full=Leucyl-tRNA synthetase;       
    1::829       0.0  51%  872 aa  SYL_ANASP RecName: Full=Leucyl-tRNA synthetase;       
    4::833       0.0  48%  876 aa  SYL_RHIME RecName: Full=Leucyl-tRNA synthetase;       
   12::805       0.0  49%  848 aa  SYL_NOVAD RecName: Full=Leucyl-tRNA synthetase;       
    1::779       0.0  52%  823 aa  SYL_LEGPA RecName: Full=Leucyl-tRNA synthetase;       
    1::779       0.0  52%  823 aa  SYL_LEGPH RecName: Full=Leucyl-tRNA synthetase;       
    1::779       0.0  51%  823 aa  SYL_LEGPL RecName: Full=Leucyl-tRNA synthetase;       
    1::779       0.0  52%  823 aa  SYL_LEGPC RecName: Full=Leucyl-tRNA synthetase;       
    4::820       0.0  49%  862 aa  SYL_RHORT RecName: Full=Leucyl-tRNA synthetase;       
    5::852       0.0  51%  864 aa  SYL_SYNR3 RecName: Full=Leucyl-tRNA synthetase;       
    1::840       0.0  51%  882 aa  SYL_SYNJB RecName: Full=Leucyl-tRNA synthetase;       
    1::811       0.0  50%  824 aa  SYL_GEOUR RecName: Full=Leucyl-tRNA synthetase;       
   22::863       0.0  50%  875 aa  SYL_SYNSC RecName: Full=Leucyl-tRNA synthetase;       
    1::838       0.0  50%  852 aa  SYL_SYNP2 RecName: Full=Leucyl-tRNA synthetase;       
    3::817       0.0  50%  861 aa  SYL_CAUCR RecName: Full=Leucyl-tRNA synthetase;       
    3::817       0.0  50%  861 aa  SYL_CAUCN RecName: Full=Leucyl-tRNA synthetase;       
    1::810       0.0  52%  854 aa  SYL_CYAP7 RecName: Full=Leucyl-tRNA synthetase;       
    4::833       0.0  49%  876 aa  SYL_RHISN RecName: Full=Leucyl-tRNA synthetase;       
    1::777       0.0  52%  821 aa  SYL_CARHZ RecName: Full=Leucyl-tRNA synthetase;       
    9::834       0.0  48%  846 aa  SYL_ZYMMO RecName: Full=Leucyl-tRNA synthetase;       
    1::779       0.0  51%  823 aa  SYL_PELPD RecName: Full=Leucyl-tRNA synthetase;       
    4::863       0.0  47%  875 aa  SYL_RHILO RecName: Full=Leucyl-tRNA synthetase;       
    4::833       0.0  49%  876 aa  SYL_SINMW RecName: Full=Leucyl-tRNA synthetase;       
    1::780       0.0  52%  824 aa  SYL_GEOMG RecName: Full=Leucyl-tRNA synthetase;       
    4::831       0.0  49%  874 aa  SYL_BRASB RecName: Full=Leucyl-tRNA synthetase;       
    1::784       0.0  50%  827 aa  SYL_DESHY RecName: Full=Leucyl-tRNA synthetase;       
    1::784       0.0  50%  827 aa  SYL_DESHD RecName: Full=Leucyl-tRNA synthetase;       
   29::872       0.0  49%  884 aa  SYL_SYNS9 RecName: Full=Leucyl-tRNA synthetase;       
    1::845       0.0  49%  857 aa  SYL_SYNPX RecName: Full=Leucyl-tRNA synthetase;       
    1::783       0.0  51%  829 aa  SYL_MOOTA RecName: Full=Leucyl-tRNA synthetase;       
    4::864       0.0  47%  876 aa  SYL_AGRVS RecName: Full=Leucyl-tRNA synthetase;       
    9::865       0.0  48%  877 aa  SYL_BRUAB RecName: Full=Leucyl-tRNA synthetase;       
    1::769       0.0  49%  815 aa  SYL_VESOH RecName: Full=Leucyl-tRNA synthetase;       
    1::780       0.0  52%  824 aa  SYL_GEOBB RecName: Full=Leucyl-tRNA synthetase;       
    9::865       0.0  48%  877 aa  SYL_BRUSI RecName: Full=Leucyl-tRNA synthetase;       
    9::865       0.0  48%  877 aa  SYL_BRUO2 RecName: Full=Leucyl-tRNA synthetase;       
    9::865       0.0  48%  877 aa  SYL_BRUME RecName: Full=Leucyl-tRNA synthetase;       
    9::865       0.0  48%  877 aa  SYL_BRUMB RecName: Full=Leucyl-tRNA synthetase;       
    1::826       0.0  51%  869 aa  SYL_SYNY3 RecName: Full=Leucyl-tRNA synthetase;       
    9::865       0.0  48%  877 aa  SYL_BRUA2 RecName: Full=Leucyl-tRNA synthetase;       
    9::865       0.0  48%  877 aa  SYL_BRUA1 RecName: Full=Leucyl-tRNA synthetase;       
    1::807       0.0  50%  851 aa  SYL_PELCD RecName: Full=Leucyl-tRNA synthetase;       
    1::841       0.0  50%  857 aa  SYL_THEEB RecName: Full=Leucyl-tRNA synthetase;       
    9::865       0.0  48%  877 aa  SYL_BRUSU RecName: Full=Leucyl-tRNA synthetase;       
   33::840       0.0  48%  883 aa  SYL_NITWN RecName: Full=Leucyl-tRNA synthetase;       
    1::780       0.0  51%  824 aa  SYL_GEOSM RecName: Full=Leucyl-tRNA synthetase;       
   33::839       0.0  49%  882 aa  SYL_RHOPB RecName: Full=Leucyl-tRNA synthetase;       
   33::835       0.0  49%  878 aa  SYL_NITHX RecName: Full=Leucyl-tRNA synthetase;       
    1::780       0.0  50%  824 aa  SYL_GEOSF RecName: Full=Leucyl-tRNA synthetase;       
    9::865       0.0  47%  877 aa  SYL_BRUC2 RecName: Full=Leucyl-tRNA synthetase;       
    1::816       0.0  48%  859 aa  SYL_MAGSM RecName: Full=Leucyl-tRNA synthetase;       
    1::818       0.0  48%  861 aa  SYL_BAUCH RecName: Full=Leucyl-tRNA synthetase;       
    4::864       0.0  48%  876 aa  SYL_RHIE6 RecName: Full=Leucyl-tRNA synthetase;       
    4::864       0.0  47%  876 aa  SYL2_RHIL3 RecName: Full=Leucyl-tRNA synthetase 2;       
    1::787       0.0  50%  829 aa  SYL_SYNFM RecName: Full=Leucyl-tRNA synthetase;       
    9::834       0.0  48%  877 aa  SYL_OCHA4 RecName: Full=Leucyl-tRNA synthetase;       
    1::821       0.0  49%  863 aa  SYL_DESAA RecName: Full=Leucyl-tRNA synthetase;       
    3::822       0.0  46%  865 aa  SYL_MARMM RecName: Full=Leucyl-tRNA synthetase;       
   10::820       0.0  50%  862 aa  SYL_MAGSA RecName: Full=Leucyl-tRNA synthetase;       
    4::833       0.0  48%  875 aa  SYL_BARBK RecName: Full=Leucyl-tRNA synthetase;       
   18::835       0.0  49%  878 aa  SYL_SYNPW RecName: Full=Leucyl-tRNA synthetase;       
    1::841       0.0  48%  855 aa  SYL_HYPNA RecName: Full=Leucyl-tRNA synthetase;       
   17::822       0.0  49%  867 aa  SYL_SYNS3 RecName: Full=Leucyl-tRNA synthetase;       
    9::813       0.0  47%  859 aa  SYL_FUSNN RecName: Full=Leucyl-tRNA synthetase;       
   33::862       0.0  50%  874 aa  SYL_AZOC5 RecName: Full=Leucyl-tRNA synthetase;       
    4::831       0.0  48%  874 aa  SYL_BRASO RecName: Full=Leucyl-tRNA synthetase;       
    8::785       0.0  50%  827 aa  SYL_DESPS RecName: Full=Leucyl-tRNA synthetase;       
    1::784       0.0  51%  827 aa  SYL_PELTS RecName: Full=Leucyl-tRNA synthetase;       
   12::843       0.0  48%  886 aa  SYL_BART1 RecName: Full=Leucyl-tRNA synthetase;       
   17::866       0.0  48%  878 aa  SYL_PROMM RecName: Full=Leucyl-tRNA synthetase;       
   17::866       0.0  48%  878 aa  SYL_PROM3 RecName: Full=Leucyl-tRNA synthetase;       
    5::824       0.0  46%  867 aa  SYL_PHEZH RecName: Full=Leucyl-tRNA synthetase;       
    2::786       0.0  51%  829 aa  SYL_DESVH RecName: Full=Leucyl-tRNA synthetase;       
    2::786       0.0  51%  829 aa  SYL_DESVV RecName: Full=Leucyl-tRNA synthetase;       
    3::832       0.0  46%  844 aa  SYL_PARDP RecName: Full=Leucyl-tRNA synthetase;       
    2::786       0.0  51%  829 aa  SYL_DESDG RecName: Full=Leucyl-tRNA synthetase;       
   11::837       0.0  47%  849 aa  SYL_SPHAL RecName: Full=Leucyl-tRNA synthetase;       
    4::858       0.0  46%  871 aa  SYL_MESSB RecName: Full=Leucyl-tRNA synthetase;       
    8::774       0.0  50%  817 aa  SYL_CALS8 RecName: Full=Leucyl-tRNA synthetase;       
    1::820       0.0  48%  863 aa  SYL_DESAH RecName: Full=Leucyl-tRNA synthetase;       
   31::822       0.0  50%  865 aa  SYL_RHOCS RecName: Full=Leucyl-tRNA synthetase;       
    4::866       0.0  46%  879 aa  SYL_OLICO RecName: Full=Leucyl-tRNA synthetase;       
   16::817       0.0  52%  861 aa  SYL_SYMTH RecName: Full=Leucyl-tRNA synthetase;       
    4::823       0.0  47%  835 aa  SYL_RICRS RecName: Full=Leucyl-tRNA synthetase;       
    4::823       0.0  47%  835 aa  SYL_RICRO RecName: Full=Leucyl-tRNA synthetase;       
   26::782       0.0  50%  825 aa  SYL_CLOTH RecName: Full=Leucyl-tRNA synthetase;       
    2::791       0.0  49%  834 aa  SYL_DESVM RecName: Full=Leucyl-tRNA synthetase;       
    1::802       0.0  51%  846 aa  SYL_HELMI RecName: Full=Leucyl-tRNA synthetase;       
    3::835       0.0  46%  847 aa  SYL_RHOS4 RecName: Full=Leucyl-tRNA synthetase;       
    1::784       0.0  51%  827 aa  SYL_DESRM RecName: Full=Leucyl-tRNA synthetase;       
    4::823       0.0  47%  835 aa  SYL_RICCN RecName: Full=Leucyl-tRNA synthetase;       
    4::823       0.0  47%  835 aa  SYL_RICAE RecName: Full=Leucyl-tRNA synthetase;       
    3::835       0.0  47%  847 aa  SYL_RHOSK RecName: Full=Leucyl-tRNA synthetase;       
    3::835       0.0  47%  847 aa  SYL_RHOS1 RecName: Full=Leucyl-tRNA synthetase;       
   15::837       0.0  47%  880 aa  SYL_BARHE RecName: Full=Leucyl-tRNA synthetase;       
    4::823       0.0  47%  835 aa  SYL_RICFE RecName: Full=Leucyl-tRNA synthetase;       
    9::781       0.0  48%  824 aa  SYL_ALKMQ RecName: Full=Leucyl-tRNA synthetase;       
    4::823       0.0  47%  835 aa  SYL_RICM5 RecName: Full=Leucyl-tRNA synthetase;       
   10::837       0.0  46%  880 aa  SYL_BARQU RecName: Full=Leucyl-tRNA synthetase;       
    4::823       0.0  47%  835 aa  SYL_RICPU RecName: Full=Leucyl-tRNA synthetase;       
    1::780       0.0  49%  824 aa  SYL_GEOSL RecName: Full=Leucyl-tRNA synthetase;       
    4::864       0.0  45%  876 aa  SYL_RHIEC RecName: Full=Leucyl-tRNA synthetase;       
    1::829       0.0  46%  872 aa  SYL_BLOPB RecName: Full=Leucyl-tRNA synthetase;       
    4::864       0.0  44%  876 aa  SYL_AGRT5 RecName: Full=Leucyl-tRNA synthetase;       
    3::817       0.0  46%  861 aa  SYL_CAUSK RecName: Full=Leucyl-tRNA synthetase;       
    1::861       0.0  45%  873 aa  SYL_SYNJA RecName: Full=Leucyl-tRNA synthetase;       
   20::783       0.0  48%  831 aa  SYL_RICBR RecName: Full=Leucyl-tRNA synthetase;       
   12::850       0.0  45%  862 aa  SYL_PROMT RecName: Full=Leucyl-tRNA synthetase;       
    1::817       0.0  49%  862 aa  SYL_SYNAS RecName: Full=Leucyl-tRNA synthetase;       
    2::774       0.0  49%  819 aa  SYL_WOLSU RecName: Full=Leucyl-tRNA synthetase;       
    1::886       0.0  52%  929 aa  SYL_TRIEI RecName: Full=Leucyl-tRNA synthetase;       
   10::823       0.0  47%  835 aa  SYL_SPHWW RecName: Full=Leucyl-tRNA synthetase;       
    3::844       0.0  45%  857 aa  SYL_SILST RecName: Full=Leucyl-tRNA synthetase;       
    3::861       0.0  44%  873 aa  SYL_RHOS5 RecName: Full=Leucyl-tRNA synthetase;       
    1::781       0.0  49%  824 aa  SYL_SYNWW RecName: Full=Leucyl-tRNA synthetase;       
    4::857       0.0  46%  870 aa  SYL_RICAH RecName: Full=Leucyl-tRNA synthetase;       
    4::864       0.0  45%  876 aa  SYL_RHILW RecName: Full=Leucyl-tRNA synthetase;       
    3::835       0.0  45%  848 aa  SYL_ROSDO RecName: Full=Leucyl-tRNA synthetase;       
    1::824       0.0  45%  867 aa  SYL_BLOFL RecName: Full=Leucyl-tRNA synthetase;       
   16::779       0.0  49%  823 aa  SYL_DEIRA RecName: Full=Leucyl-tRNA synthetase;       
    2::797       0.0  50%  838 aa  SYL_WOLPM RecName: Full=Leucyl-tRNA synthetase;       
   19::821       0.0  48%  865 aa  SYL_GLUOX RecName: Full=Leucyl-tRNA synthetase;       
    3::778       0.0  49%  819 aa  SYL_FERNB RecName: Full=Leucyl-tRNA synthetase;       
    3::777       0.0  46%  823 aa  SYL_THEM4 RecName: Full=Leucyl-tRNA synthetase;       
    4::831       0.0  49%  876 aa  SYL_METSB RecName: Full=Leucyl-tRNA synthetase;       
   16::829       0.0  47%  872 aa  SYL_PROM4 RecName: Full=Leucyl-tRNA synthetase;       
    3::839       0.0  45%  852 aa  SYL_SILPO RecName: Full=Leucyl-tRNA synthetase;       
    1::786       0.0  49%  830 aa  SYL_HALOH RecName: Full=Leucyl-tRNA synthetase;       
    9::762       0.0  50%  806 aa  SYL_CLOD6 RecName: Full=Leucyl-tRNA synthetase;       
    2::797       0.0  50%  838 aa  SYL_WOLWR RecName: Full=Leucyl-tRNA synthetase;       
    2::773       0.0  49%  815 aa  SYL_NITSB RecName: Full=Leucyl-tRNA synthetase;       
   33::820       0.0  46%  864 aa  SYL_ACICJ RecName: Full=Leucyl-tRNA synthetase;       
    3::813       0.0  47%  826 aa  SYL_NATTJ RecName: Full=Leucyl-tRNA synthetase;       
   26::816       0.0  46%  828 aa  SYL_RICPR RecName: Full=Leucyl-tRNA synthetase;       
    4::822       0.0  46%  834 aa  SYL_RICCK RecName: Full=Leucyl-tRNA synthetase;       
   50::830       0.0  47%  875 aa  SYL_GRABC RecName: Full=Leucyl-tRNA synthetase;       
   11::862       0.0  46%  904 aa  SYL_ROSS1 RecName: Full=Leucyl-tRNA synthetase;       
   16::862       0.0  47%  904 aa  SYL_ROSCS RecName: Full=Leucyl-tRNA synthetase;       
   15::815       0.0  47%  858 aa  SYL_PROMP RecName: Full=Leucyl-tRNA synthetase;       
   12::775       0.0  48%  819 aa  SYL_DEIGD RecName: Full=Leucyl-tRNA synthetase;       
   30::778       0.0  49%  819 aa  SYL_WOLPP RecName: Full=Leucyl-tRNA synthetase;       
   12::850       0.0  43%  862 aa  SYL_PROM1 RecName: Full=Leucyl-tRNA synthetase;       
    1::782       0.0  48%  826 aa  SYL_DESAP RecName: Full=Leucyl-tRNA synthetase;       
   26::782       0.0  47%  824 aa  SYL_THEP1 RecName: Full=Leucyl-tRNA synthetase;       
   33::845       0.0  46%  888 aa  SYL_RHOP5 RecName: Full=Leucyl-tRNA synthetase;       
   33::835       0.0  48%  878 aa  SYL_RHOPS RecName: Full=Leucyl-tRNA synthetase;       
    5::789       0.0  47%  830 aa  SYL_HELHP RecName: Full=Leucyl-tRNA synthetase;       
   11::831       0.0  46%  874 aa  SYL_BRAJA RecName: Full=Leucyl-tRNA synthetase;       
   26::782       0.0  46%  824 aa  SYL_THEMA RecName: Full=Leucyl-tRNA synthetase;       
    3::820       0.0  43%  863 aa  SYL_JANSC RecName: Full=Leucyl-tRNA synthetase;       
   19::821       0.0  45%  864 aa  SYL_PROM5 RecName: Full=Leucyl-tRNA synthetase;       
   33::831       0.0  47%  874 aa  SYL_RHOP2 RecName: Full=Leucyl-tRNA synthetase;       
   26::816       0.0  45%  828 aa  SYL_RICTY RecName: Full=Leucyl-tRNA synthetase;       
   33::834       0.0  47%  876 aa  SYL_RHOPT RecName: Full=Leucyl-tRNA synthetase;       
   15::813       0.0  45%  856 aa  SYL_PROMS RecName: Full=Leucyl-tRNA synthetase;       
   33::834       0.0  47%  876 aa  SYL_RHOPA RecName: Full=Leucyl-tRNA synthetase;       
    3::774       0.0  46%  815 aa  SYL_THELT RecName: Full=Leucyl-tRNA synthetase;       
    3::792       0.0  46%  835 aa  SYL_LAWIP RecName: Full=Leucyl-tRNA synthetase;       
   15::813       0.0  45%  856 aa  SYL_PROM0 RecName: Full=Leucyl-tRNA synthetase;       
    1::784       0.0  46%  828 aa  SYL_PETMO RecName: Full=Leucyl-tRNA synthetase;       
   15::813       0.0  44%  856 aa  SYL_PROM2 RecName: Full=Leucyl-tRNA synthetase;       
    6::778       0.0  48%  821 aa  SYL_CAMC5 RecName: Full=Leucyl-tRNA synthetase;       
    2::804       0.0  46%  853 aa  SYL_BRAHW RecName: Full=Leucyl-tRNA synthetase;       
    8::784       0.0  46%  829 aa  SYL_EHRCJ RecName: Full=Leucyl-tRNA synthetase;       
   23::784       0.0  44%  829 aa  SYL_EHRCR RecName: Full=Leucyl-tRNA synthetase;       
    1::770       0.0  46%  813 aa  SYL_DEHE1 RecName: Full=Leucyl-tRNA synthetase;       
    1::818       0.0  42%  861 aa  SYL_BUCAP RecName: Full=Leucyl-tRNA synthetase;       
   10::767       0.0  48%  810 aa  SYL_SOLUE RecName: Full=Leucyl-tRNA synthetase;       
   17::827       0.0  45%  870 aa  SYL_PROMA RecName: Full=Leucyl-tRNA synthetase;       
    6::772       0.0  47%  816 aa  SYL_CLOPS RecName: Full=Leucyl-tRNA synthetase;       
    6::772       0.0  47%  816 aa  SYL_CLOPE RecName: Full=Leucyl-tRNA synthetase;       
   13::787       0.0  45%  829 aa  SYL_ANAMM RecName: Full=Leucyl-tRNA synthetase;       
    1::770       0.0  46%  813 aa  SYL_DEHSB RecName: Full=Leucyl-tRNA synthetase;       
    2::824       0.0  46%  865 aa  SYL_WOLTR RecName: Full=Leucyl-tRNA synthetase;       
    3::780       0.0  45%  822 aa  SYL_SULDN RecName: Full=Leucyl-tRNA synthetase;       
    1::770       0.0  46%  813 aa  SYL_DEHSC RecName: Full=Leucyl-tRNA synthetase;       
    6::778     e-180  47%  821 aa  SYL_CAMC1 RecName: Full=Leucyl-tRNA synthetase;       
   15::813     e-179  43%  856 aa  SYL_PROM9 RecName: Full=Leucyl-tRNA synthetase;       
    1::770     e-179  45%  814 aa  SYL_HERA2 RecName: Full=Leucyl-tRNA synthetase;       
    6::790     e-179  44%  838 aa  SYL_ORITB RecName: Full=Leucyl-tRNA synthetase;       
    2::768     e-178  47%  811 aa  SYL_CAMFF RecName: Full=Leucyl-tRNA synthetase;       
   13::827     e-178  46%  869 aa  SYL_DINSH RecName: Full=Leucyl-tRNA synthetase;       
    1::811     e-178  44%  859 aa  SYL_BUCAI RecName: Full=Leucyl-tRNA synthetase;       
   25::783     e-178  47%  831 aa  SYL_NEOSM RecName: Full=Leucyl-tRNA synthetase;       
    5::764     e-177  47%  806 aa  SYL_HELAH RecName: Full=Leucyl-tRNA synthetase;       
   28::786     e-177  45%  830 aa  SYL_EHRRW RecName: Full=Leucyl-tRNA synthetase;       
   28::786     e-177  45%  830 aa  SYL_EHRRG RecName: Full=Leucyl-tRNA synthetase;       
    2::778     e-177  46%  821 aa  SYL_ARCB4 RecName: Full=Leucyl-tRNA synthetase;       
   31::771     e-177  49%  813 aa  SYL_CAMHC RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-176  47%  802 aa  SYL_BACWK RecName: Full=Leucyl-tRNA synthetase;       
    8::761     e-176  46%  804 aa  SYL_BACP2 RecName: Full=Leucyl-tRNA synthetase;       
    8::762     e-175  46%  805 aa  SYL_GEOTN RecName: Full=Leucyl-tRNA synthetase;       
    6::772     e-175  46%  816 aa  SYL_CLOP1 RecName: Full=Leucyl-tRNA synthetase;       
    1::596     e-175  55%  634 aa  SYLA_AQUAE RecName: Full=Leucyl-tRNA synthetase subunit alpha;     
    3::726     e-175  49%  809 aa  SYL_CAMJD RecName: Full=Leucyl-tRNA synthetase;       
   30::764     e-175  49%  806 aa  SYL_HELPJ RecName: Full=Leucyl-tRNA synthetase;       
   32::767     e-174  46%  809 aa  SYL_CAMLR RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-173  46%  802 aa  SYL_BACCQ RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-173  46%  802 aa  SYL_BACC7 RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-173  46%  802 aa  SYL_BACC1 RecName: Full=Leucyl-tRNA synthetase;       
    3::767     e-173  46%  809 aa  SYL_CAMJ8 RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-173  46%  802 aa  SYL_BACHK RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-172  46%  802 aa  SYL_BACCR RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-172  46%  802 aa  SYL_BACC4 RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-172  46%  802 aa  SYL_BACCZ RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-172  46%  802 aa  SYL_BACC3 RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-172  46%  802 aa  SYL_BACC0 RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-172  46%  802 aa  SYL_BACAN RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-172  46%  802 aa  SYL_BACAH RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-172  46%  802 aa  SYL_BACAC RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-172  46%  802 aa  SYL_BACAA RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-172  46%  802 aa  SYL_BACC2 RecName: Full=Leucyl-tRNA synthetase;       
    8::758     e-171  46%  802 aa  SYL_BACCN RecName: Full=Leucyl-tRNA synthetase;       
   30::764     e-171  48%  806 aa  SYL_HELPH RecName: Full=Leucyl-tRNA synthetase;       
   30::764     e-171  47%  806 aa  SYL_HELPY RecName: Full=Leucyl-tRNA synthetase;       
    8::762     e-171  46%  805 aa  SYL_ANOFW RecName: Full=Leucyl-tRNA synthetase;       
    8::761     e-170  44%  804 aa  SYL_OCEIH RecName: Full=Leucyl-tRNA synthetase;       
    3::726     e-170  48%  809 aa  SYL_CAMJJ RecName: Full=Leucyl-tRNA synthetase;       
   18::786     e-170  45%  830 aa  SYL_THEFY RecName: Full=Leucyl-tRNA synthetase;       
    3::726     e-170  48%  809 aa  SYL_CAMJR RecName: Full=Leucyl-tRNA synthetase;       
    3::758     e-169  44%  802 aa  SYL_ALKOO RecName: Full=Leucyl-tRNA synthetase;       
    3::726     e-168  48%  809 aa  SYL_CAMJE RecName: Full=Leucyl-tRNA synthetase;       
    8::761     e-168  45%  805 aa  SYL_BREBN RecName: Full=Leucyl-tRNA synthetase;       
   26::761     e-167  45%  804 aa  SYL_BACSU RecName: Full=Leucyl-tRNA synthetase;       
    9::791     e-167  43%  835 aa  SYL_ELUMP RecName: Full=Leucyl-tRNA synthetase;       
    8::754     e-167  44%  806 aa  SYL_BACHD RecName: Full=Leucyl-tRNA synthetase;       
    1::813     e-167  40%  861 aa  SYL_BUCBP RecName: Full=Leucyl-tRNA synthetase;       
    8::762     e-166  44%  805 aa  SYL_GEOKA RecName: Full=Leucyl-tRNA synthetase;       
    6::768     e-166  43%  812 aa  SYL_CLONN RecName: Full=Leucyl-tRNA synthetase;       
   24::799     e-166  44%  843 aa  SYL_ARTS2 RecName: Full=Leucyl-tRNA synthetase;       
   32::789     e-165  44%  832 aa  SYL_ACIC1 RecName: Full=Leucyl-tRNA synthetase;       
   39::819     e-165  43%  862 aa  SYL_RENSM RecName: Full=Leucyl-tRNA synthetase;       
    8::762     e-165  45%  805 aa  SYL_GEOSW RecName: Full=Leucyl-tRNA synthetase;       
    8::761     e-165  46%  804 aa  SYL_BACLD RecName: Full=Leucyl-tRNA synthetase;       
    6::810     e-164  41%  858 aa  SYL_TREDE RecName: Full=Leucyl-tRNA synthetase;       
    3::761     e-164  44%  804 aa  SYL_STAHJ RecName: Full=Leucyl-tRNA synthetase;       
    1::776     e-163  42%  819 aa  SYL_THETN RecName: Full=Leucyl-tRNA synthetase;       
   36::832     e-163  43%  874 aa  SYLM_SCHPO RecName: Full=Putative leucyl-tRNA synthetase,
    8::769     e-162  43%  813 aa  SYL_CLOBL RecName: Full=Leucyl-tRNA synthetase;       
    8::761     e-162  44%  804 aa  SYL_BACA2 RecName: Full=Leucyl-tRNA synthetase;       
   37::805     e-162  45%  848 aa  SYL_NOCSJ RecName: Full=Leucyl-tRNA synthetase;       
    8::761     e-162  44%  805 aa  SYL_LYSSC RecName: Full=Leucyl-tRNA synthetase;       
    3::759     e-162  44%  805 aa  SYL_LACF3 RecName: Full=Leucyl-tRNA synthetase;       
    8::760     e-162  44%  804 aa  SYL_BACSK RecName: Full=Leucyl-tRNA synthetase;       
    3::788     e-161  43%  838 aa  SYL1_RHIL3 RecName: Full=Leucyl-tRNA synthetase 1;       
   25::798     e-161  42%  842 aa  SYL_ARTAT RecName: Full=Leucyl-tRNA synthetase;       
    8::769     e-161  43%  813 aa  SYL_CLOBH RecName: Full=Leucyl-tRNA synthetase;       
    8::769     e-161  43%  813 aa  SYL_CLOB1 RecName: Full=Leucyl-tRNA synthetase;       
    7::763     e-160  43%  807 aa  SYL_LACSS RecName: Full=Leucyl-tRNA synthetase;       
   32::768     e-160  45%  812 aa  SYL_CLOTE RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-160  43%  833 aa  SYL_STRPI RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-160  43%  833 aa  SYL_STRP4 RecName: Full=Leucyl-tRNA synthetase;       
    8::772     e-159  44%  816 aa  SYL_CLOB8 RecName: Full=Leucyl-tRNA synthetase;       
   26::767     e-159  43%  811 aa  SYL_CLOK5 RecName: Full=Leucyl-tRNA synthetase;       
    2::758     e-159  43%  802 aa  SYL_FINM2 RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-159  43%  833 aa  SYL_STRZP RecName: Full=Leucyl-tRNA synthetase;       
    3::760     e-159  43%  804 aa  SYL_ENTFA RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-159  43%  833 aa  SYL_STRPN RecName: Full=Leucyl-tRNA synthetase;       
    3::761     e-159  43%  804 aa  SYL_STAES RecName: Full=Leucyl-tRNA synthetase;       
    3::761     e-159  43%  804 aa  SYL_STAEQ RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-158  43%  833 aa  SYL_STRZT RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-158  43%  833 aa  SYL_STRZJ RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-158  43%  833 aa  SYL_STRPJ RecName: Full=Leucyl-tRNA synthetase;       
    3::760     e-158  45%  804 aa  SYL_STAS1 RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-158  43%  833 aa  SYL_STRTD RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-158  43%  833 aa  SYL_STRT2 RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-158  43%  833 aa  SYL_STRT1 RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-158  43%  833 aa  SYL_STRR6 RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-158  43%  833 aa  SYL_STRP2 RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-158  43%  833 aa  SYL_STRPS RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-158  43%  833 aa  SYL_STRP7 RecName: Full=Leucyl-tRNA synthetase;       
    1::778     e-158  40%  864 aa  SYL_WIGBR RecName: Full=Leucyl-tRNA synthetase;       
    8::757     e-158  45%  801 aa  SYL_EXIS2 RecName: Full=Leucyl-tRNA synthetase;       
    8::758     e-158  43%  802 aa  SYL_MACCJ RecName: Full=Leucyl-tRNA synthetase;       
   33::760     e-157  45%  805 aa  SYL_LACS1 RecName: Full=Leucyl-tRNA synthetase;       
    8::759     e-157  43%  803 aa  SYL_LISIN RecName: Full=Leucyl-tRNA synthetase;       
    3::760     e-156  43%  806 aa  SYL_LACRJ RecName: Full=Leucyl-tRNA synthetase;       
    3::760     e-156  43%  806 aa  SYL_LACRD RecName: Full=Leucyl-tRNA synthetase;       
    7::866     e-156  39%  878 aa  SYL_TREPS RecName: Full=Leucyl-tRNA synthetase;       
    7::866     e-156  39%  878 aa  SYL_TREPA RecName: Full=Leucyl-tRNA synthetase;       
   14::774     e-156  43%  817 aa  SYL_RUBXD RecName: Full=Leucyl-tRNA synthetase;       
    3::767     e-156  42%  810 aa  SYL_OENOB RecName: Full=Leucyl-tRNA synthetase;       
    4::763     e-155  41%  807 aa  SYL_STAAW RecName: Full=Leucyl-tRNA synthetase;       
    3::762     e-155  41%  806 aa  SYL_STAAS RecName: Full=Leucyl-tRNA synthetase;       
    3::764     e-155  42%  808 aa  SYL_LEUMM RecName: Full=Leucyl-tRNA synthetase;       
    8::753     e-155  42%  812 aa  SYL_CLOAB RecName: Full=Leucyl-tRNA synthetase;       
    4::761     e-155  41%  805 aa  SYL_STAAT RecName: Full=Leucyl-tRNA synthetase;       
    3::760     e-155  41%  804 aa  SYL_STAAR RecName: Full=Leucyl-tRNA synthetase;       
    3::760     e-155  41%  804 aa  SYL_STAAN RecName: Full=Leucyl-tRNA synthetase;       
    3::760     e-155  41%  804 aa  SYL_STAAM RecName: Full=Leucyl-tRNA synthetase;       
    4::761     e-155  41%  805 aa  SYL_STAAE RecName: Full=Leucyl-tRNA synthetase;       
    4::761     e-155  41%  805 aa  SYL_STAAC RecName: Full=Leucyl-tRNA synthetase;       
    4::761     e-155  41%  805 aa  SYL_STAA9 RecName: Full=Leucyl-tRNA synthetase;       
    4::761     e-155  41%  805 aa  SYL_STAA8 RecName: Full=Leucyl-tRNA synthetase;       
    4::761     e-155  41%  805 aa  SYL_STAA3 RecName: Full=Leucyl-tRNA synthetase;       
    4::761     e-155  41%  805 aa  SYL_STAA2 RecName: Full=Leucyl-tRNA synthetase;       
    3::760     e-155  41%  804 aa  SYL_STAA1 RecName: Full=Leucyl-tRNA synthetase;       
    9::789     e-155  42%  833 aa  SYL_STRGC RecName: Full=Leucyl-tRNA synthetase;       
   17::805     e-155  43%  851 aa  SYL_CLAM3 RecName: Full=Leucyl-tRNA synthetase;       
    2::756     e-154  43%  804 aa  SYL_LACJO RecName: Full=Leucyl-tRNA synthetase;       
    2::777     e-154  43%  820 aa  SYL_CHLAB RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-154  41%  833 aa  SYL_STRSV RecName: Full=Leucyl-tRNA synthetase;       
    8::759     e-154  42%  803 aa  SYL_LISMF RecName: Full=Leucyl-tRNA synthetase;       
    8::759     e-154  42%  803 aa  SYL_LISMC RecName: Full=Leucyl-tRNA synthetase;       
   47::894     e-154  42%  940 aa  SYLM_DICDI RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
    3::760     e-154  42%  804 aa  SYL_STAAB RecName: Full=Leucyl-tRNA synthetase;       
   23::811     e-154  43%  855 aa  SYL_KINRD RecName: Full=Leucyl-tRNA synthetase;       
    8::761     e-154  42%  805 aa  SYL_PEDPA RecName: Full=Leucyl-tRNA synthetase;       
    2::760     e-154  42%  804 aa  SYL_LACDA RecName: Full=Leucyl-tRNA synthetase;       
    2::779     e-154  42%  820 aa  SYL_CHLFF RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-153  42%  833 aa  SYL_STRP3 RecName: Full=Leucyl-tRNA synthetase;       
    2::779     e-153  42%  820 aa  SYL_CHLPN RecName: Full=Leucyl-tRNA synthetase;       
    2::779     e-153  43%  829 aa  SYL_LACLM RecName: Full=Leucyl-tRNA synthetase;       
    2::779     e-153  43%  829 aa  SYL_LACLA RecName: Full=Leucyl-tRNA synthetase;       
    2::760     e-153  42%  804 aa  SYL_LACDB RecName: Full=Leucyl-tRNA synthetase;       
    2::777     e-153  42%  820 aa  SYL_CHLCV RecName: Full=Leucyl-tRNA synthetase;       
    2::762     e-153  43%  807 aa  SYL_PELPB RecName: Full=Leucyl-tRNA synthetase;       
    8::759     e-153  42%  803 aa  SYL_LISMH RecName: Full=Leucyl-tRNA synthetase;       
   30::752     e-153  44%  796 aa  SYL_BDEBA RecName: Full=Leucyl-tRNA synthetase;       
    8::759     e-153  42%  803 aa  SYL_LISMO RecName: Full=Leucyl-tRNA synthetase;       
    2::761     e-152  43%  807 aa  SYL_CHLP8 RecName: Full=Leucyl-tRNA synthetase;       
    8::759     e-152  42%  803 aa  SYL_LISW6 RecName: Full=Leucyl-tRNA synthetase;       
    2::778     e-152  41%  819 aa  SYL_CHLTA RecName: Full=Leucyl-tRNA synthetase;       
   47::842     e-152  43%  894 aa  SYLM_SACDO RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
    8::814     e-152  41%  863 aa  SYL_SALRD RecName: Full=Leucyl-tRNA synthetase;       
    2::758     e-152  43%  805 aa  SYL_PELLD RecName: Full=Leucyl-tRNA synthetase;       
    2::756     e-151  42%  804 aa  SYL_LACH4 RecName: Full=Leucyl-tRNA synthetase;       
   48::842     e-151  44%  894 aa  SYLM_YEAST RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
    4::738     e-151  42%  885 aa  SYL_HALSA RecName: Full=Leucyl-tRNA synthetase;       
    2::778     e-151  41%  819 aa  SYL_CHLTR RecName: Full=Leucyl-tRNA synthetase;       
    2::761     e-151  43%  807 aa  SYL_CHLTE RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-151  41%  833 aa  SYL_STREM RecName: Full=Leucyl-tRNA synthetase;       
   36::819     e-150  42%  866 aa  SYL_LEIXX RecName: Full=Leucyl-tRNA synthetase;       
   17::805     e-150  42%  852 aa  SYL_CLAMS RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-150  41%  833 aa  SYL_STRS7 RecName: Full=Leucyl-tRNA synthetase;       
   61::874     e-150  44%  994 aa  SYLM_NEUCR RecName: Full=Leucyl-tRNA synthetase, mitochondrial;    
    3::759     e-150  42%  803 aa  SYL_LEUCK RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-150  41%  833 aa  SYL_STRMU RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-150  41%  833 aa  SYL_STRE4 RecName: Full=Leucyl-tRNA synthetase;       
   33::795     e-149  41%  808 aa  SYL_LACPL RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-149  41%  833 aa  SYL_STRSY RecName: Full=Leucyl-tRNA synthetase;       
    4::789     e-149  41%  833 aa  SYL_STRS2 RecName: Full=Leucyl-tRNA synthetase;       
    2::756     e-149  42%  804 aa  SYL_LACGA RecName: Full=Leucyl-tRNA synthetase;       
    2::760     e-149  43%  805 aa  SYL_PROVI RecName: Full=Leucyl-tRNA synthetase;       
    4::781     e-149  42%  833 aa  SYL_STRU0 RecName: Full=Leucyl-tRNA synthetase;       
    2::778     e-149  41%  819 aa  SYL_CHLTB RecName: Full=Leucyl-tRNA synthetase;       
    2::778     e-149  41%  819 aa  SYL_CHLT2 RecName: Full=Leucyl-tRNA synthetase;       
    2::758     e-148  43%  805 aa  SYL_CHLT3 RecName: Full=Leucyl-tRNA synthetase;       
    2::761     e-148  42%  806 aa  SYL_CHLPB RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-148  41%  833 aa  SYL_STRPD RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-148  41%  833 aa  SYL_STRP8 RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-148  41%  833 aa  SYL_STRPG RecName: Full=Leucyl-tRNA synthetase;       
   26::778     e-148  42%  819 aa  SYL_CHLMU RecName: Full=Leucyl-tRNA synthetase;       
    3::790     e-148  40%  842 aa  SYL_BORRA RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-148  41%  833 aa  SYL_STRP6 RecName: Full=Leucyl-tRNA synthetase;       
    3::790     e-148  40%  842 aa  SYL_BORDL RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-148  41%  833 aa  SYL_STRA5 RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-148  41%  833 aa  SYL_STRA3 RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-147  41%  833 aa  SYL_STRP1 RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-147  41%  833 aa  SYL_STRPC RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-147  41%  833 aa  SYL_STRPB RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-147  41%  833 aa  SYL_STRA1 RecName: Full=Leucyl-tRNA synthetase;       
    3::794     e-147  40%  840 aa  SYL_BORAP RecName: Full=Leucyl-tRNA synthetase;       
    2::761     e-147  42%  806 aa  SYL_PROA2 RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-147  41%  833 aa  SYL_STRPF RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-147  41%  833 aa  SYL_STRPZ RecName: Full=Leucyl-tRNA synthetase;       
   29::806     e-147  44%  854 aa  SYL_SORC5 RecName: Full=Leucyl-tRNA synthetase;       
    4::779     e-146  41%  833 aa  SYL_STRPM RecName: Full=Leucyl-tRNA synthetase;       
    2::778     e-146  41%  829 aa  SYL_LACLS RecName: Full=Leucyl-tRNA synthetase;       
    3::794     e-146  40%  840 aa  SYL_BORGA RecName: Full=Leucyl-tRNA synthetase;       
    3::765     e-146  42%  809 aa  SYL_LACBA RecName: Full=Leucyl-tRNA synthetase;       
    2::767     e-145  42%  816 aa  SYL_CHLPD RecName: Full=Leucyl-tRNA synthetase;       
    2::756     e-145  41%  804 aa  SYL_LACAC RecName: Full=Leucyl-tRNA synthetase;       
   29::784     e-145  40%  803 aa  SYL_LACCB RecName: Full=Leucyl-tRNA synthetase;       
   29::784     e-145  40%  803 aa  SYL_LACC3 RecName: Full=Leucyl-tRNA synthetase;       
    2::762     e-145  41%  805 aa  SYL_CHLCH RecName: Full=Leucyl-tRNA synthetase;       
    3::794     e-144  39%  840 aa  SYL_BORBZ RecName: Full=Leucyl-tRNA synthetase;       
    3::794     e-144  39%  840 aa  SYL_BORBU RecName: Full=Leucyl-tRNA synthetase;       
    2::802     e-142  38%  845 aa  SYL_PARUW RecName: Full=Leucyl-tRNA synthetase;       
    8::823     e-141  41%  867 aa  SYL_LEPBP RecName: Full=Leucyl-tRNA synthetase;       
    8::823     e-141  41%  867 aa  SYL_LEPBA RecName: Full=Leucyl-tRNA synthetase;       
    2::762     e-141  40%  805 aa  SYL_CHLL2 RecName: Full=Leucyl-tRNA synthetase;       
   73::855     e-140  40%  902 aa  SYLM_MOUSE RecName: Full=Probable leucyl-tRNA synthetase,
    3::906     e-139  40%  950 aa  SYL_RHOBA RecName: Full=Leucyl-tRNA synthetase;       
    8::820     e-139  41%  863 aa  SYL_LEPIC RecName: Full=Leucyl-tRNA synthetase;       
   79::856     e-139  40%  903 aa  SYLM_HUMAN RecName: Full=Probable leucyl-tRNA synthetase,
    8::820     e-139  41%  863 aa  SYL_LEPIN RecName: Full=Leucyl-tRNA synthetase;       
   79::856     e-138  40%  903 aa  SYLM_PONAB RecName: Full=Probable leucyl-tRNA synthetase,
    3::759     e-138  41%  803 aa  SYL_ACHLI RecName: Full=Leucyl-tRNA synthetase;       
    3::796     e-138  38%  842 aa  SYL_BORHD RecName: Full=Leucyl-tRNA synthetase;       
   20::760     e-135  40%  806 aa  SYL_TROW8 RecName: Full=Leucyl-tRNA synthetase;       
   20::760     e-135  40%  806 aa  SYL_TROWT RecName: Full=Leucyl-tRNA synthetase;       
    3::796     e-135  39%  842 aa  SYL_BORT9 RecName: Full=Leucyl-tRNA synthetase;       
    8::821     e-131  41%  864 aa  SYL_LEPBL RecName: Full=Leucyl-tRNA synthetase;       
    8::821     e-131  41%  864 aa  SYL_LEPBJ RecName: Full=Leucyl-tRNA synthetase;       
    4::763     e-131  37%  847 aa  SYL_BUCCC RecName: Full=Leucyl-tRNA synthetase;       
    8::755     e-130  40%  799 aa  SYL_MYCPE RecName: Full=Leucyl-tRNA synthetase;       
    7::760     e-130  38%  804 aa  SYL_MYCMS RecName: Full=Leucyl-tRNA synthetase;       
    8::881     e-129  39%  923 aa  SYL_AMOA5 RecName: Full=Leucyl-tRNA synthetase;       
    8::912     e-128  38%  925 aa  SYL_PORG3 RecName: Full=Leucyl-tRNA synthetase;       
    7::760     e-127  38%  804 aa  SYL_MYCCT RecName: Full=Leucyl-tRNA synthetase;       
    8::912     e-126  38%  925 aa  SYL_PORGI RecName: Full=Leucyl-tRNA synthetase;       
   37::757     e-125  41%  801 aa  SYL_MESFL RecName: Full=Leucyl-tRNA synthetase;       
    8::901     e-125  38%  943 aa  SYL_BACFR RecName: Full=Leucyl-tRNA synthetase;       
    8::901     e-125  38%  943 aa  SYL_BACFN RecName: Full=Leucyl-tRNA synthetase;       
   20::914     e-125  40%  954 aa  SYL_SALTO RecName: Full=Leucyl-tRNA synthetase;       
   16::912     e-124  40%  952 aa  SYL_SALAI RecName: Full=Leucyl-tRNA synthetase;       
   26::938     e-123  39%  950 aa  SYL_MYCSS RecName: Full=Leucyl-tRNA synthetase;       
   26::938     e-123  39%  950 aa  SYL_MYCSK RecName: Full=Leucyl-tRNA synthetase;       
   26::938     e-123  39%  950 aa  SYL_MYCSJ RecName: Full=Leucyl-tRNA synthetase;       
    2::763     e-123  38%  806 aa  SYL_UREU1 RecName: Full=Leucyl-tRNA synthetase;       
    2::758     e-123  39%  807 aa  SYL_MYCPU RecName: Full=Leucyl-tRNA synthetase;       
    2::875     e-122  38%  918 aa  SYL_AZOPC RecName: Full=Leucyl-tRNA synthetase;       
    8::903     e-122  37%  946 aa  SYL_PARD8 RecName: Full=Leucyl-tRNA synthetase;       
   24::941     e-120  40%  953 aa  SYL_MYCS2 RecName: Full=Leucyl-tRNA synthetase;       
    8::896     e-120  38%  944 aa  SYL_BACV8 RecName: Full=Leucyl-tRNA synthetase;       
    8::896     e-120  38%  944 aa  SYL_BACTN RecName: Full=Leucyl-tRNA synthetase;       
   21::937     e-120  42%  949 aa  SYL_MYCGI RecName: Full=Leucyl-tRNA synthetase;       
    2::920     e-120  38%  962 aa  SYL_FLAPJ RecName: Full=Leucyl-tRNA synthetase;       
   19::908     e-119  39%  952 aa  SYL_CORGB RecName: Full=Leucyl-tRNA synthetase;       
   19::908     e-119  39%  952 aa  SYL_CORGL RecName: Full=Leucyl-tRNA synthetase;       
    2::763     e-118  38%  806 aa  SYL_UREPA RecName: Full=Leucyl-tRNA synthetase;       
    2::763     e-118  38%  806 aa  SYL_UREP2 RecName: Full=Leucyl-tRNA synthetase;       
   42::913     e-118  38%  955 aa  SYL_SACEN RecName: Full=Leucyl-tRNA synthetase;       
   31::957     e-118  37%  969 aa  SYL_MYCA1 RecName: Full=Leucyl-tRNA synthetase;       
   23::913     e-118  39%  957 aa  SYL_COREF RecName: Full=Leucyl-tRNA synthetase;       
   31::957     e-118  37%  969 aa  SYL_MYCPA RecName: Full=Leucyl-tRNA synthetase;       
    9::879     e-117  39%  921 aa  SYL_CYTH3 RecName: Full=Leucyl-tRNA synthetase;       
   17::932     e-117  39%  976 aa  SYL_CORJK RecName: Full=Leucyl-tRNA synthetase;       
   25::745     e-117  40%  793 aa  SYL_MYCPN RecName: Full=Leucyl-tRNA synthetase;       
   53::945     e-116  39%  987 aa  SYL_BIFLD RecName: Full=Leucyl-tRNA synthetase;       
   26::918     e-116  38%  962 aa  SYL_STRAW RecName: Full=Leucyl-tRNA synthetase;       
   53::945     e-116  39%  987 aa  SYL_BIFLO RecName: Full=Leucyl-tRNA synthetase;       
   24::913     e-116  38%  957 aa  SYL_STRGG RecName: Full=Leucyl-tRNA synthetase;       
   31::957     e-116  36%  969 aa  SYL_MYCTU RecName: Full=Leucyl-tRNA synthetase;       
   31::957     e-116  36%  969 aa  SYL_MYCTA RecName: Full=Leucyl-tRNA synthetase;       
   31::957     e-116  36%  969 aa  SYL_MYCBT RecName: Full=Leucyl-tRNA synthetase;       
   31::957     e-116  36%  969 aa  SYL_MYCBP RecName: Full=Leucyl-tRNA synthetase;       
   31::957     e-116  36%  969 aa  SYL_MYCBO RecName: Full=Leucyl-tRNA synthetase;       
   39::964     e-115  38%  976 aa  SYL_MYCUA RecName: Full=Leucyl-tRNA synthetase;       
   25::922     e-115  37%  966 aa  SYL_STRCO RecName: Full=Leucyl-tRNA synthetase;       
   58::947     e-115  40%  990 aa  SYL_BIFAA RecName: Full=Leucyl-tRNA synthetase;       
   39::964     e-115  38%  976 aa  SYL_MYCMM RecName: Full=Leucyl-tRNA synthetase;       
   27::756     e-115  39%  805 aa  SYL_MYCGA RecName: Full=Leucyl-tRNA synthetase;       
   16::906     e-115  39%  949 aa  SYL_CORA7 RecName: Full=Leucyl-tRNA synthetase;       
   25::917     e-115  37%  960 aa  SYL_CORDI RecName: Full=Leucyl-tRNA synthetase;       
   28::956     e-114  38%  968 aa  SYL_MYCVP RecName: Full=Leucyl-tRNA synthetase;       
    2::912     e-114  38%  954 aa  SYL_FLAJ1 RecName: Full=Leucyl-tRNA synthetase;       
   20::938     e-112  38%  950 aa  SYL_NOCFA RecName: Full=Leucyl-tRNA synthetase;       
   31::960     e-112  36%  972 aa  SYL_MYCLE RecName: Full=Leucyl-tRNA synthetase;       
   31::960     e-112  36%  972 aa  SYL_MYCLB RecName: Full=Leucyl-tRNA synthetase;       
    2::745     e-110  38%  792 aa  SYL_MYCGE RecName: Full=Leucyl-tRNA synthetase;       
   23::902     e-107  37%  945 aa  SYL_RHOSR RecName: Full=Leucyl-tRNA synthetase;       
    8::914     e-105  37%  962 aa  SYL_GRAFK RecName: Full=Leucyl-tRNA synthetase;       
   56::205     5e-84  39% 1064 aa  SYL_FRASC RecName: Full=Leucyl-tRNA synthetase;       
   57::407     4e-64  38% 1069 aa  SYL_FRAAA RecName: Full=Leucyl-tRNA synthetase;       
   15::724     4e-38  31%  911 aa  SYV_SYMTH RecName: Full=Valyl-tRNA synthetase;       
   40::246     2e-37  41%  289 aa  SYLB_AQUAE RecName: Full=Leucyl-tRNA synthetase subunit beta;      
   35::730     4e-34  32%  831 aa  SYV_SULAC RecName: Full=Valyl-tRNA synthetase;       
   18::603     4e-33  35%  809 aa  SYV_SULTO RecName: Full=Valyl-tRNA synthetase;       
    3::588     3e-32  33%  876 aa  SYV_BACFR RecName: Full=Valyl-tRNA synthetase;       
    3::588     3e-32  33%  876 aa  SYV_BACFN RecName: Full=Valyl-tRNA synthetase;       
    3::590     2e-31  33%  879 aa  SYV_BACTN RecName: Full=Valyl-tRNA synthetase;       
   10::750     5e-31  30%  939 aa  SYV_CHLTR RecName: Full=Valyl-tRNA synthetase;       
   10::750     5e-31  30%  939 aa  SYV_CHLTA RecName: Full=Valyl-tRNA synthetase;       
   10::750     6e-31  30%  939 aa  SYV_CHLTB RecName: Full=Valyl-tRNA synthetase;       
   10::750     6e-31  30%  939 aa  SYV_CHLT2 RecName: Full=Valyl-tRNA synthetase;       
   31::797     2e-29  29%  932 aa  SYI_THETN RecName: Full=Isoleucyl-tRNA synthetase;       
    7::647     3e-29  30% 1044 aa  SYI_METTH RecName: Full=Isoleucyl-tRNA synthetase;       
   10::620     8e-29  31%  940 aa  SYV_CHLAB RecName: Full=Valyl-tRNA synthetase;       
   10::620     6e-28  30%  940 aa  SYV_CHLCV RecName: Full=Valyl-tRNA synthetase;       
   31::615     4e-27  32%  908 aa  SYI_THEM4 RecName: Full=Isoleucyl-tRNA synthetase;       
    4::584     1e-26  36%  881 aa  SYV_HALSA RecName: Full=Valyl-tRNA synthetase;       
    4::584     1e-26  36%  881 aa  SYV_HALS3 RecName: Full=Valyl-tRNA synthetase;       
    9::744     2e-26  33%  878 aa  SYV_CARHZ RecName: Full=Valyl-tRNA synthetase;       
    6::739     3e-26  30%  873 aa  SYV_PARD8 RecName: Full=Valyl-tRNA synthetase;       
   34::821     4e-26  33%  945 aa  SYL_PYRAE RecName: Full=Leucyl-tRNA synthetase;       
    8::810     4e-26  35%  967 aa  SYL_PYRAB RecName: Full=Leucyl-tRNA synthetase;       
   19::734     5e-26  34%  877 aa  SYV_METTH RecName: Full=Valyl-tRNA synthetase;       
   11::583     6e-26  40%  886 aa  SYV_METMP RecName: Full=Valyl-tRNA synthetase;       
    4::800     6e-26  29% 1059 aa  SYI_HALWD RecName: Full=Isoleucyl-tRNA synthetase;       
    8::810     8e-26  35%  967 aa  SYL_PYRFU RecName: Full=Leucyl-tRNA synthetase;       
    1::788     1e-25  29%  966 aa  SYL_METMA RecName: Full=Leucyl-tRNA synthetase;       
    8::608     1e-25  39%  914 aa  SYV_METKA RecName: Full=Valyl-tRNA synthetase;       
    1::788     1e-25  29%  966 aa  SYL_METBF RecName: Full=Leucyl-tRNA synthetase;       
    7::307     2e-25  37%  954 aa  SYV_HAEIG RecName: Full=Valyl-tRNA synthetase;       
    1::829     3e-25  28%  961 aa  SYL_METAC RecName: Full=Leucyl-tRNA synthetase;       
   29::788     3e-25  29%  919 aa  SYI_PETMO RecName: Full=Isoleucyl-tRNA synthetase;       
    7::307     4e-25  37%  954 aa  SYV_HAEI8 RecName: Full=Valyl-tRNA synthetase;       
   47::713     7e-25  36%  878 aa  SYV_METJA RecName: Full=Valyl-tRNA synthetase;       
    7::647     7e-25  30% 1045 aa  SYI_METTM RecName: Full=Isoleucyl-tRNA synthetase;       
    8::810     9e-25  34%  967 aa  SYL_PYRHO RecName: Full=Leucyl-tRNA synthetase;       
    7::307     1e-24  37%  954 aa  SYV_HAEIN RecName: Full=Valyl-tRNA synthetase;       
    8::678     1e-24  32%  994 aa  SYV_XYLFT RecName: Full=Valyl-tRNA synthetase;       
    8::678     1e-24  32%  994 aa  SYV_XYLF2 RecName: Full=Valyl-tRNA synthetase;       
    7::317     1e-24  37%  954 aa  SYV_HAEIE RecName: Full=Valyl-tRNA synthetase;       
   32::686     1e-24  35%  863 aa  SYV_ARCFU RecName: Full=Valyl-tRNA synthetase;       
   24::620     3e-24  31%  918 aa  SYI_THENN RecName: Full=Isoleucyl-tRNA synthetase;       
    3::590     3e-24  35%  875 aa  SYV_BACV8 RecName: Full=Valyl-tRNA synthetase;       
   35::628     6e-24  30%  938 aa  SYI_SYMTH RecName: Full=Isoleucyl-tRNA synthetase;       
    1::617     7e-24  34%  921 aa  SYV_METCA RecName: Full=Valyl-tRNA synthetase;       
    1::818     7e-24  30%  962 aa  SYL_METBU RecName: Full=Leucyl-tRNA synthetase;       
    8::675     1e-23  31%  991 aa  SYV_XYLFM RecName: Full=Valyl-tRNA synthetase;       
    7::317     1e-23  36%  954 aa  SYV_HAES2 RecName: Full=Valyl-tRNA synthetase;       
    7::316     1e-23  35%  961 aa  SYV_HAEDU RecName: Full=Valyl-tRNA synthetase;       
    1::651     1e-23  27% 1047 aa  SYI_SULTO RecName: Full=Isoleucyl-tRNA synthetase;       
    8::678     1e-23  31%  994 aa  SYV_XYLFA RecName: Full=Valyl-tRNA synthetase;       
    7::317     1e-23  35%  954 aa  SYV_PASMU RecName: Full=Valyl-tRNA synthetase;       
   24::814     2e-23  29%  921 aa  SYI_BACC4 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::620     2e-23  32%  921 aa  SYI_BACC2 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::814     2e-23  29%  921 aa  SYI1_BACCR RecName: Full=Isoleucyl-tRNA synthetase 1;       
   24::814     2e-23  29%  921 aa  SYI_BACC3 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::814     2e-23  29%  921 aa  SYI1_BACHK RecName: Full=Isoleucyl-tRNA synthetase 1;       
   24::814     3e-23  29%  921 aa  SYI_BACCQ RecName: Full=Isoleucyl-tRNA synthetase;       
   24::814     3e-23  29%  921 aa  SYI_BACC7 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::814     3e-23  29%  921 aa  SYI_BACC0 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::814     3e-23  29%  921 aa  SYI1_BACCZ RecName: Full=Isoleucyl-tRNA synthetase 1;       
   24::814     3e-23  29%  921 aa  SYI1_BACC1 RecName: Full=Isoleucyl-tRNA synthetase 1;       
  148::478     4e-23  32% 1104 aa  SYV_YEAST RecName: Full=Valyl-tRNA synthetase, mitochondrial;      
   31::703     4e-23  34%  855 aa  SYV_METTP RecName: Full=Valyl-tRNA synthetase;       
   30::627     4e-23  32%  925 aa  SYI_CARHZ RecName: Full=Isoleucyl-tRNA synthetase;       
   24::620     4e-23  32%  921 aa  SYI_BACCN RecName: Full=Isoleucyl-tRNA synthetase;       
   27::623     5e-23  30% 1028 aa  SYI_THEVO RecName: Full=Isoleucyl-tRNA synthetase;       
   24::712     5e-23  31%  931 aa  SYI_DESRM RecName: Full=Isoleucyl-tRNA synthetase;       
   57::781     6e-23  29%  913 aa  SYI_FERNB RecName: Full=Isoleucyl-tRNA synthetase;       
   24::620     6e-23  32%  921 aa  SYI_BACWK RecName: Full=Isoleucyl-tRNA synthetase;       
   33::810     1e-22  31%  950 aa  SYL2_METS5 RecName: Full=Leucyl-tRNA synthetase 2;       
    9::662     1e-22  28% 1070 aa  SYI_HALSA RecName: Full=Isoleucyl-tRNA synthetase;       
   24::814     1e-22  29%  921 aa  SYI_BACAC RecName: Full=Isoleucyl-tRNA synthetase;       
   24::814     1e-22  29%  921 aa  SYI_BACAA RecName: Full=Isoleucyl-tRNA synthetase;       
   24::814     1e-22  29%  921 aa  SYI1_BACAN RecName: Full=Isoleucyl-tRNA synthetase 1;       
    1::813     2e-22  31%  958 aa  SYV_SHEON RecName: Full=Valyl-tRNA synthetase;       
    7::795     2e-22  31%  954 aa  SYV_ACTPJ RecName: Full=Valyl-tRNA synthetase;       
    7::795     2e-22  31%  954 aa  SYV_ACTP7 RecName: Full=Valyl-tRNA synthetase;       
    7::795     2e-22  31%  954 aa  SYV_ACTP2 RecName: Full=Valyl-tRNA synthetase;       
    1::305     3e-22  34%  951 aa  SYV_SALTY RecName: Full=Valyl-tRNA synthetase;       
    1::305     3e-22  34%  951 aa  SYV_SALCH RecName: Full=Valyl-tRNA synthetase;       
   22::728     3e-22  32%  893 aa  SYV_NOCFA RecName: Full=Valyl-tRNA synthetase;       
    8::810     3e-22  33%  967 aa  SYL_PYRKO RecName: Full=Leucyl-tRNA synthetase;       
    3::724     4e-22  33%  876 aa  SYV_STAHJ RecName: Full=Valyl-tRNA synthetase;       
   29::797     4e-22  29%  932 aa  SYI_THEPX RecName: Full=Isoleucyl-tRNA synthetase;       
   29::797     4e-22  29%  932 aa  SYI_THEP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   36::384     4e-22  33%  969 aa  SYI_PROMA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::334     7e-22  33%  980 aa  SYV_XANC5 RecName: Full=Valyl-tRNA synthetase;       
   97::403     7e-22  33%  980 aa  SYV_SCHPO RecName: Full=Valyl-tRNA synthetase;       
   47::295     7e-22  35%  869 aa  SYV_METAC RecName: Full=Valyl-tRNA synthetase;       
    2::186     9e-22  35%  855 aa  SYV_WOLTR RecName: Full=Valyl-tRNA synthetase;       
    4::728     9e-22  31%  865 aa  SYV_THEMA RecName: Full=Valyl-tRNA synthetase;       
    1::798     9e-22  30%  951 aa  SYV_SHISS RecName: Full=Valyl-tRNA synthetase;       
    1::798     9e-22  30%  951 aa  SYV_SHIFL RecName: Full=Valyl-tRNA synthetase;       
    1::798     9e-22  30%  951 aa  SYV_SHIBS RecName: Full=Valyl-tRNA synthetase;       
   47::295     9e-22  35%  869 aa  SYV_METBF RecName: Full=Valyl-tRNA synthetase;       
    1::798     9e-22  30%  951 aa  SYV_ECOLI RecName: Full=Valyl-tRNA synthetase;       
    1::798     9e-22  30%  951 aa  SYV_ECOL6 RecName: Full=Valyl-tRNA synthetase;       
    1::798     9e-22  30%  951 aa  SYV_ECO57 RecName: Full=Valyl-tRNA synthetase;       
    8::826     9e-22  32%  967 aa  SYL_THEON RecName: Full=Leucyl-tRNA synthetase;       
    1::305     1e-21  33%  951 aa  SYV_SALTI RecName: Full=Valyl-tRNA synthetase;       
    1::305     1e-21  33%  951 aa  SYV_SALPA RecName: Full=Valyl-tRNA synthetase;       
   22::795     2e-21  30%  944 aa  SYL2_SULTO RecName: Full=Leucyl-tRNA synthetase 2;       
   60::363     2e-21  31%  954 aa  SYI_SYNP6 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::734     2e-21  33%  876 aa  SYV_STACT RecName: Full=Valyl-tRNA synthetase;       
   47::577     2e-21  33%  869 aa  SYV_METMA RecName: Full=Valyl-tRNA synthetase;       
    1::647     2e-21  31%  951 aa  SYV_ERWCT RecName: Full=Valyl-tRNA synthetase;       
    2::805     2e-21  30%  950 aa  SYL_METTP RecName: Full=Leucyl-tRNA synthetase;       
   19::333     3e-21  32%  965 aa  SYV_YERPS RecName: Full=Valyl-tRNA synthetase;       
   19::333     3e-21  32%  965 aa  SYV_YERPE RecName: Full=Valyl-tRNA synthetase;       
    3::794     3e-21  31%  937 aa  SYL_METTH RecName: Full=Leucyl-tRNA synthetase;       
    2::768     3e-21  33%  907 aa  SYV_BARHE RecName: Full=Valyl-tRNA synthetase;       
   26::808     3e-21  30%  944 aa  SYL2_SULSO RecName: Full=Leucyl-tRNA synthetase 2;       
  296::619     4e-21  31% 1264 aa  SYVC_RAT RecName: Full=Valyl-tRNA synthetase;       
    4::312     6e-21  32%  980 aa  SYV_XANOM RecName: Full=Valyl-tRNA synthetase;       
    1::335     6e-21  34%  953 aa  SYV_PHOPR RecName: Full=Valyl-tRNA synthetase;       
    7::307     6e-21  36%  954 aa  SYV_MANSM RecName: Full=Valyl-tRNA synthetase;       
    8::747     6e-21  32%  880 aa  SYV_BACHD RecName: Full=Valyl-tRNA synthetase;       
    1::328     8e-21  33%  955 aa  SYV_BUCAI RecName: Full=Valyl-tRNA synthetase;       
    4::312     1e-20  32%  980 aa  SYV_XANOR RecName: Full=Valyl-tRNA synthetase;       
    4::312     1e-20  32%  980 aa  SYV_XANOP RecName: Full=Valyl-tRNA synthetase;       
    4::318     1e-20  33%  944 aa  SYV_XANCP RecName: Full=Valyl-tRNA synthetase;       
    4::318     1e-20  33%  944 aa  SYV_XANCB RecName: Full=Valyl-tRNA synthetase;       
    4::318     1e-20  33%  944 aa  SYV_XANC8 RecName: Full=Valyl-tRNA synthetase;       
    1::294     1e-20  34%  929 aa  SYV_NITOC RecName: Full=Valyl-tRNA synthetase;       
   25::325     1e-20  33%  984 aa  SYV_PSYA2 RecName: Full=Valyl-tRNA synthetase;       
    9::298     1e-20  34%  919 aa  SYV_FRATT RecName: Full=Valyl-tRNA synthetase;       
    2::777     1e-20  32%  907 aa  SYV_BARQU RecName: Full=Valyl-tRNA synthetase;       
  295::618     1e-20  31% 1263 aa  SYVC_MOUSE RecName: Full=Valyl-tRNA synthetase;       
   44::627     2e-20  29%  842 aa  SYV_SULSO RecName: Full=Valyl-tRNA synthetase;       
    2::741     2e-20  31%  957 aa  SYV_RHOPA RecName: Full=Valyl-tRNA synthetase;       
   35::324     2e-20  32%  945 aa  SYL_THENV RecName: Full=Leucyl-tRNA synthetase;       
   25::335     2e-20  36%  942 aa  SYL2_SULAC RecName: Full=Leucyl-tRNA synthetase 2;       
    4::318     2e-20  33%  944 aa  SYV_XANAC RecName: Full=Valyl-tRNA synthetase;       
   39::644     2e-20  32%  942 aa  SYV_STRM5 RecName: Full=Valyl-tRNA synthetase;       
    5::651     2e-20  37%  891 aa  SYV_PYRAB RecName: Full=Valyl-tRNA synthetase;       
   20::347     2e-20  31%  971 aa  SYV_ACIAD RecName: Full=Valyl-tRNA synthetase;       
  245::566     2e-20  30% 1217 aa  SYVC_TAKRU RecName: Full=Valyl-tRNA synthetase;       
   61::849     2e-20  30%  983 aa  SYI_GLOVI RecName: Full=Isoleucyl-tRNA synthetase;       
   39::644     3e-20  32%  942 aa  SYV_STRMK RecName: Full=Valyl-tRNA synthetase;       
    5::601     3e-20  32% 1165 aa  SYV_AQUAE RecName: Full=Valyl-tRNA synthetase;       
    3::738     3e-20  31%  931 aa  SYV_ALCBS RecName: Full=Valyl-tRNA synthetase;       
   60::818     3e-20  30%  960 aa  SYI_ANASP RecName: Full=Isoleucyl-tRNA synthetase;       
   10::750     4e-20  31%  880 aa  SYV_ENTFA RecName: Full=Valyl-tRNA synthetase;       
   31::628     4e-20  29%  923 aa  SYI_GEOSL RecName: Full=Isoleucyl-tRNA synthetase;       
    1::798     5e-20  29%  951 aa  SYV_SHIDS RecName: Full=Valyl-tRNA synthetase;       
    2::627     5e-20  32%  952 aa  SYV_NITWN RecName: Full=Valyl-tRNA synthetase;       
    6::728     5e-20  34%  867 aa  SYV_FERNB RecName: Full=Valyl-tRNA synthetase;       
   11::343     5e-20  36%  946 aa  SYL_PYRCJ RecName: Full=Leucyl-tRNA synthetase;       
    2::186     6e-20  34%  864 aa  SYV_WOLPM RecName: Full=Valyl-tRNA synthetase;       
   46::345     6e-20  30%  859 aa  SYV_RICFE RecName: Full=Valyl-tRNA synthetase;       
   35::193     6e-20  30%  881 aa  SYV_CLOAB RecName: Full=Valyl-tRNA synthetase;       
    7::775     6e-20  32%  932 aa  SYL_ARCFU RecName: Full=Leucyl-tRNA synthetase;       
   19::198     6e-20  32% 1080 aa  SYI_METKA RecName: Full=Isoleucyl-tRNA synthetase;       
    6::728     8e-20  34%  891 aa  SYV_PYRHO RecName: Full=Valyl-tRNA synthetase;       
  296::619     8e-20  31% 1264 aa  SYVC_HUMAN RecName: Full=Valyl-tRNA synthetase;       
    1::789     1e-19  29%  953 aa  SYV_VIBCH RecName: Full=Valyl-tRNA synthetase;       
   14::190     1e-19  34%  813 aa  SYV_RICCK RecName: Full=Valyl-tRNA synthetase;       
    1::781     1e-19  31%  947 aa  SYV_RHIME RecName: Full=Valyl-tRNA synthetase;       
   34::822     1e-19  32%  945 aa  SYL_PYRIL RecName: Full=Leucyl-tRNA synthetase;       
   35::343     1e-19  32%  945 aa  SYL_PYRAR RecName: Full=Leucyl-tRNA synthetase;       
   57::791     1e-19  30%  912 aa  SYI_FERPE RecName: Full=Isoleucyl-tRNA synthetase;       
   14::184     2e-19  39%  968 aa  SYV_RALSO RecName: Full=Valyl-tRNA synthetase;       
   27::391     2e-19  35%  812 aa  SYV_RICCN RecName: Full=Valyl-tRNA synthetase;       
    6::728     2e-19  35%  891 aa  SYV_PYRFU RecName: Full=Valyl-tRNA synthetase;       
    1::221     3e-19  37%  921 aa  SYV_LEGPL RecName: Full=Valyl-tRNA synthetase;       
    1::221     3e-19  37%  921 aa  SYV_LEGPH RecName: Full=Valyl-tRNA synthetase;       
    1::221     3e-19  37%  921 aa  SYV_LEGPA RecName: Full=Valyl-tRNA synthetase;       
    3::736     4e-19  33%  876 aa  SYV_STAES RecName: Full=Valyl-tRNA synthetase;       
    3::736     4e-19  33%  876 aa  SYV_STAEQ RecName: Full=Valyl-tRNA synthetase;       
   46::726     4e-19  31%  812 aa  SYV_RICB8 RecName: Full=Valyl-tRNA synthetase;       
   46::726     5e-19  31%  812 aa  SYV_RICBR RecName: Full=Valyl-tRNA synthetase;       
   27::391     5e-19  35%  812 aa  SYV_RICAE RecName: Full=Valyl-tRNA synthetase;       
    6::460     5e-19  32%  872 aa  SYV_NATPD RecName: Full=Valyl-tRNA synthetase;       
    9::719     5e-19  32%  889 aa  SYV_LACPL RecName: Full=Valyl-tRNA synthetase;       
   44::757     5e-19  34%  896 aa  SYV_GRABC RecName: Full=Valyl-tRNA synthetase;       
    8::738     5e-19  34%  880 aa  SYV_GEOKA RecName: Full=Valyl-tRNA synthetase;       
    9::297     5e-19  35%  943 aa  SYV_DECAR RecName: Full=Valyl-tRNA synthetase;       
    1::334     7e-19  33%  952 aa  SYV_VIBPA RecName: Full=Valyl-tRNA synthetase;       
   14::190     9e-19  32%  814 aa  SYV_RICTY RecName: Full=Valyl-tRNA synthetase;       
   10::583     9e-19  35%  887 aa  SYV_GEOSL RecName: Full=Valyl-tRNA synthetase;       
   10::619     9e-19  33%  939 aa  SYV_CHLMU RecName: Full=Valyl-tRNA synthetase;       
   83::401     9e-19  28% 1050 aa  SYV_CAEEL RecName: Full=Valyl-tRNA synthetase;       
    8::747     9e-19  33%  880 aa  SYV_BACST RecName: Full=Valyl-tRNA synthetase;       
    3::790     9e-19  30%  943 aa  SYL_METKA RecName: Full=Leucyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAAW RecName: Full=Valyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAAT RecName: Full=Valyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAAS RecName: Full=Valyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAAN RecName: Full=Valyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAAM RecName: Full=Valyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAAE RecName: Full=Valyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAAC RecName: Full=Valyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAA9 RecName: Full=Valyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAA8 RecName: Full=Valyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAA3 RecName: Full=Valyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAA2 RecName: Full=Valyl-tRNA synthetase;       
    3::726     1e-18  32%  876 aa  SYV_STAA1 RecName: Full=Valyl-tRNA synthetase;       
    6::323     1e-18  34%  959 aa  SYL_AERPE RecName: Full=Leucyl-tRNA synthetase;       
    1::792     2e-18  28%  957 aa  SYV_VIBF1 RecName: Full=Valyl-tRNA synthetase;       
   27::391     2e-18  34%  812 aa  SYV_RICRS RecName: Full=Valyl-tRNA synthetase;       
   27::391     2e-18  34%  812 aa  SYV_RICRO RecName: Full=Valyl-tRNA synthetase;       
   46::190     2e-18  37%  812 aa  SYV_RICAH RecName: Full=Valyl-tRNA synthetase;       
    3::830     2e-18  31%  987 aa  SYV_RHOSK RecName: Full=Valyl-tRNA synthetase;       
    3::830     2e-18  31%  987 aa  SYV_RHOS4 RecName: Full=Valyl-tRNA synthetase;       
   23::764     2e-18  33%  899 aa  SYV_PELCD RecName: Full=Valyl-tRNA synthetase;       
    8::747     2e-18  33%  880 aa  SYV_BACSU RecName: Full=Valyl-tRNA synthetase;       
   44::300     2e-18  33%  875 aa  SYV_ANOFW RecName: Full=Valyl-tRNA synthetase;       
   32::313     2e-18  32%  938 aa  SYL1_METS5 RecName: Full=Leucyl-tRNA synthetase 1;       
   60::369     2e-18  29%  959 aa  SYI_CYAP8 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::726     2e-18  32%  876 aa  SYV_STAAB RecName: Full=Valyl-tRNA synthetase;       
    6::728     2e-18  34%  888 aa  SYV_PYRKO RecName: Full=Valyl-tRNA synthetase;       
   10::196     2e-18  31% 1066 aa  SYI_PYRHO RecName: Full=Isoleucyl-tRNA synthetase;       
   60::369     2e-18  28%  959 aa  SYI_CYAA5 RecName: Full=Isoleucyl-tRNA synthetase;       
    5::576     4e-18  36%  883 aa  SYV_STRT2 RecName: Full=Valyl-tRNA synthetase;       
    5::576     4e-18  36%  883 aa  SYV_STRT1 RecName: Full=Valyl-tRNA synthetase;       
    3::726     4e-18  32%  876 aa  SYV_STAS1 RecName: Full=Valyl-tRNA synthetase;       
   27::391     4e-18  34%  812 aa  SYV_RICPU RecName: Full=Valyl-tRNA synthetase;       
   14::190     4e-18  32%  814 aa  SYV_RICPR RecName: Full=Valyl-tRNA synthetase;       
    1::646     4e-18  31%  949 aa  SYV_IDILO RecName: Full=Valyl-tRNA synthetase;       
   28::369     4e-18  30%  988 aa  SYI_SYNY3 RecName: Full=Isoleucyl-tRNA synthetase;       
   60::371     4e-18  32%  959 aa  SYI_NOSP7 RecName: Full=Isoleucyl-tRNA synthetase;       
   48::851     4e-18  28% 1014 aa  SYI_DEHE1 RecName: Full=Isoleucyl-tRNA synthetase;       
    5::576     5e-18  35%  883 aa  SYV_STRR6 RecName: Full=Valyl-tRNA synthetase;       
    3::830     5e-18  31%  987 aa  SYV_RHOS1 RecName: Full=Valyl-tRNA synthetase;       
   17::595     5e-18  32%  882 aa  SYV_MYCPA RecName: Full=Valyl-tRNA synthetase;       
   41::824     5e-18  26%  955 aa  SYL_METM5 RecName: Full=Leucyl-tRNA synthetase;       
   57::790     5e-18  29%  928 aa  SYI_LACJO RecName: Full=Isoleucyl-tRNA synthetase;       
   24::785     5e-18  27%  921 aa  SYI_BACHD RecName: Full=Isoleucyl-tRNA synthetase;       
    5::717     6e-18  31%  883 aa  SYV_STRPN RecName: Full=Valyl-tRNA synthetase;       
    4::575     6e-18  36%  882 aa  SYV_STRPM RecName: Full=Valyl-tRNA synthetase;       
    4::575     6e-18  36%  882 aa  SYV_STRP8 RecName: Full=Valyl-tRNA synthetase;       
    4::575     6e-18  36%  882 aa  SYV_STRP1 RecName: Full=Valyl-tRNA synthetase;       
   43::619     6e-18  31% 1064 aa  SYVM_DICDI RecName: Full=Probable valyl-tRNA synthetase,
   41::824     6e-18  27%  955 aa  SYL_METM7 RecName: Full=Leucyl-tRNA synthetase;       
    8::603     8e-18  34%  910 aa  SYV_SYNY3 RecName: Full=Valyl-tRNA synthetase;       
    4::716     8e-18  31%  882 aa  SYV_STRP6 RecName: Full=Valyl-tRNA synthetase;       
    4::716     8e-18  30%  882 aa  SYV_STRP3 RecName: Full=Valyl-tRNA synthetase;       
   13::305     8e-18  34%  917 aa  SYV_NITEC RecName: Full=Valyl-tRNA synthetase;       
   24::777     8e-18  30%  924 aa  SYI_GEOKA RecName: Full=Isoleucyl-tRNA synthetase;       
    5::576     1e-17  35%  883 aa  SYV_STRMU RecName: Full=Valyl-tRNA synthetase;       
    3::314     1e-17  31%  926 aa  SYV_NITMU RecName: Full=Valyl-tRNA synthetase;       
    2::740     1e-17  29%  906 aa  SYV_CAUCR RecName: Full=Valyl-tRNA synthetase;       
   15::779     1e-17  29%  945 aa  SYL1_SULTO RecName: Full=Leucyl-tRNA synthetase 1;       
    4::316     1e-17  31%  942 aa  SYL1_SULAC RecName: Full=Leucyl-tRNA synthetase 1;       
   24::620     1e-17  30%  923 aa  SYI_GEOSW RecName: Full=Isoleucyl-tRNA synthetase;       
   60::369     1e-17  31%  959 aa  SYI_CYAP7 RecName: Full=Isoleucyl-tRNA synthetase;       
    1::301     1e-17  32%  951 aa  SYV_VIBVY RecName: Full=Valyl-tRNA synthetase;       
    1::301     1e-17  32%  951 aa  SYV_VIBVU RecName: Full=Valyl-tRNA synthetase;       
  140::452     1e-17  32% 1093 aa  SYV_NEUCR RecName: Full=Valyl-tRNA synthetase, mitochondrial;      
    7::714     1e-17  32%  882 aa  SYV_LACSS RecName: Full=Valyl-tRNA synthetase;       
    2::814     1e-17  29%  947 aa  SYV_AGRT5 RecName: Full=Valyl-tRNA synthetase;       
   41::824     1e-17  26%  955 aa  SYL_METMP RecName: Full=Leucyl-tRNA synthetase;       
   68::382     1e-17  28%  965 aa  SYI_PROM2 RecName: Full=Isoleucyl-tRNA synthetase;       
   31::354     1e-17  32%  930 aa  SYI_MOOTA RecName: Full=Isoleucyl-tRNA synthetase;       
    8::194     1e-17  33% 1049 aa  SYI_METTP RecName: Full=Isoleucyl-tRNA synthetase;       
   24::351     1e-17  30%  924 aa  SYI_GEOTN RecName: Full=Isoleucyl-tRNA synthetase;       
   24::621     1e-17  32%  921 aa  SYI_BACSU RecName: Full=Isoleucyl-tRNA synthetase;       
    7::187     2e-17  37%  810 aa  SYV_EHRRW RecName: Full=Valyl-tRNA synthetase;       
    9::189     2e-17  37%  812 aa  SYV_EHRRG RecName: Full=Valyl-tRNA synthetase;       
   10::307     2e-17  29%  966 aa  SYV_BLOFL RecName: Full=Valyl-tRNA synthetase;       
   13::647     2e-17  33% 1076 aa  SYI_METB6 RecName: Full=Isoleucyl-tRNA synthetase;       
   60::807     2e-17  29%  955 aa  SYI_CYAP4 RecName: Full=Isoleucyl-tRNA synthetase;       
   34::299     2e-17  32%  879 aa  SYV_THETN RecName: Full=Valyl-tRNA synthetase;       
    7::766     2e-17  32%  913 aa  SYV_THEEB RecName: Full=Valyl-tRNA synthetase;       
    5::576     2e-17  35%  883 aa  SYV_STRA5 RecName: Full=Valyl-tRNA synthetase;       
    5::576     2e-17  35%  884 aa  SYV_STRA3 RecName: Full=Valyl-tRNA synthetase;       
    1::644     2e-17  32%  948 aa  SYV_PSEU2 RecName: Full=Valyl-tRNA synthetase;       
    1::644     2e-17  31%  948 aa  SYV_PSEF5 RecName: Full=Valyl-tRNA synthetase;       
   19::812     2e-17  30%  965 aa  SYV_PHOLL RecName: Full=Valyl-tRNA synthetase;       
    7::579     2e-17  33%  802 aa  SYV_EHRCJ RecName: Full=Valyl-tRNA synthetase;       
  107::415     2e-17  30% 1072 aa  SYVC_DICDI RecName: Full=Probable valyl-tRNA synthetase,
   24::199     2e-17  31%  919 aa  SYI_THEP1 RecName: Full=Isoleucyl-tRNA synthetase;       
   68::383     2e-17  27%  967 aa  SYI_PROM1 RecName: Full=Isoleucyl-tRNA synthetase;       
    7::652     2e-17  35% 1058 aa  SYI_METBU RecName: Full=Isoleucyl-tRNA synthetase;       
   10::599     3e-17  33%  909 aa  SYV_TREDE RecName: Full=Valyl-tRNA synthetase;       
   17::620     3e-17  34%  933 aa  SYV_PROMA RecName: Full=Valyl-tRNA synthetase;       
   11::719     3e-17  31%  883 aa  SYV_OCEIH RecName: Full=Valyl-tRNA synthetase;       
   10::252     3e-17  32%  957 aa  SYV_BLOPB RecName: Full=Valyl-tRNA synthetase;       
   38::798     3e-17  26%  952 aa  SYL_METVS RecName: Full=Leucyl-tRNA synthetase;       
   68::661     3e-17  33%  968 aa  SYI_SYNS3 RecName: Full=Isoleucyl-tRNA synthetase;       
   69::828     3e-17  29%  974 aa  SYI_SYNPX RecName: Full=Isoleucyl-tRNA synthetase;       
   68::383     3e-17  28%  967 aa  SYI_PROMT RecName: Full=Isoleucyl-tRNA synthetase;       
   11::664     3e-17  33% 1064 aa  SYI_AERPE RecName: Full=Isoleucyl-tRNA synthetase;       
    3::608     4e-17  33%  931 aa  SYV_SPHAL RecName: Full=Valyl-tRNA synthetase;       
    1::815     4e-17  30%  950 aa  SYV_PSEAE RecName: Full=Valyl-tRNA synthetase;       
   12::741     4e-17  32%  883 aa  SYV_LACCA RecName: Full=Valyl-tRNA synthetase;       
    3::726     5e-17  32%  876 aa  SYV_STAAR RecName: Full=Valyl-tRNA synthetase;       
    6::296     5e-17  29%  874 aa  SYV_PETMO RecName: Full=Valyl-tRNA synthetase;       
    1::321     5e-17  34%  882 aa  SYV_ONYPE RecName: Full=Valyl-tRNA synthetase;       
    8::588     5e-17  34%  880 aa  SYV_LACLA RecName: Full=Valyl-tRNA synthetase;       
   40::767     5e-17  31%  932 aa  SYV_CORJK RecName: Full=Valyl-tRNA synthetase;       
   12::573     5e-17  36%  823 aa  SYV_ANAMM RecName: Full=Valyl-tRNA synthetase;       
   13::830     5e-17  26%  969 aa  SYL_META3 RecName: Full=Leucyl-tRNA synthetase;       
   10::196     5e-17  33% 1066 aa  SYI_PYRFU RecName: Full=Isoleucyl-tRNA synthetase;       
    8::747     7e-17  31%  880 aa  SYV_BACLD RecName: Full=Valyl-tRNA synthetase;       
    2::748     9e-17  34%  888 aa  SYV_GLUOX RecName: Full=Valyl-tRNA synthetase;       
   16::583     9e-17  31%  887 aa  SYV_DESPS RecName: Full=Valyl-tRNA synthetase;       
    1::296     9e-17  33%  920 aa  SYV_COXBU RecName: Full=Valyl-tRNA synthetase;       
    8::194     9e-17  34% 1058 aa  SYI_METBF RecName: Full=Isoleucyl-tRNA synthetase;       
   47::647     9e-17  27% 1033 aa  SYI2_BACC1 RecName: Full=Isoleucyl-tRNA synthetase 2;       
    5::576     1e-16  35%  884 aa  SYV_STRA1 RecName: Full=Valyl-tRNA synthetase;       
   45::777     1e-16  33%  910 aa  SYV_BRUSU RecName: Full=Valyl-tRNA synthetase;       
    3::159     1e-16  33%  977 aa  SYL_NANEQ RecName: Full=Leucyl-tRNA synthetase;       
    6::194     1e-16  34% 1104 aa  SYI_UNCMA RecName: Full=Isoleucyl-tRNA synthetase;       
   68::382     1e-16  29%  968 aa  SYI_PROMS RecName: Full=Isoleucyl-tRNA synthetase;       
    7::661     1e-16  32% 1074 aa  SYI_HALMA RecName: Full=Isoleucyl-tRNA synthetase;       
   48::379     1e-16  30% 1014 aa  SYI_DEHSC RecName: Full=Isoleucyl-tRNA synthetase;       
   24::348     1e-16  32%  896 aa  SYI_ACHLI RecName: Full=Isoleucyl-tRNA synthetase;       
  104::420     1e-16  30% 1012 aa  SYIM_MOUSE RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
    5::292     1e-16  33%  873 aa  SYV_MESFL RecName: Full=Valyl-tRNA synthetase;       
   25::299     1e-16  34%  880 aa  SYV_DEHE1 RecName: Full=Valyl-tRNA synthetase;       
   10::335     1e-16  29%  942 aa  SYL_METJA RecName: Full=Leucyl-tRNA synthetase;       
   57::374     1e-16  27%  918 aa  SYI_SULNB RecName: Full=Isoleucyl-tRNA synthetase;       
   49::243     2e-16  35%  955 aa  SYV_RALEJ RecName: Full=Valyl-tRNA synthetase;       
   47::218     2e-16  40%  862 aa  SYV_LEIXX RecName: Full=Valyl-tRNA synthetase;       
   45::777     2e-16  33%  910 aa  SYV_BRUME RecName: Full=Valyl-tRNA synthetase;       
   47::222     3e-16  37%  856 aa  SYV_TROWT RecName: Full=Valyl-tRNA synthetase;       
   47::222     3e-16  37%  856 aa  SYV_TROW8 RecName: Full=Valyl-tRNA synthetase;       
    8::750     3e-16  33%  914 aa  SYV_SYNPX RecName: Full=Valyl-tRNA synthetase;       
    7::577     3e-16  35%  879 aa  SYV_LACJO RecName: Full=Valyl-tRNA synthetase;       
   43::717     3e-16  29%  876 aa  SYV_GRAFK RecName: Full=Valyl-tRNA synthetase;       
   26::737     3e-16  34%  903 aa  SYV_CORGL RecName: Full=Valyl-tRNA synthetase;       
   34::303     3e-16  32%  880 aa  SYV_CLOPE RecName: Full=Valyl-tRNA synthetase;       
    7::730     3e-16  30%  877 aa  SYV_AMOA5 RecName: Full=Valyl-tRNA synthetase;       
    7::660     3e-16  33% 1061 aa  SYI_NATPD RecName: Full=Isoleucyl-tRNA synthetase;       
    9::298     3e-16  34%  937 aa  SYV_LARHH RecName: Full=Valyl-tRNA synthetase;       
    7::577     3e-16  35%  879 aa  SYV_LACAC RecName: Full=Valyl-tRNA synthetase;       
    3::331     3e-16  30%  644 aa  SYM_CLOAB RecName: Full=Methionyl-tRNA synthetase;       
    8::652     3e-16  31% 1049 aa  SYI_SULIM RecName: Full=Isoleucyl-tRNA synthetase;       
    8::652     3e-16  31% 1049 aa  SYI_SULIA RecName: Full=Isoleucyl-tRNA synthetase;       
    1::299     4e-16  32%  948 aa  SYV_PSEPK RecName: Full=Valyl-tRNA synthetase;       
   43::188     6e-16  35%  862 aa  SYV_THETH RecName: Full=Valyl-tRNA synthetase;       
   43::188     6e-16  35%  862 aa  SYV_THET8 RecName: Full=Valyl-tRNA synthetase;       
    1::315     6e-16  32%  951 aa  SYV_PSEHT RecName: Full=Valyl-tRNA synthetase;       
    6::701     6e-16  30%  876 aa  SYV_PORGI RecName: Full=Valyl-tRNA synthetase;       
    6::720     6e-16  30%  876 aa  SYV_PORG3 RecName: Full=Valyl-tRNA synthetase;       
   46::209     6e-16  34%  854 aa  SYV_ORITB RecName: Full=Valyl-tRNA synthetase;       
    9::190     6e-16  32%  918 aa  SYV_NITEU RecName: Full=Valyl-tRNA synthetase;       
    1::232     6e-16  32%  956 aa  SYV_BUCBP RecName: Full=Valyl-tRNA synthetase;       
   15::194     6e-16  31% 1100 aa  SYI_TREDE RecName: Full=Isoleucyl-tRNA synthetase;       
   68::382     6e-16  28%  968 aa  SYI_PROM9 RecName: Full=Isoleucyl-tRNA synthetase;       
   20::199     6e-16  29%  926 aa  SYI_NATTJ RecName: Full=Isoleucyl-tRNA synthetase;       
    8::811     6e-16  32% 1059 aa  SYI_METMJ RecName: Full=Isoleucyl-tRNA synthetase;       
   43::188     7e-16  35%  862 aa  SYV_THET2 RecName: Full=Valyl-tRNA synthetase;       
    1::327     7e-16  32%  945 aa  SYV_NEIG1 RecName: Full=Valyl-tRNA synthetase;       
   47::620     7e-16  33%  940 aa  SYV_CHLFF RecName: Full=Valyl-tRNA synthetase;       
   20::621     1e-15  32%  933 aa  SYV_PROMT RecName: Full=Valyl-tRNA synthetase;       
   26::737     1e-15  33%  903 aa  SYV_COREF RecName: Full=Valyl-tRNA synthetase;       
    1::327     1e-15  31%  945 aa  SYV_NEIMA RecName: Full=Valyl-tRNA synthetase;       
   18::203     1e-15  32%  973 aa  SYV_COLP3 RecName: Full=Valyl-tRNA synthetase;       
    2::352     1e-15  31%  649 aa  SYM_BACST RecName: Full=Methionyl-tRNA synthetase;       
   90::405     1e-15  29% 1000 aa  SYIM_CHICK RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
    9::199     2e-15  33%  912 aa  SYV_THIDA RecName: Full=Valyl-tRNA synthetase;       
    4::581     2e-15  32%  875 aa  SYV_PELUB RecName: Full=Valyl-tRNA synthetase;       
    1::327     2e-15  31%  945 aa  SYV_NEIMB RecName: Full=Valyl-tRNA synthetase;       
   57::238     2e-15  42%  911 aa  SYV_BIFLO RecName: Full=Valyl-tRNA synthetase;       
   57::238     2e-15  42%  911 aa  SYV_BIFLI RecName: Full=Valyl-tRNA synthetase;       
   57::238     2e-15  42%  911 aa  SYV_BIFLD RecName: Full=Valyl-tRNA synthetase;       
    7::194     2e-15  31%  880 aa  SYV_BACSK RecName: Full=Valyl-tRNA synthetase;       
   22::621     2e-15  33%  929 aa  SYV_PROMM RecName: Full=Valyl-tRNA synthetase;       
   31::618     2e-15  32%  919 aa  SYV_CORDI RecName: Full=Valyl-tRNA synthetase;       
    3::365     2e-15  34%  660 aa  SYM_BACHD RecName: Full=Methionyl-tRNA synthetase;       
   34::628     2e-15  30%  927 aa  SYI_SYNWW RecName: Full=Isoleucyl-tRNA synthetase;       
   59::201     2e-15  29%  915 aa  SYI_MYCMS RecName: Full=Isoleucyl-tRNA synthetase;       
    8::194     2e-15  31% 1058 aa  SYI_METAC RecName: Full=Isoleucyl-tRNA synthetase;       
   32::752     3e-15  30%  901 aa  SYV_HALMA RecName: Full=Valyl-tRNA synthetase;       
    5::753     3e-15  31%  897 aa  SYV_GLOVI RecName: Full=Valyl-tRNA synthetase;       
   11::717     3e-15  32%  881 aa  SYV_BACHK RecName: Full=Valyl-tRNA synthetase;       
   11::305     3e-15  32%  881 aa  SYV_BACCZ RecName: Full=Valyl-tRNA synthetase;       
   11::717     3e-15  32%  881 aa  SYV_BACCR RecName: Full=Valyl-tRNA synthetase;       
   11::305     3e-15  32%  881 aa  SYV_BACC1 RecName: Full=Valyl-tRNA synthetase;       
   11::717     3e-15  32%  881 aa  SYV_BACAN RecName: Full=Valyl-tRNA synthetase;       
   61::221     3e-15  31%  953 aa  SYI_THEEB RecName: Full=Isoleucyl-tRNA synthetase;       
    2::293     3e-15  31%  986 aa  SYI_SULSO RecName: Full=Isoleucyl-tRNA synthetase;       
   45::295     4e-15  30%  861 aa  SYV_THELT RecName: Full=Valyl-tRNA synthetase;       
   24::199     4e-15  32%  919 aa  SYI_THEMA RecName: Full=Isoleucyl-tRNA synthetase;       
   12::656     4e-15  33% 1039 aa  SYI_METJA RecName: Full=Isoleucyl-tRNA synthetase;       
   57::784     4e-15  28%  928 aa  SYI_LACSS RecName: Full=Isoleucyl-tRNA synthetase;       
   45::621     4e-15  34%  925 aa  SYI_BREBN RecName: Full=Isoleucyl-tRNA synthetase;       
   24::621     4e-15  27%  922 aa  SYI_BACLD RecName: Full=Isoleucyl-tRNA synthetase;       
   63::627     5e-15  43%  870 aa  SYV_PROAC RecName: Full=Valyl-tRNA synthetase;       
   10::718     5e-15  31%  883 aa  SYV_LISMF RecName: Full=Valyl-tRNA synthetase;       
   49::600     5e-15  35%  913 aa  SYV_DEIRA RecName: Full=Valyl-tRNA synthetase;       
   25::585     5e-15  36%  880 aa  SYV_DEHSC RecName: Full=Valyl-tRNA synthetase;       
   20::308     5e-15  30%  901 aa  SYV_CHLTE RecName: Full=Valyl-tRNA synthetase;       
  136::452     5e-15  28% 1108 aa  SYV_ARATH RecName: Full=Valyl-tRNA synthetase;       
   30::211     5e-15  31%  910 aa  SYL_THEVO RecName: Full=Leucyl-tRNA synthetase;       
   57::358     5e-15  29%  920 aa  SYI_CALS8 RecName: Full=Isoleucyl-tRNA synthetase;       
  104::420     5e-15  28% 1012 aa  SYIM_HUMAN RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
    8::606     6e-15  34%  909 aa  SYV_SYNP6 RecName: Full=Valyl-tRNA synthetase;       
    8::193     6e-15  31% 1062 aa  SYI_METHJ RecName: Full=Isoleucyl-tRNA synthetase;       
   24::628     6e-15  29%  929 aa  SYI_HALOH RecName: Full=Isoleucyl-tRNA synthetase;       
   43::606     8e-15  40%  860 aa  SYV_SALTO RecName: Full=Valyl-tRNA synthetase;       
   10::718     8e-15  31%  883 aa  SYV_LISMO RecName: Full=Valyl-tRNA synthetase;       
    2::181     8e-15  31%  516 aa  SYM_RHIME RecName: Full=Methionyl-tRNA synthetase;       
    1::299     1e-14  31%  948 aa  SYV_PSESM RecName: Full=Valyl-tRNA synthetase;       
    9::748     1e-14  31%  882 aa  SYV_LISIN RecName: Full=Valyl-tRNA synthetase;       
    7::580     1e-14  35%  875 aa  SYV_BORBU RecName: Full=Valyl-tRNA synthetase;       
   32::622     1e-14  32%  916 aa  SYI_STAHJ RecName: Full=Isoleucyl-tRNA synthetase;       
   46::627     1e-14  28%  932 aa  SYI_SACD2 RecName: Full=Isoleucyl-tRNA synthetase;       
   68::211     1e-14  33%  968 aa  SYI_PROMM RecName: Full=Isoleucyl-tRNA synthetase;       
    8::194     1e-14  33% 1058 aa  SYI_METMA RecName: Full=Isoleucyl-tRNA synthetase;       
   24::786     1e-14  30%  911 aa  SYI_EXIS2 RecName: Full=Isoleucyl-tRNA synthetase;       
   48::197     1e-14  32% 1036 aa  SYI_CLOTE RecName: Full=Isoleucyl-tRNA synthetase;       
   20::782     1e-14  30%  923 aa  SYI_BACSK RecName: Full=Isoleucyl-tRNA synthetase;       
   57::354     1e-14  24%  919 aa  SYI_ARCB4 RecName: Full=Isoleucyl-tRNA synthetase;       
   44::298     1e-14  32%  855 aa  SYV_SOLUE RecName: Full=Valyl-tRNA synthetase;       
    8::200     1e-14  33%  939 aa  SYV_CHRVO RecName: Full=Valyl-tRNA synthetase;       
   12::192     1e-14  35%  969 aa  SYL_STAMF RecName: Full=Leucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAAW RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAAT RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAAS RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAAR RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAAN RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAAM RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAAE RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAAC RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAAB RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAA9 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAA8 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAA3 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAA2 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI_STAA1 RecName: Full=Isoleucyl-tRNA synthetase;       
   29::199     1e-14  32%  922 aa  SYI_DESHY RecName: Full=Isoleucyl-tRNA synthetase;       
   29::199     1e-14  32%  922 aa  SYI_DESHD RecName: Full=Isoleucyl-tRNA synthetase;       
   57::628     1e-14  30%  923 aa  SYI_BRAHW RecName: Full=Isoleucyl-tRNA synthetase;       
    5::189     1e-14  33% 1018 aa  SYI_ARCFU RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     1e-14  34%  917 aa  SYI1_STAAU RecName: Full=Isoleucyl-tRNA synthetase;       
    1::299     2e-14  31%  948 aa  SYV_PSE14 RecName: Full=Valyl-tRNA synthetase;       
   11::759     2e-14  30%  918 aa  SYV_PROMP RecName: Full=Valyl-tRNA synthetase;       
   39::191     2e-14  32%  949 aa  SYV_PARUW RecName: Full=Valyl-tRNA synthetase;       
   31::346     2e-14  33%  910 aa  SYI_THEAB RecName: Full=Isoleucyl-tRNA synthetase;       
   24::622     2e-14  32%  916 aa  SYI_STAS1 RecName: Full=Isoleucyl-tRNA synthetase;       
    9::473     2e-14  33% 1067 aa  SYI_PYRAB RecName: Full=Isoleucyl-tRNA synthetase;       
   30::636     2e-14  33%  934 aa  SYI_DESDG RecName: Full=Isoleucyl-tRNA synthetase;       
    7::583     2e-14  32%  894 aa  SYV_BDEBA RecName: Full=Valyl-tRNA synthetase;       
    2::171     2e-14  26%  638 aa  SYM_THETN RecName: Full=Methionyl-tRNA synthetase;       
    4::364     2e-14  34%  673 aa  SYM_OCEIH RecName: Full=Methionyl-tRNA synthetase;       
   31::185     2e-14  34%  934 aa  SYL1_SULSO RecName: Full=Leucyl-tRNA synthetase 1;       
    9::473     2e-14  32% 1065 aa  SYI_PYRKO RecName: Full=Isoleucyl-tRNA synthetase;       
   24::353     2e-14  27%  911 aa  SYI_NAUPA RecName: Full=Isoleucyl-tRNA synthetase;       
   57::781     2e-14  30%  921 aa  SYI_LISW6 RecName: Full=Isoleucyl-tRNA synthetase;       
   57::781     2e-14  30%  921 aa  SYI_LISMO RecName: Full=Isoleucyl-tRNA synthetase;       
   57::812     2e-14  29%  921 aa  SYI_LISMH RecName: Full=Isoleucyl-tRNA synthetase;       
   57::812     2e-14  29%  921 aa  SYI_LISMF RecName: Full=Isoleucyl-tRNA synthetase;       
   57::812     2e-14  29%  921 aa  SYI_LISMC RecName: Full=Isoleucyl-tRNA synthetase;       
   57::781     2e-14  30%  921 aa  SYI_LISIN RecName: Full=Isoleucyl-tRNA synthetase;       
    3::859     3e-14  28% 1020 aa  SYV_SILPO RecName: Full=Valyl-tRNA synthetase;       
    4::302     3e-14  29%  887 aa  SYV_FUSNN RecName: Full=Valyl-tRNA synthetase;       
    3::220     3e-14  30%  723 aa  SYM_PYRHO RecName: Full=Methionyl-tRNA synthetase;       
    3::364     3e-14  32%  660 aa  SYM1_BACCR RecName: Full=Methionyl-tRNA synthetase 1;       
   48::197     3e-14  30% 1035 aa  SYI_CLOAB RecName: Full=Isoleucyl-tRNA synthetase;       
   76::241     4e-14  36%  881 aa  SYV_THEFY RecName: Full=Valyl-tRNA synthetase;       
    7::580     4e-14  33%  875 aa  SYV_BORGA RecName: Full=Valyl-tRNA synthetase;       
  104::431     4e-14  30% 1060 aa  SYVM_MOUSE RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
   60::362     4e-14  34%  952 aa  SYI_MICAN RecName: Full=Isoleucyl-tRNA synthetase;       
   60::614     5e-14  34%  886 aa  SYI_MYCHJ RecName: Full=Isoleucyl-tRNA synthetase;       
   60::614     5e-14  35%  886 aa  SYI_MYCH2 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::625     5e-14  33%  931 aa  SYI_LACS1 RecName: Full=Isoleucyl-tRNA synthetase;       
   60::808     5e-14  30%  971 aa  SYI_ACAM1 RecName: Full=Isoleucyl-tRNA synthetase;       
   18::596     7e-14  33%  886 aa  SYV_MYCLE RecName: Full=Valyl-tRNA synthetase;       
   24::622     7e-14  33%  916 aa  SYI_STAEQ RecName: Full=Isoleucyl-tRNA synthetase;       
   24::622     7e-14  33%  871 aa  SYI_STAEP RecName: Full=Isoleucyl-tRNA synthetase;       
   68::662     7e-14  30%  969 aa  SYI_PROM4 RecName: Full=Isoleucyl-tRNA synthetase;       
   10::303     9e-14  33%  884 aa  SYV_DESVH RecName: Full=Valyl-tRNA synthetase;       
   47::304     9e-14  33%  940 aa  SYV_CHLPN RecName: Full=Valyl-tRNA synthetase;       
   40::211     9e-14  32%  910 aa  SYL_THEAC RecName: Full=Leucyl-tRNA synthetase;       
   22::618     9e-14  31%  900 aa  SYI_MYCPE RecName: Full=Isoleucyl-tRNA synthetase;       
   32::657     9e-14  29%  936 aa  SYI_COXBR RecName: Full=Isoleucyl-tRNA synthetase;       
   48::197     9e-14  31% 1039 aa  SYI_CLOPE RecName: Full=Isoleucyl-tRNA synthetase;       
   46::303     1e-13  33%  874 aa  SYV_UREPA RecName: Full=Valyl-tRNA synthetase;       
  104::431     1e-13  30% 1065 aa  SYVM_RAT RecName: Full=Valyl-tRNA synthetase, mitochondrial;       
    3::343     1e-13  33%  516 aa  SYM_RHILO RecName: Full=Methionyl-tRNA synthetase;       
    3::344     1e-13  32%  515 aa  SYM_BRUSU RecName: Full=Methionyl-tRNA synthetase;       
    3::344     1e-13  32%  515 aa  SYM_BRUME RecName: Full=Methionyl-tRNA synthetase;       
   24::622     1e-13  31%  915 aa  SYI_STACT RecName: Full=Isoleucyl-tRNA synthetase;       
    3::220     2e-13  30%  724 aa  SYM_PYRFU RecName: Full=Methionyl-tRNA synthetase;       
   47::196     2e-13  33% 1043 aa  SYI_THET8 RecName: Full=Isoleucyl-tRNA synthetase;       
   94::235     2e-13  33% 1034 aa  SYIM_DICDI RecName: Full=Probable isoleucyl-tRNA synthetase,
   45::764     2e-13  30%  927 aa  SYV_RHILO RecName: Full=Valyl-tRNA synthetase;       
    7::581     2e-13  33%  882 aa  SYV_LEPIN RecName: Full=Valyl-tRNA synthetase;       
    7::581     2e-13  33%  882 aa  SYV_LEPIC RecName: Full=Valyl-tRNA synthetase;       
   47::193     2e-13  34%  955 aa  SYV_BURPS RecName: Full=Valyl-tRNA synthetase;       
   47::193     2e-13  34%  955 aa  SYV_BURMA RecName: Full=Valyl-tRNA synthetase;       
    2::309     2e-13  32%  958 aa  SYV_BRAJA RecName: Full=Valyl-tRNA synthetase;       
   47::196     2e-13  32% 1043 aa  SYI_THET2 RecName: Full=Isoleucyl-tRNA synthetase;       
   35::622     2e-13  34%  916 aa  SYI_STAES RecName: Full=Isoleucyl-tRNA synthetase;       
   32::657     2e-13  29%  936 aa  SYI_COXBU RecName: Full=Isoleucyl-tRNA synthetase;       
   32::657     2e-13  29%  936 aa  SYI_COXBN RecName: Full=Isoleucyl-tRNA synthetase;       
   32::657     2e-13  29%  936 aa  SYI_COXB2 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::657     2e-13  29%  936 aa  SYI_COXB1 RecName: Full=Isoleucyl-tRNA synthetase;       
    8::586     3e-13  31%  876 aa  SYV_MYCTU RecName: Full=Valyl-tRNA synthetase;       
    8::586     3e-13  31%  876 aa  SYV_MYCBO RecName: Full=Valyl-tRNA synthetase;       
    3::364     3e-13  32%  660 aa  SYM1_BACAN RecName: Full=Methionyl-tRNA synthetase 1;       
   28::201     3e-13  31%  905 aa  SYI_PELUB RecName: Full=Isoleucyl-tRNA synthetase;       
   60::614     3e-13  34%  886 aa  SYI_MYCH7 RecName: Full=Isoleucyl-tRNA synthetase;       
    5::302     3e-13  31%  872 aa  SYV_MYCMS RecName: Full=Valyl-tRNA synthetase;       
    3::220     3e-13  30%  722 aa  SYM_PYRAB RecName: Full=Methionyl-tRNA synthetase;       
    3::346     3e-13  29%  641 aa  SYM_CLOTE RecName: Full=Methionyl-tRNA synthetase;       
   68::382     3e-13  32%  968 aa  SYI_PROM0 RecName: Full=Isoleucyl-tRNA synthetase;       
   59::188     3e-13  29%  900 aa  SYI_ONYPE RecName: Full=Isoleucyl-tRNA synthetase;       
   24::617     3e-13  34%  861 aa  SYI_MYCPN RecName: Full=Isoleucyl-tRNA synthetase;       
   11::294     4e-13  32%  880 aa  SYV_CLOTE RecName: Full=Valyl-tRNA synthetase;       
    9::329     4e-13  34%  998 aa  SYV_AZOSB RecName: Full=Valyl-tRNA synthetase;       
   59::202     4e-13  32%  885 aa  SYI_MYCMO RecName: Full=Isoleucyl-tRNA synthetase;       
   12::654     4e-13  34% 1034 aa  SYI_METMP RecName: Full=Isoleucyl-tRNA synthetase;       
    9::762     6e-13  28%  896 aa  SYV_SPHWW RecName: Full=Valyl-tRNA synthetase;       
   43::207     6e-13  38%  862 aa  SYV_SALAI RecName: Full=Valyl-tRNA synthetase;       
   12::352     6e-13  29%  592 aa  SYM_ROSS1 RecName: Full=Methionyl-tRNA synthetase;       
   58::353     6e-13  26%  915 aa  SYI_WOLSU RecName: Full=Isoleucyl-tRNA synthetase;       
   47::172     6e-13  37% 1038 aa  SYI_PARUW RecName: Full=Isoleucyl-tRNA synthetase;       
    1::220     8e-13  28% 1050 aa  SYI_SULAC RecName: Full=Isoleucyl-tRNA synthetase;       
    9::754     1e-12  30%  884 aa  SYV_ZYMMO RecName: Full=Valyl-tRNA synthetase;       
    1::706     1e-12  28%  832 aa  SYV_MYCS5 RecName: Full=Valyl-tRNA synthetase;       
    1::567     1e-12  32%  827 aa  SYV_MYCPU RecName: Full=Valyl-tRNA synthetase;       
   57::620     1e-12  34%  911 aa  SYI_THELT RecName: Full=Isoleucyl-tRNA synthetase;       
   57::617     1e-12  32%  895 aa  SYI_MYCGE RecName: Full=Isoleucyl-tRNA synthetase;       
   48::197     1e-12  30% 1038 aa  SYI_CLONN RecName: Full=Isoleucyl-tRNA synthetase;       
   57::358     1e-12  31%  920 aa  SYI_ANATD RecName: Full=Isoleucyl-tRNA synthetase;       
   52::98      1e-12  33% 1024 aa  SYI_PICTO RecName: Full=Isoleucyl-tRNA synthetase;       
   57::795     1e-12  29%  914 aa  SYI_MACCJ RecName: Full=Isoleucyl-tRNA synthetase;       
    9::640     2e-12  31%  948 aa  SYV_AZOSE RecName: Full=Valyl-tRNA synthetase;       
   57::795     2e-12  29%  932 aa  SYI_LACLA RecName: Full=Isoleucyl-tRNA synthetase;       
   57::352     2e-12  33%  927 aa  SYI_LACH4 RecName: Full=Isoleucyl-tRNA synthetase;       
    1::296     2e-12  28%  822 aa  SYV_MYCHJ RecName: Full=Valyl-tRNA synthetase;       
    1::296     2e-12  28%  822 aa  SYV_MYCH7 RecName: Full=Valyl-tRNA synthetase;       
    1::296     2e-12  28%  822 aa  SYV_MYCH2 RecName: Full=Valyl-tRNA synthetase;       
    6::144     2e-12  32%  689 aa  SYM_CYTH3 RecName: Full=Methionyl-tRNA synthetase;       
   28::776     2e-12  30%  930 aa  SYI_STRA5 RecName: Full=Isoleucyl-tRNA synthetase;       
   28::776     2e-12  30%  930 aa  SYI_STRA3 RecName: Full=Isoleucyl-tRNA synthetase;       
   28::776     2e-12  30%  930 aa  SYI_STRA1 RecName: Full=Isoleucyl-tRNA synthetase;       
   60::620     2e-12  35%  892 aa  SYI_MYCAP RecName: Full=Isoleucyl-tRNA synthetase;       
   31::347     2e-12  32%  921 aa  SYI_KOSOT RecName: Full=Isoleucyl-tRNA synthetase;       
   24::351     2e-12  25%  916 aa  SYI_CAMFF RecName: Full=Isoleucyl-tRNA synthetase;       
   12::229     3e-12  30%  592 aa  SYM_ROSCS RecName: Full=Methionyl-tRNA synthetase;       
    8::143     3e-12  30%  710 aa  SYM_HERAR RecName: Full=Methionyl-tRNA synthetase;       
    3::365     3e-12  32%  664 aa  SYM_BACSU RecName: Full=Methionyl-tRNA synthetase;       
   48::161     3e-12  31%  922 aa  SYI_RUTMC RecName: Full=Isoleucyl-tRNA synthetase;       
   57::352     3e-12  28%  907 aa  SYI_METI4 RecName: Full=Isoleucyl-tRNA synthetase;       
   14::630     3e-12  35% 1072 aa  SYIC_YEAST RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   10::310     4e-12  33%  861 aa  SYV_MYCGA RecName: Full=Valyl-tRNA synthetase;       
    1::188     4e-12  28%  960 aa  SYV_BUCAP RecName: Full=Valyl-tRNA synthetase;       
   52::600     4e-12  36%  823 aa  SYV_AERPE RecName: Full=Valyl-tRNA synthetase;       
    5::149     4e-12  30%  689 aa  SYM_POLSJ RecName: Full=Methionyl-tRNA synthetase;       
   85::401     4e-12  31%  993 aa  SYIM_MACFA RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   12::305     5e-12  30% 1014 aa  SYV_ANASP RecName: Full=Valyl-tRNA synthetase;       
    3::140     5e-12  31%  741 aa  SYM_PYRKO RecName: Full=Methionyl-tRNA synthetase;       
   31::632     5e-12  31%  939 aa  SYI_SULSY RecName: Full=Isoleucyl-tRNA synthetase;       
   24::776     5e-12  29%  930 aa  SYI_STRZP RecName: Full=Isoleucyl-tRNA synthetase;       
   24::776     5e-12  29%  930 aa  SYI_STRPS RecName: Full=Isoleucyl-tRNA synthetase;       
   24::776     5e-12  29%  930 aa  SYI_STRPJ RecName: Full=Isoleucyl-tRNA synthetase;       
   24::776     5e-12  29%  930 aa  SYI_STRP7 RecName: Full=Isoleucyl-tRNA synthetase;       
   87::213     5e-12  31%  973 aa  SYIM_SCHPO RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
    6::728     6e-12  31%  871 aa  SYV_NITSB RecName: Full=Valyl-tRNA synthetase;       
   43::201     6e-12  28% 1026 aa  SYI_THEAC RecName: Full=Isoleucyl-tRNA synthetase;       
   29::199     6e-12  31%  927 aa  SYI_PELCD RecName: Full=Isoleucyl-tRNA synthetase;       
   57::624     6e-12  33%  937 aa  SYI_LACBA RecName: Full=Isoleucyl-tRNA synthetase;       
   28::336     8e-12  30%  894 aa  SYV_WOLSU RecName: Full=Valyl-tRNA synthetase;       
   19::587     8e-12  32%  874 aa  SYV_STRAW RecName: Full=Valyl-tRNA synthetase;       
   10::760     8e-12  26%  811 aa  SYV_SPHEL RecName: Full=Valyl-tRNA synthetase;       
    9::179     8e-12  31%  969 aa  SYV_HERAR RecName: Full=Valyl-tRNA synthetase;       
   16::216     8e-12  27%  960 aa  SYV_BORPE RecName: Full=Valyl-tRNA synthetase;       
   16::216     8e-12  27%  960 aa  SYV_BORPA RecName: Full=Valyl-tRNA synthetase;       
   16::216     8e-12  27%  960 aa  SYV_BORBR RecName: Full=Valyl-tRNA synthetase;       
   57::353     8e-12  25%  919 aa  SYI_SULDN RecName: Full=Isoleucyl-tRNA synthetase;       
   68::382     8e-12  34%  965 aa  SYI_PROM5 RecName: Full=Isoleucyl-tRNA synthetase;       
    3::362     1e-11  32%  657 aa  SYM_STAAW RecName: Full=Methionyl-tRNA synthetase;       
    3::362     1e-11  32%  657 aa  SYM_STAAS RecName: Full=Methionyl-tRNA synthetase;       
    3::362     1e-11  32%  657 aa  SYM_STAAR RecName: Full=Methionyl-tRNA synthetase;       
    3::362     1e-11  32%  657 aa  SYM_STAAN RecName: Full=Methionyl-tRNA synthetase;       
    3::362     1e-11  32%  657 aa  SYM_STAAM RecName: Full=Methionyl-tRNA synthetase;       
    3::362     1e-11  32%  657 aa  SYM_STAAC RecName: Full=Methionyl-tRNA synthetase;       
    8::266     1e-11  29%  722 aa  SYM_BURM1 RecName: Full=Methionyl-tRNA synthetase;       
   28::776     1e-11  30%  933 aa  SYI_STRP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   94::237     1e-11  28% 1002 aa  SYIM_YEAST RecName: Full=Isoleucyl-tRNA synthetase, mitochondrial; 
   13::191     1e-11  29% 1030 aa  SYI2_PSEFL RecName: Full=Isoleucyl-tRNA synthetase 2;       
  104::431     1e-11  29% 1063 aa  SYVM_HUMAN RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
    3::362     1e-11  33%  658 aa  SYM_STAS1 RecName: Full=Methionyl-tRNA synthetase;       
   10::118     1e-11  32%  540 aa  SYM_HALOH RecName: Full=Methionyl-tRNA synthetase;       
    4::151     1e-11  30%  546 aa  SYM_COXBU RecName: Full=Methionyl-tRNA synthetase;       
    4::151     1e-11  30%  546 aa  SYM_COXBR RecName: Full=Methionyl-tRNA synthetase;       
    4::151     1e-11  30%  546 aa  SYM_COXBN RecName: Full=Methionyl-tRNA synthetase;       
    4::151     1e-11  30%  546 aa  SYM_COXB2 RecName: Full=Methionyl-tRNA synthetase;       
    4::151     1e-11  30%  546 aa  SYM_COXB1 RecName: Full=Methionyl-tRNA synthetase;       
   10::119     1e-11  35%  544 aa  SYM1_BACC1 RecName: Full=Methionyl-tRNA synthetase 1;       
   48::194     1e-11  33% 1091 aa  SYI_TREPS RecName: Full=Isoleucyl-tRNA synthetase;       
   48::194     1e-11  33% 1091 aa  SYI_TREPA RecName: Full=Isoleucyl-tRNA synthetase;       
   68::382     1e-11  32%  965 aa  SYI_PROMP RecName: Full=Isoleucyl-tRNA synthetase;       
   40::666     1e-11  30% 1040 aa  SYI_META3 RecName: Full=Isoleucyl-tRNA synthetase;       
   57::198     1e-11  31%  931 aa  SYI_LACDB RecName: Full=Isoleucyl-tRNA synthetase;       
   57::198     1e-11  31%  931 aa  SYI_LACDA RecName: Full=Isoleucyl-tRNA synthetase;       
   57::350     1e-11  24%  930 aa  SYI_HELHP RecName: Full=Isoleucyl-tRNA synthetase;       
   10::119     2e-11  34%  544 aa  SYM_BACC7 RecName: Full=Methionyl-tRNA synthetase;       
   10::119     2e-11  35%  544 aa  SYM_BACC4 RecName: Full=Methionyl-tRNA synthetase;       
   10::119     2e-11  35%  544 aa  SYM_BACC2 RecName: Full=Methionyl-tRNA synthetase;       
   28::776     2e-11  30%  933 aa  SYI_STRPM RecName: Full=Isoleucyl-tRNA synthetase;       
   28::776     2e-11  30%  933 aa  SYI_STRP8 RecName: Full=Isoleucyl-tRNA synthetase;       
   28::776     2e-11  30%  933 aa  SYI_STRP6 RecName: Full=Isoleucyl-tRNA synthetase;       
   28::776     2e-11  30%  933 aa  SYI_STRP1 RecName: Full=Isoleucyl-tRNA synthetase;       
   28::619     2e-11  31%  888 aa  SYI_MYCPU RecName: Full=Isoleucyl-tRNA synthetase;       
   26::187     2e-11  29%  908 aa  SYI_MESFL RecName: Full=Isoleucyl-tRNA synthetase;       
   57::769     2e-11  29%  928 aa  SYI_LACCB RecName: Full=Isoleucyl-tRNA synthetase;       
   57::769     2e-11  29%  928 aa  SYI_LACC3 RecName: Full=Isoleucyl-tRNA synthetase;       
   43::193     2e-11  32%  937 aa  SYI_HYDS0 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::634     2e-11  33%  938 aa  SYI_DESDA RecName: Full=Isoleucyl-tRNA synthetase;       
   59::352     2e-11  23%  917 aa  SYI_CAMJE RecName: Full=Isoleucyl-tRNA synthetase;       
   27::652     2e-11  33%  956 aa  SYI_AQUAE RecName: Full=Isoleucyl-tRNA synthetase;       
   14::657     2e-11  32% 1101 aa  SYI_ANAMM RecName: Full=Isoleucyl-tRNA synthetase;       
   36::660     2e-11  34% 1262 aa  SYIC_HUMAN RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
    8::455     2e-11  35%  790 aa  SYV_THEVO RecName: Full=Valyl-tRNA synthetase;       
    4::640     2e-11  28% 1035 aa  SYV_RHOBA RecName: Full=Valyl-tRNA synthetase;       
   37::544     2e-11  36%  768 aa  SYV_PICTO RecName: Full=Valyl-tRNA synthetase;       
   38::557     2e-11  37%  874 aa  SYV_HELPY RecName: Full=Valyl-tRNA synthetase;       
   63::623     2e-11  30%  901 aa  SYI_MYCGA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::193     2e-11  31% 1066 aa  SYI_METLZ RecName: Full=Isoleucyl-tRNA synthetase;       
   59::352     2e-11  23%  917 aa  SYI_CAMJR RecName: Full=Isoleucyl-tRNA synthetase;       
   29::297     3e-11  32%  870 aa  SYV_CAMJR RecName: Full=Valyl-tRNA synthetase;       
    3::362     3e-11  32%  656 aa  SYM_STAES RecName: Full=Methionyl-tRNA synthetase;       
    3::362     3e-11  32%  656 aa  SYM_STAEQ RecName: Full=Methionyl-tRNA synthetase;       
   14::144     3e-11  32%  679 aa  SYM_PARD8 RecName: Full=Methionyl-tRNA synthetase;       
   10::119     3e-11  33%  544 aa  SYM_BACC3 RecName: Full=Methionyl-tRNA synthetase;       
   10::119     3e-11  33%  544 aa  SYM_BACC0 RecName: Full=Methionyl-tRNA synthetase;       
   10::119     3e-11  33%  544 aa  SYM_BACAC RecName: Full=Methionyl-tRNA synthetase;       
   10::119     3e-11  33%  544 aa  SYM_BACAA RecName: Full=Methionyl-tRNA synthetase;       
   10::119     3e-11  33%  544 aa  SYM2_BACAN RecName: Full=Methionyl-tRNA synthetase 2;       
   10::119     3e-11  33%  544 aa  SYM1_BACHK RecName: Full=Methionyl-tRNA synthetase 1;       
   10::119     3e-11  33%  544 aa  SYM1_BACAH RecName: Full=Methionyl-tRNA synthetase 1;       
   37::90      3e-11  46% 1022 aa  SYL_IGNH4 RecName: Full=Leucyl-tRNA synthetase;       
   57::776     3e-11  30%  930 aa  SYI_STRSV RecName: Full=Isoleucyl-tRNA synthetase;       
   24::776     3e-11  29%  930 aa  SYI_STRGC RecName: Full=Isoleucyl-tRNA synthetase;       
   57::637     3e-11  35%  947 aa  SYI_PERMH RecName: Full=Isoleucyl-tRNA synthetase;       
   57::788     3e-11  31%  933 aa  SYI_PEDPA RecName: Full=Isoleucyl-tRNA synthetase;       
   37::573     4e-11  38%  839 aa  SYV_MYCMO RecName: Full=Valyl-tRNA synthetase;       
    9::179     4e-11  30%  965 aa  SYV_JANMA RecName: Full=Valyl-tRNA synthetase;       
    3::221     4e-11  29%  733 aa  SYM_THEON RecName: Full=Methionyl-tRNA synthetase;       
    2::132     4e-11  31%  710 aa  SYM_METBF RecName: Full=Methionyl-tRNA synthetase;       
    8::266     4e-11  29%  720 aa  SYM_BURCM RecName: Full=Methionyl-tRNA synthetase;       
    8::266     4e-11  29%  720 aa  SYM_BURA4 RecName: Full=Methionyl-tRNA synthetase;       
   10::119     4e-11  33%  544 aa  SYM_BACCQ RecName: Full=Methionyl-tRNA synthetase;       
   28::776     4e-11  28%  929 aa  SYI_STRTD RecName: Full=Isoleucyl-tRNA synthetase;       
   28::776     4e-11  28%  929 aa  SYI_STRT2 RecName: Full=Isoleucyl-tRNA synthetase;       
   28::776     4e-11  28%  929 aa  SYI_STRT1 RecName: Full=Isoleucyl-tRNA synthetase;       
   31::353     4e-11  30%  930 aa  SYI_DESAP RecName: Full=Isoleucyl-tRNA synthetase;       
    8::292     5e-11  37%  791 aa  SYV_THEAC RecName: Full=Valyl-tRNA synthetase;       
    2::136     5e-11  30%  658 aa  SYM_ARCFU RecName: Full=Methionyl-tRNA synthetase;       
   10::118     5e-11  33%  544 aa  SYM2_BACCR RecName: Full=Methionyl-tRNA synthetase 2;       
   57::776     5e-11  30%  930 aa  SYI_STRZT RecName: Full=Isoleucyl-tRNA synthetase;       
   57::776     5e-11  30%  930 aa  SYI_STRZJ RecName: Full=Isoleucyl-tRNA synthetase;       
   57::776     5e-11  30%  930 aa  SYI_STRR6 RecName: Full=Isoleucyl-tRNA synthetase;       
   57::776     5e-11  30%  930 aa  SYI_STRPN RecName: Full=Isoleucyl-tRNA synthetase;       
   57::776     5e-11  30%  930 aa  SYI_STRPI RecName: Full=Isoleucyl-tRNA synthetase;       
   57::776     5e-11  30%  930 aa  SYI_STRP4 RecName: Full=Isoleucyl-tRNA synthetase;       
   57::776     5e-11  30%  930 aa  SYI_STRP2 RecName: Full=Isoleucyl-tRNA synthetase;       
   34::659     5e-11  32% 1053 aa  SYI_MYCPA RecName: Full=Isoleucyl-tRNA synthetase;       
   30::376     5e-11  26%  939 aa  SYI_MARAV RecName: Full=Isoleucyl-tRNA synthetase;       
   57::626     5e-11  35%  930 aa  SYI_LACF3 RecName: Full=Isoleucyl-tRNA synthetase;       
    7::85      5e-11  30% 1022 aa  SYI2_OCEIH RecName: Full=Isoleucyl-tRNA synthetase 2;       
   24::797     5e-11  26%  918 aa  SYI1_OCEIH RecName: Full=Isoleucyl-tRNA synthetase 1;       
   19::695     7e-11  29%  874 aa  SYV_STRCO RecName: Full=Valyl-tRNA synthetase;       
    3::362     7e-11  32%  659 aa  SYM_STAHJ RecName: Full=Methionyl-tRNA synthetase;       
    8::266     7e-11  31%  725 aa  SYM_BURPS RecName: Full=Methionyl-tRNA synthetase;       
    8::266     7e-11  31%  725 aa  SYM_BURP6 RecName: Full=Methionyl-tRNA synthetase;       
    8::266     7e-11  31%  725 aa  SYM_BURP1 RecName: Full=Methionyl-tRNA synthetase;       
    8::266     7e-11  31%  725 aa  SYM_BURP0 RecName: Full=Methionyl-tRNA synthetase;       
    8::266     7e-11  31%  725 aa  SYM_BURMS RecName: Full=Methionyl-tRNA synthetase;       
    8::266     7e-11  31%  725 aa  SYM_BURMA RecName: Full=Methionyl-tRNA synthetase;       
    8::266     7e-11  31%  725 aa  SYM_BURM9 RecName: Full=Methionyl-tRNA synthetase;       
    8::266     7e-11  31%  725 aa  SYM_BURM7 RecName: Full=Methionyl-tRNA synthetase;       
   25::620     7e-11  31%  900 aa  SYI_UREPA RecName: Full=Isoleucyl-tRNA synthetase;       
   47::196     7e-11  29% 1033 aa  SYI2_BACCR RecName: Full=Isoleucyl-tRNA synthetase 2;       
   34::573     9e-11  32%  751 aa  SYV_NANEQ RecName: Full=Valyl-tRNA synthetase;       
   36::555     9e-11  37%  872 aa  SYV_HELPJ RecName: Full=Valyl-tRNA synthetase;       
   29::174     9e-11  32%  870 aa  SYV_CAMJE RecName: Full=Valyl-tRNA synthetase;       
   12::140     9e-11  33%  584 aa  SYM_THERP RecName: Full=Methionyl-tRNA synthetase;       
    2::323     9e-11  28%  507 aa  SYM_RICTY RecName: Full=Methionyl-tRNA synthetase;       
   48::200     9e-11  31%  955 aa  SYI_VESOH RecName: Full=Isoleucyl-tRNA synthetase;       
   34::655     9e-11  29%  941 aa  SYI_PSYA2 RecName: Full=Isoleucyl-tRNA synthetase;       
   57::624     9e-11  33%  932 aa  SYI_LACPL RecName: Full=Isoleucyl-tRNA synthetase;       
    2::323     1e-10  28%  508 aa  SYM_RICPR RecName: Full=Methionyl-tRNA synthetase;       
    5::129     1e-10  32%  688 aa  SYM_DIAST RecName: Full=Methionyl-tRNA synthetase;       
   12::122     1e-10  37%  553 aa  SYM_DEHSC RecName: Full=Methionyl-tRNA synthetase;       
   12::122     1e-10  37%  553 aa  SYM_DEHSB RecName: Full=Methionyl-tRNA synthetase;       
    5::129     1e-10  32%  688 aa  SYM_ACISJ RecName: Full=Methionyl-tRNA synthetase;       
   26::690     1e-10  30% 1092 aa  SYI_CORJK RecName: Full=Isoleucyl-tRNA synthetase;       
   27::677     1e-10  30% 1103 aa  SYI_BIFLO RecName: Full=Isoleucyl-tRNA synthetase;       
   69::622     2e-10  34%  956 aa  SYV_TREPA RecName: Full=Valyl-tRNA synthetase;       
   14::255     2e-10  31%  680 aa  SYM_PORGI RecName: Full=Methionyl-tRNA synthetase;       
   14::255     2e-10  31%  680 aa  SYM_PORG3 RecName: Full=Methionyl-tRNA synthetase;       
    3::364     2e-10  32%  664 aa  SYM_LISMO RecName: Full=Methionyl-tRNA synthetase;       
    4::365     2e-10  32%  665 aa  SYM_LISMF RecName: Full=Methionyl-tRNA synthetase;       
    3::364     2e-10  33%  664 aa  SYM_LISIN RecName: Full=Methionyl-tRNA synthetase;       
    8::266     2e-10  29%  718 aa  SYM_BURCJ RecName: Full=Methionyl-tRNA synthetase;       
   10::118     2e-10  32%  544 aa  SYM_BACWK RecName: Full=Methionyl-tRNA synthetase;       
  100::254     2e-10  31% 1213 aa  SYI_RHOBA RecName: Full=Isoleucyl-tRNA synthetase;       
   15::828     2e-10  28% 1084 aa  SYI_CHLTE RecName: Full=Isoleucyl-tRNA synthetase;       
   15::191     2e-10  30% 1043 aa  SYI_CHLPN RecName: Full=Isoleucyl-tRNA synthetase;       
   25::366     2e-10  30%  942 aa  SYI_BLOPB RecName: Full=Isoleucyl-tRNA synthetase;       
   47::196     2e-10  31% 1033 aa  SYI_BACAH RecName: Full=Isoleucyl-tRNA synthetase;       
   47::196     2e-10  31% 1033 aa  SYI2_BACHK RecName: Full=Isoleucyl-tRNA synthetase 2;       
    4::149     2e-10  29%  577 aa  SYM_RUBXD RecName: Full=Methionyl-tRNA synthetase;       
    3::363     2e-10  32%  669 aa  SYM_ENTFA RecName: Full=Methionyl-tRNA synthetase;       
   42::220     2e-10  29% 1005 aa  SYI_RHOPA RecName: Full=Isoleucyl-tRNA synthetase;       
   36::191     2e-10  35% 1262 aa  SYIC_MOUSE RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   12::122     3e-10  37%  553 aa  SYM_DEHE1 RecName: Full=Methionyl-tRNA synthetase;       
   10::265     3e-10  29%  710 aa  SYM_BURXL RecName: Full=Methionyl-tRNA synthetase;       
   11::266     3e-10  31%  718 aa  SYM_BURTA RecName: Full=Methionyl-tRNA synthetase;       
   24::353     3e-10  32%  931 aa  SYI_LACRJ RecName: Full=Isoleucyl-tRNA synthetase;       
   32::633     3e-10  31%  938 aa  SYI_DESVM RecName: Full=Isoleucyl-tRNA synthetase;       
   47::299     4e-10  34%  869 aa  SYV_MYCPE RecName: Full=Valyl-tRNA synthetase;       
    2::140     4e-10  29%  570 aa  SYM_PYRAE RecName: Full=Methionyl-tRNA synthetase;       
   19::147     4e-10  29%  715 aa  SYM_METMA RecName: Full=Methionyl-tRNA synthetase;       
   12::143     4e-10  32%  679 aa  SYM_BACFR RecName: Full=Methionyl-tRNA synthetase;       
   12::143     4e-10  32%  679 aa  SYM_BACFN RecName: Full=Methionyl-tRNA synthetase;       
   18::677     4e-10  32% 1041 aa  SYI_MYCTU RecName: Full=Isoleucyl-tRNA synthetase;       
   18::677     4e-10  32% 1041 aa  SYI_MYCBO RecName: Full=Isoleucyl-tRNA synthetase;       
   32::360     4e-10  30%  938 aa  SYI_DESVV RecName: Full=Isoleucyl-tRNA synthetase;       
   32::360     4e-10  30%  938 aa  SYI_DESVH RecName: Full=Isoleucyl-tRNA synthetase;       
   24::97      4e-10  30% 1078 aa  SYI_DEIRA RecName: Full=Isoleucyl-tRNA synthetase;       
   59::353     4e-10  24%  921 aa  SYI_CAMHC RecName: Full=Isoleucyl-tRNA synthetase;       
   33::303     5e-10  35%  837 aa  SYV_MYCGE RecName: Full=Valyl-tRNA synthetase;       
    2::181     5e-10  29%  665 aa  SYM_STRP3 RecName: Full=Methionyl-tRNA synthetase;       
   16::346     5e-10  27%  645 aa  SYM_CLOPE RecName: Full=Methionyl-tRNA synthetase;       
    8::266     5e-10  28%  721 aa  SYM_BURVG RecName: Full=Methionyl-tRNA synthetase;       
    8::266     5e-10  29%  718 aa  SYM_BURCH RecName: Full=Methionyl-tRNA synthetase;       
    8::266     5e-10  29%  716 aa  SYM_BURCC RecName: Full=Methionyl-tRNA synthetase;       
    8::266     5e-10  29%  718 aa  SYM_BURCA RecName: Full=Methionyl-tRNA synthetase;       
    3::140     5e-10  25%  516 aa  SYM_AGRT5 RecName: Full=Methionyl-tRNA synthetase;       
   65::210     5e-10  29%  970 aa  SYI_SILPO RecName: Full=Isoleucyl-tRNA synthetase;       
   12::660     5e-10  29%  981 aa  SYI_PYRAE RecName: Full=Isoleucyl-tRNA synthetase;       
   39::217     5e-10  28%  999 aa  SYI_NITWN RecName: Full=Isoleucyl-tRNA synthetase;       
   57::200     5e-10  33%  939 aa  SYI_DESPS RecName: Full=Isoleucyl-tRNA synthetase;       
    4::189     5e-10  34% 1036 aa  SYI_CHLTR RecName: Full=Isoleucyl-tRNA synthetase;       
    4::189     5e-10  34% 1036 aa  SYI_CHLTB RecName: Full=Isoleucyl-tRNA synthetase;       
    4::189     5e-10  34% 1036 aa  SYI_CHLTA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::189     5e-10  34% 1036 aa  SYI_CHLT2 RecName: Full=Isoleucyl-tRNA synthetase;       
   33::303     6e-10  33%  838 aa  SYV_MYCPN RecName: Full=Valyl-tRNA synthetase;       
   14::124     6e-10  33%  606 aa  SYM_THEFY RecName: Full=Methionyl-tRNA synthetase;       
   12::221     6e-10  28%  673 aa  SYM_METLZ RecName: Full=Methionyl-tRNA synthetase;       
    6::141     6e-10  31%  670 aa  SYM_LEGPL RecName: Full=Methionyl-tRNA synthetase;       
    6::141     6e-10  31%  670 aa  SYM_LEGPH RecName: Full=Methionyl-tRNA synthetase;       
    6::141     6e-10  31%  670 aa  SYM_LEGPC RecName: Full=Methionyl-tRNA synthetase;       
    8::144     6e-10  29%  700 aa  SYM_JANMA RecName: Full=Methionyl-tRNA synthetase;       
   11::128     6e-10  35%  620 aa  SYM_BIFAA RecName: Full=Methionyl-tRNA synthetase;       
   12::143     6e-10  33%  679 aa  SYM_BACTN RecName: Full=Methionyl-tRNA synthetase;       
   30::184     6e-10  26%  943 aa  SYI_PSEPW RecName: Full=Isoleucyl-tRNA synthetase;       
  104::432     8e-10  29% 1064 aa  SYVM_MACMU RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
    2::181     8e-10  29%  665 aa  SYM_STRP8 RecName: Full=Methionyl-tRNA synthetase;       
   28::185     8e-10  29%  930 aa  SYI_STRMU RecName: Full=Isoleucyl-tRNA synthetase;       
   17::201     8e-10  29% 1047 aa  SYI_STRAW RecName: Full=Isoleucyl-tRNA synthetase;       
   30::184     8e-10  29%  943 aa  SYI_PSEU5 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::200     8e-10  29%  942 aa  SYI_PSEHT RecName: Full=Isoleucyl-tRNA synthetase;       
   31::115     8e-10  38%  914 aa  SYI_LEPIN RecName: Full=Isoleucyl-tRNA synthetase;       
   31::193     8e-10  36%  914 aa  SYI_LEPIC RecName: Full=Isoleucyl-tRNA synthetase;       
   48::639     8e-10  27%  944 aa  SYI_IDILO RecName: Full=Isoleucyl-tRNA synthetase;       
   28::675     8e-10  29% 1117 aa  SYI_EHRRW RecName: Full=Isoleucyl-tRNA synthetase;       
   28::675     8e-10  29% 1118 aa  SYI_EHRRG RecName: Full=Isoleucyl-tRNA synthetase;       
    4::189     8e-10  33% 1036 aa  SYI_CHLMU RecName: Full=Isoleucyl-tRNA synthetase;       
   17::629     8e-10  33% 1141 aa  SYIC_CAEEL RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   47::196     8e-10  31% 1033 aa  SYI2_BACCZ RecName: Full=Isoleucyl-tRNA synthetase 2;       
    6::130     1e-09  31%  680 aa  SYM_THICR RecName: Full=Methionyl-tRNA synthetase;       
    2::181     1e-09  29%  665 aa  SYM_STRP6 RecName: Full=Methionyl-tRNA synthetase;       
   11::121     1e-09  35%  600 aa  SYM_SALAI RecName: Full=Methionyl-tRNA synthetase;       
    7::147     1e-09  28%  712 aa  SYM_METAC RecName: Full=Methionyl-tRNA synthetase;       
    6::141     1e-09  31%  670 aa  SYM_LEGPA RecName: Full=Methionyl-tRNA synthetase;       
    2::249     1e-09  29%  561 aa  SYM_IGNH4 RecName: Full=Methionyl-tRNA synthetase;       
    3::140     1e-09  26%  572 aa  SYM_HYPBU RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-09  29%  676 aa  SYM_ERWT9 RecName: Full=Methionyl-tRNA synthetase;       
   11::128     1e-09  33%  623 aa  SYM_BIFA0 RecName: Full=Methionyl-tRNA synthetase;       
   16::195     1e-09  28% 1134 aa  SYI_WOLTR RecName: Full=Isoleucyl-tRNA synthetase;       
   30::184     1e-09  26%  943 aa  SYI_PSEPK RecName: Full=Isoleucyl-tRNA synthetase;       
   30::184     1e-09  26%  943 aa  SYI_PSEPG RecName: Full=Isoleucyl-tRNA synthetase;       
   30::184     1e-09  26%  943 aa  SYI_PSEP1 RecName: Full=Isoleucyl-tRNA synthetase;       
   30::184     1e-09  28%  943 aa  SYI_PSEE4 RecName: Full=Isoleucyl-tRNA synthetase;       
   57::786     1e-09  29%  927 aa  SYI_LACAC RecName: Full=Isoleucyl-tRNA synthetase;       
   35::339     1e-09  28%  950 aa  SYVM_SCHPO RecName: Full=Valyl-tRNA synthetase, mitochondrial;     
    2::171     1e-09  25%  512 aa  SYM_RICFE RecName: Full=Methionyl-tRNA synthetase;       
    9::131     1e-09  29%  703 aa  SYM_MYXXD RecName: Full=Methionyl-tRNA synthetase;       
   12::122     1e-09  30%  663 aa  SYM_METPE RecName: Full=Methionyl-tRNA synthetase;       
    3::256     1e-09  29%  691 aa  SYM_GRAFK RecName: Full=Methionyl-tRNA synthetase;       
   11::128     1e-09  33%  621 aa  SYM_BIFLO RecName: Full=Methionyl-tRNA synthetase;       
   10::89      1e-09  38%  540 aa  SYM1_ALKOO RecName: Full=Methionyl-tRNA synthetase 1;       
   25::677     1e-09  31% 1042 aa  SYI_NOCFA RecName: Full=Isoleucyl-tRNA synthetase;       
   46::367     1e-09  26%  937 aa  SYI_HAES2 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::364     1e-09  30%  932 aa  SYI_DECAR RecName: Full=Isoleucyl-tRNA synthetase;       
   42::220     1e-09  28% 1002 aa  SYI_BRAJA RecName: Full=Isoleucyl-tRNA synthetase;       
   14::124     2e-09  35%  603 aa  SYM_SALTO RecName: Full=Methionyl-tRNA synthetase;       
    2::120     2e-09  31%  660 aa  SYM_METS3 RecName: Full=Methionyl-tRNA synthetase;       
   12::121     2e-09  28%  662 aa  SYM_METB6 RecName: Full=Methionyl-tRNA synthetase;       
    8::266     2e-09  28%  720 aa  SYM_BURS3 RecName: Full=Methionyl-tRNA synthetase;       
   25::635     2e-09  31%  943 aa  SYI_PSEU2 RecName: Full=Isoleucyl-tRNA synthetase;       
   25::184     2e-09  26%  943 aa  SYI_PSE14 RecName: Full=Isoleucyl-tRNA synthetase;       
   41::108     2e-09  33%  529 aa  SYI_AQUPY RecName: Full=Isoleucyl-tRNA synthetase;       
   45::589     2e-09  35%  799 aa  SYV_PYRAE RecName: Full=Valyl-tRNA synthetase;       
    3::182     2e-09  27%  665 aa  SYM_STRR6 RecName: Full=Methionyl-tRNA synthetase;       
    3::182     2e-09  27%  665 aa  SYM_STRPN RecName: Full=Methionyl-tRNA synthetase;       
    7::131     2e-09  31%  676 aa  SYM_PECCP RecName: Full=Methionyl-tRNA synthetase;       
    2::249     2e-09  27%  651 aa  SYM_METTH RecName: Full=Methionyl-tRNA synthetase;       
    4::139     2e-09  27%  697 aa  SYM_METPP RecName: Full=Methionyl-tRNA synthetase;       
   14::149     2e-09  28%  686 aa  SYM_ALCBS RecName: Full=Methionyl-tRNA synthetase;       
   31::209     2e-09  30%  993 aa  SYI_RHILO RecName: Full=Isoleucyl-tRNA synthetase;       
   25::184     2e-09  26%  943 aa  SYI_PSESM RecName: Full=Isoleucyl-tRNA synthetase;       
   58::364     2e-09  30%  937 aa  SYI_DESAD RecName: Full=Isoleucyl-tRNA synthetase;       
   24::623     2e-09  27% 1052 aa  SYI_CORDI RecName: Full=Isoleucyl-tRNA synthetase;       
   48::197     2e-09  33% 1034 aa  SYI_CLOK5 RecName: Full=Isoleucyl-tRNA synthetase;       
   26::154     2e-09  32%  925 aa  SYI_CHRVO RecName: Full=Isoleucyl-tRNA synthetase;       
   29::183     2e-09  27%  953 aa  SYI_BORA1 RecName: Full=Isoleucyl-tRNA synthetase;       
   25::184     2e-09  27%  943 aa  SYI_AZOVD RecName: Full=Isoleucyl-tRNA synthetase;       
   54::313     3e-09  30%  899 aa  SYV_HELHP RecName: Full=Valyl-tRNA synthetase;       
  104::431     3e-09  28% 1062 aa  SYVM_PIG RecName: Full=Valyl-tRNA synthetase, mitochondrial;       
    7::131     3e-09  27%  679 aa  SYM_SODGM RecName: Full=Methionyl-tRNA synthetase;       
    5::122     3e-09  29%  512 aa  SYM_MYCPN RecName: Full=Methionyl-tRNA synthetase;       
    2::120     3e-09  32%  676 aa  SYM_METST RecName: Full=Methionyl-tRNA synthetase;       
   30::195     3e-09  29% 1111 aa  SYI_WOLPM RecName: Full=Isoleucyl-tRNA synthetase;       
   66::192     3e-09  27%  959 aa  SYI_RALME RecName: Full=Isoleucyl-tRNA synthetase;       
   69::227     3e-09  29%  960 aa  SYI_GLUOX RecName: Full=Isoleucyl-tRNA synthetase;       
   57::351     3e-09  30%  926 aa  SYI_ENTFA RecName: Full=Isoleucyl-tRNA synthetase;       
   16::192     3e-09  30% 1043 aa  SYI_CHLCV RecName: Full=Isoleucyl-tRNA synthetase;       
   16::192     3e-09  30% 1043 aa  SYI_CHLAB RecName: Full=Isoleucyl-tRNA synthetase;       
   36::652     3e-09  31% 1044 aa  SYI_BORRA RecName: Full=Isoleucyl-tRNA synthetase;       
   14::131     4e-09  29%  675 aa  SYM_TOLAT RecName: Full=Methionyl-tRNA synthetase;       
    7::119     4e-09  32%  593 aa  SYM_SACEN RecName: Full=Methionyl-tRNA synthetase;       
   14::223     4e-09  27%  669 aa  SYM_METTP RecName: Full=Methionyl-tRNA synthetase;       
    7::131     4e-09  31%  677 aa  SYM_ENTS8 RecName: Full=Methionyl-tRNA synthetase;       
   10::134     4e-09  28%  681 aa  SYM_DEIRA RecName: Full=Methionyl-tRNA synthetase;       
   12::122     4e-09  34%  612 aa  SYM_CORK4 RecName: Full=Methionyl-tRNA synthetase;       
   11::128     4e-09  32%  621 aa  SYM_BIFLI RecName: Full=Methionyl-tRNA synthetase;       
   20::196     4e-09  28% 1081 aa  SYI_TETTH RecName: Full=Isoleucyl-tRNA synthetase;       
   17::98      4e-09  34% 1086 aa  SYI_RICPR RecName: Full=Isoleucyl-tRNA synthetase;       
   17::196     4e-09  30% 1094 aa  SYI_RICFE RecName: Full=Isoleucyl-tRNA synthetase;       
   66::192     4e-09  30%  959 aa  SYI_RALPJ RecName: Full=Isoleucyl-tRNA synthetase;       
   58::360     4e-09  27%  936 aa  SYI_PROMH RecName: Full=Isoleucyl-tRNA synthetase;       
   11::92      4e-09  32% 1110 aa  SYI_CYTH3 RecName: Full=Isoleucyl-tRNA synthetase;       
   38::192     4e-09  26%  945 aa  SYI_BURXL RecName: Full=Isoleucyl-tRNA synthetase;       
   38::192     4e-09  26%  945 aa  SYI_BURPP RecName: Full=Isoleucyl-tRNA synthetase;       
   54::192     4e-09  27%  945 aa  SYI_BURP8 RecName: Full=Isoleucyl-tRNA synthetase;       
   35::672     4e-09  33%  972 aa  SYI_BRUME RecName: Full=Isoleucyl-tRNA synthetase;       
   35::672     4e-09  33%  972 aa  SYI_BRUAB RecName: Full=Isoleucyl-tRNA synthetase;       
   35::672     4e-09  33%  972 aa  SYI_BRUA2 RecName: Full=Isoleucyl-tRNA synthetase;       
   36::652     4e-09  33% 1044 aa  SYI_BORHD RecName: Full=Isoleucyl-tRNA synthetase;       
   32::199     4e-09  31% 1056 aa  SYI_BDEBA RecName: Full=Isoleucyl-tRNA synthetase;       
    4::145     5e-09  26%  565 aa  SYM_THEPD RecName: Full=Methionyl-tRNA synthetase;       
    2::181     5e-09  28%  665 aa  SYM_STRP1 RecName: Full=Methionyl-tRNA synthetase;       
   21::138     5e-09  29%  601 aa  SYM_PROAC RecName: Full=Methionyl-tRNA synthetase;       
    4::345     5e-09  30%  537 aa  SYM_MYCLE RecName: Full=Methionyl-tRNA synthetase;       
    2::248     5e-09  28%  559 aa  SYM_KORCO RecName: Full=Methionyl-tRNA synthetase;       
   12::121     5e-09  31%  600 aa  SYM_CHLAD RecName: Full=Methionyl-tRNA synthetase;       
   39::196     5e-09  30% 1092 aa  SYI_RICPU RecName: Full=Isoleucyl-tRNA synthetase;       
   39::196     5e-09  30% 1092 aa  SYI_RICCN RecName: Full=Isoleucyl-tRNA synthetase;       
   24::695     5e-09  32% 1059 aa  SYI_MYCLE RecName: Full=Isoleucyl-tRNA synthetase;       
   84::698     5e-09  35% 1119 aa  SYI_LEIXX RecName: Full=Isoleucyl-tRNA synthetase;       
   46::367     5e-09  25%  937 aa  SYI_HAES1 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::655     5e-09  34% 1054 aa  SYI_CORGL RecName: Full=Isoleucyl-tRNA synthetase;       
   70::215     5e-09  32%  969 aa  SYI_CAUCR RecName: Full=Isoleucyl-tRNA synthetase;       
   54::192     5e-09  29%  945 aa  SYI_BURVG RecName: Full=Isoleucyl-tRNA synthetase;       
   54::192     5e-09  29%  945 aa  SYI_BURCM RecName: Full=Isoleucyl-tRNA synthetase;       
   54::192     5e-09  29%  945 aa  SYI_BURCC RecName: Full=Isoleucyl-tRNA synthetase;       
   54::192     5e-09  29%  945 aa  SYI_BURA4 RecName: Full=Isoleucyl-tRNA synthetase;       
   35::672     5e-09  35%  972 aa  SYI_BRUSU RecName: Full=Isoleucyl-tRNA synthetase;       
   36::652     5e-09  32% 1044 aa  SYI_BORT9 RecName: Full=Isoleucyl-tRNA synthetase;       
   36::194     5e-09  31% 1042 aa  SYI_BORAP RecName: Full=Isoleucyl-tRNA synthetase;       
   47::614     5e-09  34% 1033 aa  SYI2_BACAN RecName: Full=Isoleucyl-tRNA synthetase 2;       
   10::118     7e-09  38%  545 aa  SYM_STRPS RecName: Full=Methionyl-tRNA synthetase;       
   10::118     7e-09  38%  545 aa  SYM_STRP7 RecName: Full=Methionyl-tRNA synthetase;       
   12::122     7e-09  35%  610 aa  SYM_CORGL RecName: Full=Methionyl-tRNA synthetase;       
   12::122     7e-09  35%  610 aa  SYM_CORGB RecName: Full=Methionyl-tRNA synthetase;       
   14::228     7e-09  28%  703 aa  SYM_CHLTE RecName: Full=Methionyl-tRNA synthetase;       
   12::121     7e-09  31%  600 aa  SYM_CHLSY RecName: Full=Methionyl-tRNA synthetase;       
   12::121     7e-09  31%  600 aa  SYM_CHLAA RecName: Full=Methionyl-tRNA synthetase;       
   12::143     7e-09  29%  680 aa  SYM_BACV8 RecName: Full=Methionyl-tRNA synthetase;       
   63::628     7e-09  34% 1056 aa  SYI_TROWT RecName: Full=Isoleucyl-tRNA synthetase;       
   63::628     7e-09  34% 1056 aa  SYI_TROW8 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::196     7e-09  30% 1103 aa  SYI_RICAH RecName: Full=Isoleucyl-tRNA synthetase;       
   54::192     7e-09  29%  945 aa  SYI_BURM1 RecName: Full=Isoleucyl-tRNA synthetase;       
   38::192     7e-09  28%  945 aa  SYI_BURCH RecName: Full=Isoleucyl-tRNA synthetase;       
   38::192     7e-09  28%  945 aa  SYI_BURCA RecName: Full=Isoleucyl-tRNA synthetase;       
   31::183     7e-09  26%  953 aa  SYI_BORPE RecName: Full=Isoleucyl-tRNA synthetase;       
   31::183     7e-09  26%  953 aa  SYI_BORPA RecName: Full=Isoleucyl-tRNA synthetase;       
   36::194     7e-09  26% 1042 aa  SYI_BORGA RecName: Full=Isoleucyl-tRNA synthetase;       
   36::813     7e-09  27% 1042 aa  SYI_BORBZ RecName: Full=Isoleucyl-tRNA synthetase;       
   36::813     7e-09  27% 1042 aa  SYI_BORBU RecName: Full=Isoleucyl-tRNA synthetase;       
   31::183     7e-09  26%  953 aa  SYI_BORBR RecName: Full=Isoleucyl-tRNA synthetase;       
    3::237     9e-09  26%  672 aa  SYM_META3 RecName: Full=Methionyl-tRNA synthetase;       
    4::148     9e-09  26%  689 aa  SYM_LEPCP RecName: Full=Methionyl-tRNA synthetase;       
   13::142     9e-09  29%  702 aa  SYM_CHLL2 RecName: Full=Methionyl-tRNA synthetase;       
    6::139     9e-09  26%  692 aa  SYM_BORPE RecName: Full=Methionyl-tRNA synthetase;       
    6::139     9e-09  26%  692 aa  SYM_BORPA RecName: Full=Methionyl-tRNA synthetase;       
    6::139     9e-09  26%  692 aa  SYM_BORBR RecName: Full=Methionyl-tRNA synthetase;       
   29::102     9e-09  30%  939 aa  SYI_METCA RecName: Full=Isoleucyl-tRNA synthetase;       
   52::193     9e-09  32%  915 aa  SYI_LEPBP RecName: Full=Isoleucyl-tRNA synthetase;       
   52::193     9e-09  32%  915 aa  SYI_LEPBA RecName: Full=Isoleucyl-tRNA synthetase;       
   56::192     9e-09  28%  945 aa  SYI_BURS3 RecName: Full=Isoleucyl-tRNA synthetase;       
   31::209     9e-09  28%  967 aa  SYI_AGRT5 RecName: Full=Isoleucyl-tRNA synthetase;       
   12::124     1e-08  35%  547 aa  SYM_THEAC RecName: Full=Methionyl-tRNA synthetase;       
   19::171     1e-08  26%  508 aa  SYM_RICCN RecName: Full=Methionyl-tRNA synthetase;       
    5::142     1e-08  26%  700 aa  SYM_PELPB RecName: Full=Methionyl-tRNA synthetase;       
   10::150     1e-08  27%  701 aa  SYM_NITEC RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  30%  676 aa  SYM_ERWCT RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECO5E RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECO57 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECO27 RecName: Full=Methionyl-tRNA synthetase;       
   11::121     1e-08  32%  614 aa  SYM_BEUC1 RecName: Full=Methionyl-tRNA synthetase;       
   58::238     1e-08  26%  622 aa  SYMM_NEUCR RecName: Full=Probable methionyl-tRNA synthetase,
    8::138     1e-08  29%  690 aa  SYM1_SORC5 RecName: Full=Methionyl-tRNA synthetase 1;       
   31::363     1e-08  30%  937 aa  SYI_THISH RecName: Full=Isoleucyl-tRNA synthetase;       
   32::370     1e-08  25%  938 aa  SYI_MANSM RecName: Full=Isoleucyl-tRNA synthetase;       
   33::359     1e-08  32%  933 aa  SYI_FUSNN RecName: Full=Isoleucyl-tRNA synthetase;       
   40::192     1e-08  27%  945 aa  SYI_BURTA RecName: Full=Isoleucyl-tRNA synthetase;       
   56::192     1e-08  28%  945 aa  SYI_BURCJ RecName: Full=Isoleucyl-tRNA synthetase;       
   36::652     1e-08  31% 1044 aa  SYI_BORDL RecName: Full=Isoleucyl-tRNA synthetase;       
   38::192     1e-08  27%  945 aa  SYI1_BURPS RecName: Full=Isoleucyl-tRNA synthetase 1;       
   38::192     1e-08  27%  945 aa  SYI1_BURMA RecName: Full=Isoleucyl-tRNA synthetase 1;       
   12::123     1e-08  36%  543 aa  SYM_THEVO RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SHISS RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SHIFL RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SHIF8 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SHIBS RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SHIB3 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  675 aa  SYM_SERP5 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALTY RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALTI RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALSV RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALPK RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALPC RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALPB RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALPA RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALNS RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALHS RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALG2 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALEP RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALDC RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALCH RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALAR RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_SALA4 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_KLEP7 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_KLEP3 RecName: Full=Methionyl-tRNA synthetase;       
   18::74      1e-08  42%  689 aa  SYM_HALSA RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ESCF3 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ENT38 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECOUT RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECOSM RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECOSE RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECOLU RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECOLI RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECOLC RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECOL6 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECOL5 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECOK1 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECOHS RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECODH RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECOBW RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECO8A RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECO81 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECO7I RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECO55 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECO45 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_ECO24 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-08  29%  677 aa  SYM_CITK8 RecName: Full=Methionyl-tRNA synthetase;       
    2::108     1e-08  29%  678 aa  SYM_ACIF5 RecName: Full=Methionyl-tRNA synthetase;       
    2::108     1e-08  29%  678 aa  SYM_ACIF2 RecName: Full=Methionyl-tRNA synthetase;       
    5::129     1e-08  27%  706 aa  SYM_ACIAC RecName: Full=Methionyl-tRNA synthetase;       
   11::96      1e-08  31% 1058 aa  SYLC_DICDI RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;    
   30::361     1e-08  23%  938 aa  SYI_YERE8 RecName: Full=Isoleucyl-tRNA synthetase;       
   26::645     1e-08  30%  943 aa  SYI_XYLFT RecName: Full=Isoleucyl-tRNA synthetase;       
   26::645     1e-08  30%  943 aa  SYI_XYLFA RecName: Full=Isoleucyl-tRNA synthetase;       
   26::645     1e-08  30%  943 aa  SYI_XYLF2 RecName: Full=Isoleucyl-tRNA synthetase;       
   17::196     1e-08  32% 1086 aa  SYI_RICTY RecName: Full=Isoleucyl-tRNA synthetase;       
   53::196     1e-08  31% 1108 aa  SYI_RICB8 RecName: Full=Isoleucyl-tRNA synthetase;       
   53::196     1e-08  30% 1092 aa  SYI_RICAE RecName: Full=Isoleucyl-tRNA synthetase;       
   54::193     1e-08  35%  914 aa  SYI_LEPBL RecName: Full=Isoleucyl-tRNA synthetase;       
   54::193     1e-08  35%  914 aa  SYI_LEPBJ RecName: Full=Isoleucyl-tRNA synthetase;       
   32::184     1e-08  27%  932 aa  SYI_AZOSB RecName: Full=Isoleucyl-tRNA synthetase;       
    9::664     1e-08  32% 1064 aa  SYIC_SCHPO RecName: Full=Isoleucyl-tRNA synthetase, cytoplasmic;   
   14::131     2e-08  30%  677 aa  SYM_SHIDS RecName: Full=Methionyl-tRNA synthetase;       
   19::171     2e-08  23%  509 aa  SYM_RICBR RecName: Full=Methionyl-tRNA synthetase;       
    2::140     2e-08  27%  570 aa  SYM_PYRCJ RecName: Full=Methionyl-tRNA synthetase;       
    2::140     2e-08  28%  570 aa  SYM_PYRAR RecName: Full=Methionyl-tRNA synthetase;       
    4::142     2e-08  26%  686 aa  SYM_PSYIN RecName: Full=Methionyl-tRNA synthetase;       
    5::100     2e-08  34%  707 aa  SYM_POLNA RecName: Full=Methionyl-tRNA synthetase;       
   11::115     2e-08  31%  690 aa  SYM_PICTO RecName: Full=Methionyl-tRNA synthetase;       
   12::221     2e-08  26%  664 aa  SYM_METMJ RecName: Full=Methionyl-tRNA synthetase;       
    6::142     2e-08  26%  547 aa  SYM_BAUCH RecName: Full=Methionyl-tRNA synthetase;       
   26::645     2e-08  30%  943 aa  SYI_XYLFM RecName: Full=Isoleucyl-tRNA synthetase;       
   53::196     2e-08  29% 1079 aa  SYI_RICCK RecName: Full=Isoleucyl-tRNA synthetase;       
   30::184     2e-08  27%  943 aa  SYI_PSEF5 RecName: Full=Isoleucyl-tRNA synthetase;       
   26::621     2e-08  31%  897 aa  SYI_MYCS5 RecName: Full=Isoleucyl-tRNA synthetase;       
   59::197     2e-08  28%  958 aa  SYI_JANMA RecName: Full=Isoleucyl-tRNA synthetase;       
   25::361     2e-08  24%  948 aa  SYI_EDWI9 RecName: Full=Isoleucyl-tRNA synthetase;       
   48::361     2e-08  24%  939 aa  SYI_BUCBP RecName: Full=Isoleucyl-tRNA synthetase;       
   24::183     2e-08  26%  953 aa  SYI_BORPD RecName: Full=Isoleucyl-tRNA synthetase;       
   30::184     2e-08  26%  943 aa  SYI1_PSEFL RecName: Full=Isoleucyl-tRNA synthetase 1;       
   13::130     3e-08  30%  702 aa  SYM_PROVI RecName: Full=Methionyl-tRNA synthetase;       
    6::124     3e-08  31%  675 aa  SYM_PROMH RecName: Full=Methionyl-tRNA synthetase;       
    9::129     3e-08  29%  674 aa  SYM_NITOC RecName: Full=Methionyl-tRNA synthetase;       
   11::122     3e-08  30%  600 aa  SYM_KINRD RecName: Full=Methionyl-tRNA synthetase;       
   15::125     3e-08  32%  613 aa  SYM_COREF RecName: Full=Methionyl-tRNA synthetase;       
   30::184     3e-08  26%  943 aa  SYI_PSEFS RecName: Full=Isoleucyl-tRNA synthetase;       
   25::366     3e-08  30%  940 aa  SYI_NITOC RecName: Full=Isoleucyl-tRNA synthetase;       
   11::86      3e-08  37%  595 aa  SYM_NOCSJ RecName: Full=Methionyl-tRNA synthetase;       
    4::139     3e-08  28%  685 aa  SYM_NEIMA RecName: Full=Methionyl-tRNA synthetase;       
    4::139     3e-08  28%  685 aa  SYM_NEIM0 RecName: Full=Methionyl-tRNA synthetase;       
   18::80      3e-08  40%  717 aa  SYM_HALMA RecName: Full=Methionyl-tRNA synthetase;       
   12::122     3e-08  33%  610 aa  SYM_CORDI RecName: Full=Methionyl-tRNA synthetase;       
   66::192     3e-08  26%  963 aa  SYI_RALEJ RecName: Full=Isoleucyl-tRNA synthetase;       
    2::140     4e-08  30%  565 aa  SYM_THENV RecName: Full=Methionyl-tRNA synthetase;       
    7::133     4e-08  28%  684 aa  SYM_METBU RecName: Full=Methionyl-tRNA synthetase;       
    7::144     4e-08  28%  686 aa  SYM_FLAPJ RecName: Full=Methionyl-tRNA synthetase;       
    2::113     4e-08  30%  558 aa  SYM1_ACAM1 RecName: Full=Methionyl-tRNA synthetase 1;       
   53::196     4e-08  31% 1108 aa  SYI_RICBR RecName: Full=Isoleucyl-tRNA synthetase;       
   66::192     4e-08  26%  964 aa  SYI_RALEH RecName: Full=Isoleucyl-tRNA synthetase;       
   57::632     4e-08  30%  918 aa  SYI_NITSB RecName: Full=Isoleucyl-tRNA synthetase;       
   58::200     4e-08  32%  937 aa  SYI_LAWIP RecName: Full=Isoleucyl-tRNA synthetase;       
   32::200     4e-08  26%  935 aa  SYI_FRATW RecName: Full=Isoleucyl-tRNA synthetase;       
   32::200     4e-08  26%  935 aa  SYI_FRATT RecName: Full=Isoleucyl-tRNA synthetase;       
   32::200     4e-08  26%  935 aa  SYI_FRATO RecName: Full=Isoleucyl-tRNA synthetase;       
   32::200     4e-08  26%  935 aa  SYI_FRATN RecName: Full=Isoleucyl-tRNA synthetase;       
   32::200     4e-08  26%  935 aa  SYI_FRATM RecName: Full=Isoleucyl-tRNA synthetase;       
   32::200     4e-08  26%  935 aa  SYI_FRATH RecName: Full=Isoleucyl-tRNA synthetase;       
   32::200     4e-08  26%  935 aa  SYI_FRATF RecName: Full=Isoleucyl-tRNA synthetase;       
   32::200     4e-08  26%  935 aa  SYI_FRAT1 RecName: Full=Isoleucyl-tRNA synthetase;       
    7::131     6e-08  29%  689 aa  SYM_SHEB9 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     6e-08  29%  689 aa  SYM_SHEB8 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     6e-08  29%  689 aa  SYM_SHEB5 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     6e-08  29%  689 aa  SYM_SHEB2 RecName: Full=Methionyl-tRNA synthetase;       
    4::139     6e-08  28%  685 aa  SYM_NEIMB RecName: Full=Methionyl-tRNA synthetase;       
    4::139     6e-08  28%  684 aa  SYM_NEIG1 RecName: Full=Methionyl-tRNA synthetase;       
    4::174     6e-08  22%  519 aa  SYM_MYCBO RecName: Full=Methionyl-tRNA synthetase;       
    2::119     6e-08  31%  663 aa  SYM_METM5 RecName: Full=Methionyl-tRNA synthetase;       
    3::118     6e-08  29%  668 aa  SYM_METKA RecName: Full=Methionyl-tRNA synthetase;       
    2::119     6e-08  28%  651 aa  SYM_METJA RecName: Full=Methionyl-tRNA synthetase;       
   13::265     6e-08  29%  700 aa  SYM_CHLT3 RecName: Full=Methionyl-tRNA synthetase;       
   17::201     6e-08  29% 1047 aa  SYI_STRCO RecName: Full=Isoleucyl-tRNA synthetase;       
   62::200     6e-08  28%  959 aa  SYI_HERAR RecName: Full=Isoleucyl-tRNA synthetase;       
   69::195     6e-08  26%  966 aa  SYI_CUPTR RecName: Full=Isoleucyl-tRNA synthetase;       
   50::196     6e-08  30% 1162 aa  SYI_BACTN RecName: Full=Isoleucyl-tRNA synthetase;       
    7::142     7e-08  27%  686 aa  SYM_VIBFM RecName: Full=Methionyl-tRNA synthetase;       
    7::142     7e-08  27%  686 aa  SYM_VIBF1 RecName: Full=Methionyl-tRNA synthetase;       
    2::140     7e-08  28%  567 aa  SYM_PYRIL RecName: Full=Methionyl-tRNA synthetase;       
    3::150     7e-08  26%  678 aa  SYM_PSEMY RecName: Full=Methionyl-tRNA synthetase;       
    7::222     7e-08  25%  675 aa  SYM_PHOLL RecName: Full=Methionyl-tRNA synthetase;       
   10::140     7e-08  26%  706 aa  SYM_NITEU RecName: Full=Methionyl-tRNA synthetase;       
    2::119     7e-08  31%  663 aa  SYM_METM7 RecName: Full=Methionyl-tRNA synthetase;       
    3::362     7e-08  31%  662 aa  SYM_LACLA RecName: Full=Methionyl-tRNA synthetase;       
   69::215     7e-08  26%  941 aa  SYI_ZYMMO RecName: Full=Isoleucyl-tRNA synthetase;       
   47::368     7e-08  26%  941 aa  SYI_HAEI8 RecName: Full=Isoleucyl-tRNA synthetase;       
   29::675     7e-08  28% 1120 aa  SYI_EHRCJ RecName: Full=Isoleucyl-tRNA synthetase;       
   24::655     7e-08  34% 1054 aa  SYI_COREF RecName: Full=Isoleucyl-tRNA synthetase;       
   41::375     7e-08  24%  938 aa  SYI_ACTP7 RecName: Full=Isoleucyl-tRNA synthetase;       
   14::632     7e-08  35% 1067 aa  SYIC_DICDI RecName: Full=Probable isoleucyl-tRNA synthetase,
    7::131     1e-07  28%  675 aa  SYM_YERE8 RecName: Full=Methionyl-tRNA synthetase;       
    7::142     1e-07  26%  683 aa  SYM_VIBCH RecName: Full=Methionyl-tRNA synthetase;       
    7::142     1e-07  26%  683 aa  SYM_VIBC3 RecName: Full=Methionyl-tRNA synthetase;       
    3::131     1e-07  28%  683 aa  SYM_SHEFN RecName: Full=Methionyl-tRNA synthetase;       
    4::108     1e-07  30%  685 aa  SYM_NEIMF RecName: Full=Methionyl-tRNA synthetase;       
   12::122     1e-07  34%  611 aa  SYM_CORU7 RecName: Full=Methionyl-tRNA synthetase;       
    4::148     1e-07  27%  675 aa  SYM_ALHEH RecName: Full=Methionyl-tRNA synthetase;       
   17::895     1e-07  32% 1186 aa  SYLC_CAEEL RecName: Full=Leucyl-tRNA synthetase;       
   33::188     1e-07  24%  940 aa  SYI_WIGBR RecName: Full=Isoleucyl-tRNA synthetase;       
   48::361     1e-07  25%  934 aa  SYI_TERTT RecName: Full=Isoleucyl-tRNA synthetase;       
   47::368     1e-07  26%  941 aa  SYI_HAEIN RecName: Full=Isoleucyl-tRNA synthetase;       
   47::368     1e-07  26%  941 aa  SYI_HAEIG RecName: Full=Isoleucyl-tRNA synthetase;       
   50::95      1e-07  31% 1141 aa  SYI_BACFR RecName: Full=Isoleucyl-tRNA synthetase;       
   50::95      1e-07  31% 1141 aa  SYI_BACFN RecName: Full=Isoleucyl-tRNA synthetase;       
    7::131     1e-07  28%  675 aa  SYM_YERPY RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-07  28%  675 aa  SYM_YERPS RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-07  28%  675 aa  SYM_YERPP RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-07  28%  675 aa  SYM_YERPN RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-07  28%  675 aa  SYM_YERPG RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-07  28%  675 aa  SYM_YERPE RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-07  28%  675 aa  SYM_YERPB RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-07  28%  675 aa  SYM_YERPA RecName: Full=Methionyl-tRNA synthetase;       
    7::131     1e-07  28%  675 aa  SYM_YERP3 RecName: Full=Methionyl-tRNA synthetase;       
   12::147     1e-07  27%  688 aa  SYM_VIBPA RecName: Full=Methionyl-tRNA synthetase;       
    7::142     1e-07  27%  686 aa  SYM_VIBHB RecName: Full=Methionyl-tRNA synthetase;       
    6::116     1e-07  28%  691 aa  SYM_VEREI RecName: Full=Methionyl-tRNA synthetase;       
    3::334     1e-07  34%  521 aa  SYM_UREPA RecName: Full=Methionyl-tRNA synthetase;       
    3::140     1e-07  25%  728 aa  SYM_NITMU RecName: Full=Methionyl-tRNA synthetase;       
   36::132     1e-07  32% 1123 aa  SYLC_NEUCR RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
   58::365     1e-07  25%  940 aa  SYI_SHEHH RecName: Full=Isoleucyl-tRNA synthetase;       
   30::184     1e-07  26%  943 aa  SYI_PSEPF RecName: Full=Isoleucyl-tRNA synthetase;       
  365::533     1e-07  35%  628 aa  SYI_ANTLO RecName: Full=Isoleucyl-tRNA synthetase;       
   14::142     2e-07  28%  686 aa  SYM_VIBSL RecName: Full=Methionyl-tRNA synthetase;       
    7::131     2e-07  28%  679 aa  SYM_SHEHH RecName: Full=Methionyl-tRNA synthetase;       
    7::142     2e-07  25%  680 aa  SYM_PHOPR RecName: Full=Methionyl-tRNA synthetase;       
    6::142     2e-07  28%  678 aa  SYM_MARAV RecName: Full=Methionyl-tRNA synthetase;       
   35::152     2e-07  25%  741 aa  SYM_HALWD RecName: Full=Methionyl-tRNA synthetase;       
    4::141     2e-07  26%  684 aa  SYM_HAEDU RecName: Full=Methionyl-tRNA synthetase;       
    4::148     2e-07  26%  696 aa  SYM_DECAR RecName: Full=Methionyl-tRNA synthetase;       
    6::120     2e-07  26%  497 aa  SYM_AQUAE RecName: Full=Methionyl-tRNA synthetase;       
    7::142     2e-07  26%  686 aa  SYM_ALISL RecName: Full=Methionyl-tRNA synthetase;       
   48::364     2e-07  29%  929 aa  SYI_THIDA RecName: Full=Isoleucyl-tRNA synthetase;       
   25::184     2e-07  25%  943 aa  SYI_PSEMY RecName: Full=Isoleucyl-tRNA synthetase;       
   47::840     2e-07  28%  941 aa  SYI_HAEIE RecName: Full=Isoleucyl-tRNA synthetase;       
   11::139     2e-07  28%  692 aa  SYM_STRMK RecName: Full=Methionyl-tRNA synthetase;       
   11::139     2e-07  28%  693 aa  SYM_STRM5 RecName: Full=Methionyl-tRNA synthetase;       
    9::119     2e-07  31%  663 aa  SYM_METMP RecName: Full=Methionyl-tRNA synthetase;       
    2::142     2e-07  27%  550 aa  SYM_CHLTR RecName: Full=Methionyl-tRNA synthetase;       
    2::142     2e-07  27%  550 aa  SYM_CHLTA RecName: Full=Methionyl-tRNA synthetase;       
   50::196     2e-07  30% 1137 aa  SYI_PORGI RecName: Full=Isoleucyl-tRNA synthetase;       
   25::839     2e-07  27%  940 aa  SYI_MARMS RecName: Full=Isoleucyl-tRNA synthetase;       
   64::209     2e-07  27%  971 aa  SYI_BARHE RecName: Full=Isoleucyl-tRNA synthetase;       
    7::144     3e-07  28%  676 aa  SYM_SHEON RecName: Full=Methionyl-tRNA synthetase;       
    7::131     3e-07  29%  673 aa  SYM_SHELP RecName: Full=Methionyl-tRNA synthetase;       
   17::79      3e-07  38%  698 aa  SYM_NATPD RecName: Full=Methionyl-tRNA synthetase;       
   12::122     3e-07  35%  612 aa  SYM_CORJK RecName: Full=Methionyl-tRNA synthetase;       
    8::133     3e-07  27%  705 aa  SYM_CHLCH RecName: Full=Methionyl-tRNA synthetase;       
  228::359     3e-07  31%  782 aa  SYMC_SCHPO RecName: Full=Probable methionyl-tRNA synthetase,
   58::365     3e-07  25%  940 aa  SYI_SHEPA RecName: Full=Isoleucyl-tRNA synthetase;       
   64::209     3e-07  27%  971 aa  SYI_BARQU RecName: Full=Isoleucyl-tRNA synthetase;       
    7::131     4e-07  28%  679 aa  SYM_SHEPA RecName: Full=Methionyl-tRNA synthetase;       
    3::138     4e-07  28%  679 aa  SYM_PSEA7 RecName: Full=Methionyl-tRNA synthetase;       
    9::139     4e-07  27%  679 aa  SYM_HALHL RecName: Full=Methionyl-tRNA synthetase;       
    8::211     4e-07  25%  681 aa  SYM_CHRSD RecName: Full=Methionyl-tRNA synthetase;       
    6::139     4e-07  26%  691 aa  SYM_BORA1 RecName: Full=Methionyl-tRNA synthetase;       
    4::148     4e-07  26%  723 aa  SYM_AZOSB RecName: Full=Methionyl-tRNA synthetase;       
   14::131     4e-07  25%  685 aa  SYM_ACTSZ RecName: Full=Methionyl-tRNA synthetase;       
   32::184     4e-07  27%  939 aa  SYI_AZOSE RecName: Full=Isoleucyl-tRNA synthetase;       
   48::364     4e-07  35%  941 aa  SYI_ALHEH RecName: Full=Isoleucyl-tRNA synthetase;       
   23::144     4e-07  32%  494 aa  SYC_GEOUR RecName: Full=Cysteinyl-tRNA synthetase;       
   11::139     5e-07  26%  696 aa  SYM_XANCP RecName: Full=Methionyl-tRNA synthetase;       
   11::139     5e-07  26%  694 aa  SYM_XANCB RecName: Full=Methionyl-tRNA synthetase;       
   11::139     5e-07  26%  696 aa  SYM_XANC8 RecName: Full=Methionyl-tRNA synthetase;       
   10::149     5e-07  26%  688 aa  SYM_RALSO RecName: Full=Methionyl-tRNA synthetase;       
   13::142     5e-07  29%  702 aa  SYM_PELLD RecName: Full=Methionyl-tRNA synthetase;       
    4::174     5e-07  22%  519 aa  SYM_MYCTU RecName: Full=Methionyl-tRNA synthetase;       
    2::119     5e-07  31%  663 aa  SYM_METVS RecName: Full=Methionyl-tRNA synthetase;       
   14::131     5e-07  26%  686 aa  SYM_MANSM RecName: Full=Methionyl-tRNA synthetase;       
    3::124     5e-07  27%  579 aa  SYM_HYPNA RecName: Full=Methionyl-tRNA synthetase;       
   14::131     5e-07  27%  683 aa  SYM_HAES2 RecName: Full=Methionyl-tRNA synthetase;       
    4::214     5e-07  27%  551 aa  SYM_CHLPN RecName: Full=Methionyl-tRNA synthetase;       
    4::208     5e-07  26%  550 aa  SYM_CHLMU RecName: Full=Methionyl-tRNA synthetase;       
    3::150     5e-07  25%  681 aa  SYM_AZOVD RecName: Full=Methionyl-tRNA synthetase;       
    4::69      5e-07  35%  718 aa  SYM_AZOSE RecName: Full=Methionyl-tRNA synthetase;       
   28::109     5e-07  32% 1090 aa  SYLC_YEAST RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
   16::101     5e-07  28% 1176 aa  SYLC_PONAB RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
   59::352     5e-07  29%  921 aa  SYI_CAMLR RecName: Full=Isoleucyl-tRNA synthetase;       
   11::139     6e-07  26%  694 aa  SYM_XANOR RecName: Full=Methionyl-tRNA synthetase;       
   11::139     6e-07  26%  694 aa  SYM_XANOP RecName: Full=Methionyl-tRNA synthetase;       
   11::139     6e-07  26%  694 aa  SYM_XANOM RecName: Full=Methionyl-tRNA synthetase;       
    5::147     6e-07  24%  690 aa  SYM_VIBVY RecName: Full=Methionyl-tRNA synthetase;       
    5::147     6e-07  24%  690 aa  SYM_VIBVU RecName: Full=Methionyl-tRNA synthetase;       
    3::212     6e-07  23%  538 aa  SYM_STRCO RecName: Full=Methionyl-tRNA synthetase;       
    7::131     6e-07  27%  688 aa  SYM_SHEWM RecName: Full=Methionyl-tRNA synthetase;       
    7::131     6e-07  28%  692 aa  SYM_SHESH RecName: Full=Methionyl-tRNA synthetase;       
   25::367     6e-07  24%  938 aa  SYI_HAEPS RecName: Full=Isoleucyl-tRNA synthetase;       
   30::629     6e-07  28%  938 aa  SYI_BAUCH RecName: Full=Isoleucyl-tRNA synthetase;       
   22::150     8e-07  26%  702 aa  SYM_XYLFT RecName: Full=Methionyl-tRNA synthetase;       
   22::150     8e-07  26%  702 aa  SYM_XYLFM RecName: Full=Methionyl-tRNA synthetase;       
   22::150     8e-07  26%  702 aa  SYM_XYLFA RecName: Full=Methionyl-tRNA synthetase;       
   22::150     8e-07  26%  702 aa  SYM_XYLF2 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     8e-07  29%  689 aa  SYM_SHESW RecName: Full=Methionyl-tRNA synthetase;       
    7::131     8e-07  29%  676 aa  SYM_SHESR RecName: Full=Methionyl-tRNA synthetase;       
    7::131     8e-07  29%  676 aa  SYM_SHESM RecName: Full=Methionyl-tRNA synthetase;       
    7::131     8e-07  29%  676 aa  SYM_SHESA RecName: Full=Methionyl-tRNA synthetase;       
    7::131     8e-07  29%  689 aa  SYM_SHEPC RecName: Full=Methionyl-tRNA synthetase;       
    3::72      8e-07  33%  689 aa  SYM_SHEDO RecName: Full=Methionyl-tRNA synthetase;       
    3::138     8e-07  27%  677 aa  SYM_PSEAE RecName: Full=Methionyl-tRNA synthetase;       
    3::138     8e-07  27%  678 aa  SYM_PSEAB RecName: Full=Methionyl-tRNA synthetase;       
    3::138     8e-07  27%  677 aa  SYM_PSEA8 RecName: Full=Methionyl-tRNA synthetase;       
    7::131     8e-07  24%  675 aa  SYM_PSEA6 RecName: Full=Methionyl-tRNA synthetase;       
    3::138     8e-07  24%  682 aa  SYM_PSE14 RecName: Full=Methionyl-tRNA synthetase;       
   12::121     8e-07  26%  664 aa  SYM_METHJ RecName: Full=Methionyl-tRNA synthetase;       
    4::139     8e-07  24%  681 aa  SYM_HAHCH RecName: Full=Methionyl-tRNA synthetase;       
    7::94      8e-07  32%  711 aa  SYM_FLAJ1 RecName: Full=Methionyl-tRNA synthetase;       
    2::142     8e-07  27%  550 aa  SYM_CHLTB RecName: Full=Methionyl-tRNA synthetase;       
    2::142     8e-07  27%  550 aa  SYM_CHLT2 RecName: Full=Methionyl-tRNA synthetase;       
    3::140     8e-07  26%  551 aa  SYM_CHLAB RecName: Full=Methionyl-tRNA synthetase;       
   14::131     8e-07  29%  677 aa  SYM_AERHH RecName: Full=Methionyl-tRNA synthetase;       
   62::117     8e-07  38% 1111 aa  SYLC_SCHPO RecName: Full=Putative leucyl-tRNA synthetase,
   58::107     8e-07  37%  920 aa  SYI_HELPG RecName: Full=Isoleucyl-tRNA synthetase;       
    7::131     1e-06  26%  675 aa  SYM_SHEAM RecName: Full=Methionyl-tRNA synthetase;       
    4::90      1e-06  29%  700 aa  SYM_RHOFD RecName: Full=Methionyl-tRNA synthetase;       
    3::138     1e-06  25%  679 aa  SYM_PSEPG RecName: Full=Methionyl-tRNA synthetase;       
    3::138     1e-06  24%  683 aa  SYM_PSEFS RecName: Full=Methionyl-tRNA synthetase;       
   18::365     1e-06  35%  683 aa  SYM_LACPL RecName: Full=Methionyl-tRNA synthetase;       
    3::66      1e-06  31%  674 aa  SYM_FRATW RecName: Full=Methionyl-tRNA synthetase;       
    3::66      1e-06  31%  674 aa  SYM_FRATT RecName: Full=Methionyl-tRNA synthetase;       
    3::66      1e-06  31%  673 aa  SYM_FRATN RecName: Full=Methionyl-tRNA synthetase;       
    3::66      1e-06  31%  674 aa  SYM_FRATH RecName: Full=Methionyl-tRNA synthetase;       
    3::66      1e-06  31%  674 aa  SYM_FRATF RecName: Full=Methionyl-tRNA synthetase;       
    3::66      1e-06  31%  674 aa  SYM_FRAT1 RecName: Full=Methionyl-tRNA synthetase;       
   20::86      1e-06  33%  713 aa  SYM_COLP3 RecName: Full=Methionyl-tRNA synthetase;       
    2::139     1e-06  29%  572 aa  SYM_AERPE RecName: Full=Methionyl-tRNA synthetase;       
   16::101     1e-06  28% 1176 aa  SYLC_HUMAN RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
   58::365     1e-06  22%  940 aa  SYI_SHEON RecName: Full=Isoleucyl-tRNA synthetase;       
   22::150     1e-06  27%  683 aa  SYM_UNCMA RecName: Full=Methionyl-tRNA synthetase;       
    9::148     1e-06  26%  690 aa  SYM_THIDA RecName: Full=Methionyl-tRNA synthetase;       
    3::138     1e-06  24%  682 aa  SYM_PSESM RecName: Full=Methionyl-tRNA synthetase;       
    3::138     1e-06  23%  683 aa  SYM_PSEPF RecName: Full=Methionyl-tRNA synthetase;       
    3::138     1e-06  25%  681 aa  SYM_PSEF5 RecName: Full=Methionyl-tRNA synthetase;       
   14::131     1e-06  28%  682 aa  SYM_PASMU RecName: Full=Methionyl-tRNA synthetase;       
    3::66      1e-06  31%  674 aa  SYM_FRATO RecName: Full=Methionyl-tRNA synthetase;       
    3::135     1e-06  28%  685 aa  SYM_ACIAD RecName: Full=Methionyl-tRNA synthetase;       
   59::201     1e-06  25%  919 aa  SYI_CAMC5 RecName: Full=Isoleucyl-tRNA synthetase;       
   24::202     1e-06  24%  953 aa  SYI_BLOFL RecName: Full=Isoleucyl-tRNA synthetase;       
    5::137     2e-06  26%  545 aa  SYM_VESOH RecName: Full=Methionyl-tRNA synthetase;       
   10::70      2e-06  36%  686 aa  SYM_RALEH RecName: Full=Methionyl-tRNA synthetase;       
   18::81      2e-06  33%  692 aa  SYM_METFK RecName: Full=Methionyl-tRNA synthetase;       
    7::142     2e-06  24%  545 aa  SYM_HAMD5 RecName: Full=Methionyl-tRNA synthetase;       
   10::70      2e-06  36%  688 aa  SYM_CUPTR RecName: Full=Methionyl-tRNA synthetase;       
   58::365     2e-06  23%  940 aa  SYI_SHESR RecName: Full=Isoleucyl-tRNA synthetase;       
   33::363     2e-06  25%  932 aa  SYI_PASMU RecName: Full=Isoleucyl-tRNA synthetase;       
   32::367     2e-06  26%  940 aa  SYI_BUCAT RecName: Full=Isoleucyl-tRNA synthetase;       
   32::367     2e-06  26%  940 aa  SYI_BUCAI RecName: Full=Isoleucyl-tRNA synthetase;       
   32::367     2e-06  26%  940 aa  SYI_BUCA5 RecName: Full=Isoleucyl-tRNA synthetase;       
    5::129     2e-06  24%  673 aa  SYM_PSEHT RecName: Full=Methionyl-tRNA synthetase;       
   14::131     2e-06  26%  683 aa  SYM_HAES1 RecName: Full=Methionyl-tRNA synthetase;       
    4::139     2e-06  27%  682 aa  SYM_ACTPJ RecName: Full=Methionyl-tRNA synthetase;       
    4::139     2e-06  27%  682 aa  SYM_ACTP7 RecName: Full=Methionyl-tRNA synthetase;       
    4::139     2e-06  27%  679 aa  SYM_ACTP2 RecName: Full=Methionyl-tRNA synthetase;       
   32::103     2e-06  32%  944 aa  SYI_SALTY RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     2e-06  32%  944 aa  SYI_SALTI RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     2e-06  32%  944 aa  SYI_SALPK RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     2e-06  32%  944 aa  SYI_SALPA RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     2e-06  32%  944 aa  SYI_SALG2 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     2e-06  32%  944 aa  SYI_SALEP RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     2e-06  32%  944 aa  SYI_SALCH RecName: Full=Isoleucyl-tRNA synthetase;       
   25::104     2e-06  31%  943 aa  SYI_PSEAE RecName: Full=Isoleucyl-tRNA synthetase;       
   25::104     2e-06  31%  943 aa  SYI_PSEAB RecName: Full=Isoleucyl-tRNA synthetase;       
   25::104     2e-06  31%  943 aa  SYI_PSEA8 RecName: Full=Isoleucyl-tRNA synthetase;       
   25::104     2e-06  31%  943 aa  SYI_PSEA7 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::153     2e-06  30%  929 aa  SYI_NEIMF RecName: Full=Isoleucyl-tRNA synthetase;       
   25::361     2e-06  25%  935 aa  SYI_HAEDU RecName: Full=Isoleucyl-tRNA synthetase;       
   11::90      3e-06  31%  694 aa  SYM_XANC5 RecName: Full=Methionyl-tRNA synthetase;       
   11::90      3e-06  31%  694 aa  SYM_XANAC RecName: Full=Methionyl-tRNA synthetase;       
    2::105     3e-06  25%  550 aa  SYM_WIGBR RecName: Full=Methionyl-tRNA synthetase;       
    3::146     3e-06  25%  713 aa  SYM_SALRD RecName: Full=Methionyl-tRNA synthetase;       
   10::140     3e-06  26%  700 aa  SYM_PSYCK RecName: Full=Methionyl-tRNA synthetase;       
   10::140     3e-06  26%  700 aa  SYM_PSYA2 RecName: Full=Methionyl-tRNA synthetase;       
    3::138     3e-06  25%  679 aa  SYM_PSEPK RecName: Full=Methionyl-tRNA synthetase;       
    3::138     3e-06  25%  679 aa  SYM_PSEP1 RecName: Full=Methionyl-tRNA synthetase;       
    2::90      3e-06  28%  636 aa  SYM_FUSNN RecName: Full=Methionyl-tRNA synthetase;       
    3::140     3e-06  26%  550 aa  SYM_CHLCV RecName: Full=Methionyl-tRNA synthetase;       
   10::153     3e-06  27%  582 aa  SYM_CALMQ RecName: Full=Methionyl-tRNA synthetase;       
   46::153     3e-06  31%  929 aa  SYI_NEIMB RecName: Full=Isoleucyl-tRNA synthetase;       
   46::153     3e-06  31%  929 aa  SYI_NEIMA RecName: Full=Isoleucyl-tRNA synthetase;       
   46::153     3e-06  31%  929 aa  SYI_NEIM0 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::153     3e-06  31%  929 aa  SYI_NEIG2 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::153     3e-06  31%  929 aa  SYI_NEIG1 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::352     3e-06  36%  920 aa  SYI_HELPY RecName: Full=Isoleucyl-tRNA synthetase;       
   58::365     3e-06  29%  941 aa  SYI_HALHL RecName: Full=Isoleucyl-tRNA synthetase;       
   30::103     3e-06  33%  953 aa  SYI_COLP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   39::112     3e-06  32%  945 aa  SYI_ACIAD RecName: Full=Isoleucyl-tRNA synthetase;       
   10::68      4e-06  36%  690 aa  SYM_RALME RecName: Full=Methionyl-tRNA synthetase;       
   10::68      4e-06  36%  688 aa  SYM_RALEJ RecName: Full=Methionyl-tRNA synthetase;       
    9::140     4e-06  23%  776 aa  SYM_NANEQ RecName: Full=Methionyl-tRNA synthetase;       
    6::136     4e-06  25%  694 aa  SYM_METCA RecName: Full=Methionyl-tRNA synthetase;       
   58::101     4e-06  36%  920 aa  SYI_HELPS RecName: Full=Isoleucyl-tRNA synthetase;       
   58::107     4e-06  35%  920 aa  SYI_HELP2 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::362     4e-06  28%  941 aa  SYI_BUCCC RecName: Full=Isoleucyl-tRNA synthetase;       
    3::138     5e-06  24%  682 aa  SYM_PSEU2 RecName: Full=Methionyl-tRNA synthetase;       
    5::119     5e-06  31%  570 aa  SYM_JANSC RecName: Full=Methionyl-tRNA synthetase;       
   59::359     5e-06  23%  943 aa  SYI_STRM5 RecName: Full=Isoleucyl-tRNA synthetase;       
   26::185     5e-06  24%  939 aa  SYI_NITEU RecName: Full=Isoleucyl-tRNA synthetase;       
   58::352     5e-06  35%  920 aa  SYI_HELPH RecName: Full=Isoleucyl-tRNA synthetase;       
   30::104     5e-06  28%  941 aa  SYI_HAHCH RecName: Full=Isoleucyl-tRNA synthetase;       
   58::103     5e-06  37%  924 aa  SYI_DICNV RecName: Full=Isoleucyl-tRNA synthetase;       
   58::184     5e-06  26%  946 aa  SYI_CHRSD RecName: Full=Isoleucyl-tRNA synthetase;       
   59::104     5e-06  39%  918 aa  SYI_CAMC1 RecName: Full=Isoleucyl-tRNA synthetase;       
   22::144     5e-06  30%  473 aa  SYC_POLNS RecName: Full=Cysteinyl-tRNA synthetase;       
    2::173     7e-06  25%  629 aa  SYM_THEMA RecName: Full=Methionyl-tRNA synthetase;       
    3::138     7e-06  21%  679 aa  SYM_PSEU5 RecName: Full=Methionyl-tRNA synthetase;       
    3::138     7e-06  24%  681 aa  SYM_PSEPW RecName: Full=Methionyl-tRNA synthetase;       
    9::115     7e-06  24%  681 aa  SYM_LEPBP RecName: Full=Methionyl-tRNA synthetase;       
    9::115     7e-06  24%  681 aa  SYM_LEPBA RecName: Full=Methionyl-tRNA synthetase;       
    5::131     7e-06  28%  684 aa  SYM_HAEPS RecName: Full=Methionyl-tRNA synthetase;       
    6::143     7e-06  26%  689 aa  SYM_CHRVO RecName: Full=Methionyl-tRNA synthetase;       
   13::70      7e-06  37%  702 aa  SYM_CHLPD RecName: Full=Methionyl-tRNA synthetase;       
    3::115     7e-06  27%  687 aa  SYM_BDEBA RecName: Full=Methionyl-tRNA synthetase;       
   45::103     7e-06  32% 1178 aa  SYLC_MOUSE RecName: Full=Leucyl-tRNA synthetase, cytoplasmic;      
   30::103     7e-06  32%  949 aa  SYI_VIBCM RecName: Full=Isoleucyl-tRNA synthetase;       
   30::103     7e-06  32%  949 aa  SYI_VIBCH RecName: Full=Isoleucyl-tRNA synthetase;       
   30::103     7e-06  32%  949 aa  SYI_VIBC3 RecName: Full=Isoleucyl-tRNA synthetase;       
   25::156     7e-06  28%  938 aa  SYI_SERP5 RecName: Full=Isoleucyl-tRNA synthetase;       
   25::644     7e-06  29%  952 aa  SYI_ALISL RecName: Full=Isoleucyl-tRNA synthetase;       
   41::187     7e-06  25%  938 aa  SYI_ACTP2 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::360     7e-06  26%  967 aa  SYI2_BURMA RecName: Full=Isoleucyl-tRNA synthetase 2;       
   11::144     7e-06  28%  475 aa  SYC_METVS RecName: Full=Cysteinyl-tRNA synthetase;       
   23::142     7e-06  30%  465 aa  SYC_METS5 RecName: Full=Cysteinyl-tRNA synthetase;       
   38::225     9e-06  26%  489 aa  SYV_TRIVA RecName: Full=Valyl-tRNA synthetase;       
    3::326     9e-06  30%  628 aa  SYM_CAMJE RecName: Full=Methionyl-tRNA synthetase;       
   59::835     9e-06  27%  943 aa  SYI_XANCP RecName: Full=Isoleucyl-tRNA synthetase;       
   59::188     9e-06  25%  943 aa  SYI_XANCB RecName: Full=Isoleucyl-tRNA synthetase;       
   59::835     9e-06  27%  943 aa  SYI_XANC8 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::103     9e-06  31%  954 aa  SYI_PHOPR RecName: Full=Isoleucyl-tRNA synthetase;       
   58::101     9e-06  36%  920 aa  SYI_HELPJ RecName: Full=Isoleucyl-tRNA synthetase;       
   58::352     9e-06  37%  921 aa  SYI_HELAH RecName: Full=Isoleucyl-tRNA synthetase;       
    3::138     1e-05  24%  679 aa  SYM_PSEE4 RecName: Full=Methionyl-tRNA synthetase;       
    3::140     1e-05  25%  551 aa  SYM_CHLFF RecName: Full=Methionyl-tRNA synthetase;       
   59::188     1e-05  25%  943 aa  SYI_XANC5 RecName: Full=Isoleucyl-tRNA synthetase;       
   59::188     1e-05  25%  943 aa  SYI_XANAC RecName: Full=Isoleucyl-tRNA synthetase;       
   59::359     1e-05  22%  943 aa  SYI_STRMK RecName: Full=Isoleucyl-tRNA synthetase;       
   30::200     1e-05  23%  937 aa  SYI_PECCP RecName: Full=Isoleucyl-tRNA synthetase;       
   25::156     1e-05  27%  938 aa  SYI_ERWT9 RecName: Full=Isoleucyl-tRNA synthetase;       
   30::200     1e-05  23%  937 aa  SYI_ERWCT RecName: Full=Isoleucyl-tRNA synthetase;       
    8::91      2e-05  33%  572 aa  SYM_MARMM RecName: Full=Methionyl-tRNA synthetase;       
   59::188     2e-05  25%  943 aa  SYI_XANOR RecName: Full=Isoleucyl-tRNA synthetase;       
   59::188     2e-05  25%  943 aa  SYI_XANOM RecName: Full=Isoleucyl-tRNA synthetase;       
   32::161     2e-05  28%  931 aa  SYI_LEGPL RecName: Full=Isoleucyl-tRNA synthetase;       
   32::161     2e-05  28%  931 aa  SYI_LEGPH RecName: Full=Isoleucyl-tRNA synthetase;       
   32::161     2e-05  28%  931 aa  SYI_LEGPC RecName: Full=Isoleucyl-tRNA synthetase;       
   32::161     2e-05  28%  931 aa  SYI_LEGPA RecName: Full=Isoleucyl-tRNA synthetase;       
   32::200     2e-05  25%  935 aa  SYI_FRAP2 RecName: Full=Isoleucyl-tRNA synthetase;       
    1::515     2e-05  31% 1024 aa  SYI2_STAAU RecName: Full=Isoleucyl-tRNA synthetase;       
    8::66      2e-05  31%  686 aa  SYM_MAGSM RecName: Full=Methionyl-tRNA synthetase;       
   58::200     2e-05  26%  940 aa  SYI_SHESH RecName: Full=Isoleucyl-tRNA synthetase;       
   31::103     2e-05  33%  957 aa  SYI_LARHH RecName: Full=Isoleucyl-tRNA synthetase;       
  264::320     2e-05  40%  466 aa  SYC_CLOPS RecName: Full=Cysteinyl-tRNA synthetase;       
  264::320     2e-05  40%  466 aa  SYC_CLOPE RecName: Full=Cysteinyl-tRNA synthetase;       
  264::320     2e-05  40%  466 aa  SYC_CLOP1 RecName: Full=Cysteinyl-tRNA synthetase;       
   36::88      3e-05  36%  881 aa  SYV_WIGBR RecName: Full=Valyl-tRNA synthetase;       
    5::346     3e-05  29%  529 aa  SYM_THEEB RecName: Full=Methionyl-tRNA synthetase;       
    5::135     3e-05  24%  550 aa  SYM_RUTMC RecName: Full=Methionyl-tRNA synthetase;       
   22::156     3e-05  26%  801 aa  SYM_ORYSJ RecName: Full=Probable methionyl-tRNA synthetase;        
   30::361     3e-05  27%  938 aa  SYI_YERPY RecName: Full=Isoleucyl-tRNA synthetase;       
   30::361     3e-05  27%  938 aa  SYI_YERPS RecName: Full=Isoleucyl-tRNA synthetase;       
   30::361     3e-05  27%  938 aa  SYI_YERPP RecName: Full=Isoleucyl-tRNA synthetase;       
   30::361     3e-05  27%  938 aa  SYI_YERPN RecName: Full=Isoleucyl-tRNA synthetase;       
   30::361     3e-05  27%  938 aa  SYI_YERPG RecName: Full=Isoleucyl-tRNA synthetase;       
   30::361     3e-05  27%  938 aa  SYI_YERPE RecName: Full=Isoleucyl-tRNA synthetase;       
   30::361     3e-05  27%  938 aa  SYI_YERPB RecName: Full=Isoleucyl-tRNA synthetase;       
   30::361     3e-05  27%  938 aa  SYI_YERPA RecName: Full=Isoleucyl-tRNA synthetase;       
   30::361     3e-05  27%  938 aa  SYI_YERP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::367     3e-05  32%  948 aa  SYI_VIBVY RecName: Full=Isoleucyl-tRNA synthetase;       
   46::367     3e-05  32%  948 aa  SYI_VIBVU RecName: Full=Isoleucyl-tRNA synthetase;       
   46::103     3e-05  31%  952 aa  SYI_VIBFM RecName: Full=Isoleucyl-tRNA synthetase;       
   46::103     3e-05  31%  952 aa  SYI_VIBF1 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::156     3e-05  28%  938 aa  SYI_KLEP3 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::360     3e-05  26%  967 aa  SYI2_BURPS RecName: Full=Isoleucyl-tRNA synthetase 2;       
   22::144     3e-05  30%  473 aa  SYC_POLSQ RecName: Full=Cysteinyl-tRNA synthetase;       
   10::114     3e-05  29%  811 aa  SYM_TREPA RecName: Full=Methionyl-tRNA synthetase;       
    8::65      3e-05  44%  574 aa  SYM_STRAW RecName: Full=Methionyl-tRNA synthetase;       
    5::142     3e-05  23%  673 aa  SYM_DICNV RecName: Full=Methionyl-tRNA synthetase;       
  146::261     3e-05  36%  751 aa  SYMC_YEAST RecName: Full=Methionyl-tRNA synthetase, cytoplasmic;   
   46::103     3e-05  31%  952 aa  SYI_VIBSL RecName: Full=Isoleucyl-tRNA synthetase;       
   46::634     3e-05  30%  942 aa  SYI_VIBPA RecName: Full=Isoleucyl-tRNA synthetase;       
   46::634     3e-05  31%  942 aa  SYI_VIBHB RecName: Full=Isoleucyl-tRNA synthetase;       
   58::103     3e-05  35%  940 aa  SYI_SHESW RecName: Full=Isoleucyl-tRNA synthetase;       
   58::103     3e-05  35%  940 aa  SYI_SHESM RecName: Full=Isoleucyl-tRNA synthetase;       
   58::103     3e-05  35%  940 aa  SYI_SHESA RecName: Full=Isoleucyl-tRNA synthetase;       
   58::103     3e-05  35%  940 aa  SYI_SHEPC RecName: Full=Isoleucyl-tRNA synthetase;       
   58::103     3e-05  35%  940 aa  SYI_SHEB5 RecName: Full=Isoleucyl-tRNA synthetase;       
  491::697     3e-05  34% 1114 aa  SYI_PROAC RecName: Full=Isoleucyl-tRNA synthetase;       
   25::103     3e-05  31%  937 aa  SYI_ALCBS RecName: Full=Isoleucyl-tRNA synthetase;       
   23::248     3e-05  26%  481 aa  SYC_PELCD RecName: Full=Cysteinyl-tRNA synthetase;       
    5::166     5e-05  22%  618 aa  SYM_THET8 RecName: Full=Methionyl-tRNA synthetase;       
    7::70      5e-05  31%  682 aa  SYM_HAEIN RecName: Full=Methionyl-tRNA synthetase;       
    7::70      5e-05  31%  682 aa  SYM_HAEIG RecName: Full=Methionyl-tRNA synthetase;       
    7::70      5e-05  31%  682 aa  SYM_HAEIE RecName: Full=Methionyl-tRNA synthetase;       
    7::70      5e-05  31%  682 aa  SYM_HAEI8 RecName: Full=Methionyl-tRNA synthetase;       
    7::137     5e-05  27%  547 aa  SYM_BUCAT RecName: Full=Methionyl-tRNA synthetase;       
    7::137     5e-05  27%  547 aa  SYM_BUCAI RecName: Full=Methionyl-tRNA synthetase;       
    7::137     5e-05  27%  547 aa  SYM_BUCA5 RecName: Full=Methionyl-tRNA synthetase;       
   58::370     5e-05  32%  940 aa  SYI_SHEWM RecName: Full=Isoleucyl-tRNA synthetase;       
   58::103     5e-05  29%  940 aa  SYI_SHELP RecName: Full=Isoleucyl-tRNA synthetase;       
   58::103     5e-05  35%  940 aa  SYI_SHEB9 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::103     5e-05  35%  940 aa  SYI_SHEB8 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::103     5e-05  35%  940 aa  SYI_SHEB2 RecName: Full=Isoleucyl-tRNA synthetase;       
   25::145     5e-05  29%  463 aa  SYC_POLNA RecName: Full=Cysteinyl-tRNA synthetase;       
   27::142     5e-05  29%  485 aa  SYC_GEOMG RecName: Full=Cysteinyl-tRNA synthetase;       
   13::150     6e-05  26%  698 aa  SYM_PARUW RecName: Full=Methionyl-tRNA synthetase;       
    5::325     6e-05  31%  512 aa  SYM_MYCGE RecName: Full=Methionyl-tRNA synthetase;       
   14::139     6e-05  25%  715 aa  SYM_LEPIN RecName: Full=Methionyl-tRNA synthetase;       
   14::139     6e-05  25%  715 aa  SYM_LEPIC RecName: Full=Methionyl-tRNA synthetase;       
    7::70      6e-05  30%  677 aa  SYM_IDILO RecName: Full=Methionyl-tRNA synthetase;       
    2::139     6e-05  28%  729 aa  SYM_BORHD RecName: Full=Methionyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_SHISS RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_SHIFL RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_SHIDS RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_SHIBS RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_SHIB3 RecName: Full=Isoleucyl-tRNA synthetase;       
   46::370     6e-05  31%  940 aa  SYI_SHEPW RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ESCF3 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECOSM RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECOSE RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECOLU RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECOLI RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECOLC RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECOHS RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECODH RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECOBW RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECO8A RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECO7I RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  32%  938 aa  SYI_ECO5E RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  32%  938 aa  SYI_ECO57 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECO55 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::351     6e-05  33%  938 aa  SYI_ECO24 RecName: Full=Isoleucyl-tRNA synthetase;       
   20::140     6e-05  30%  492 aa  SYC_PROM5 RecName: Full=Cysteinyl-tRNA synthetase;       
  131::179     8e-05  43%  562 aa  SYR_XANOR RecName: Full=Arginyl-tRNA synthetase;       
  131::179     8e-05  43%  562 aa  SYR_XANOP RecName: Full=Arginyl-tRNA synthetase;       
  131::179     8e-05  43%  562 aa  SYR_XANOM RecName: Full=Arginyl-tRNA synthetase;       
  131::179     8e-05  43%  562 aa  SYR_XANCP RecName: Full=Arginyl-tRNA synthetase;       
  131::179     8e-05  43%  562 aa  SYR_XANCB RecName: Full=Arginyl-tRNA synthetase;       
  131::179     8e-05  43%  562 aa  SYR_XANC8 RecName: Full=Arginyl-tRNA synthetase;       
  131::179     8e-05  43%  562 aa  SYR_XANC5 RecName: Full=Arginyl-tRNA synthetase;       
  131::179     8e-05  43%  562 aa  SYR_XANAC RecName: Full=Arginyl-tRNA synthetase;       
  131::189     8e-05  43%  562 aa  SYR_STRMK RecName: Full=Arginyl-tRNA synthetase;       
    8::116     8e-05  31%  573 aa  SYM_SILST RecName: Full=Methionyl-tRNA synthetase;       
    8::90      8e-05  33%  572 aa  SYM_DINSH RecName: Full=Methionyl-tRNA synthetase;       
    8::141     8e-05  25%  569 aa  SYM_CAUSK RecName: Full=Methionyl-tRNA synthetase;       
   15::155     8e-05  21%  577 aa  SYMM_CANAL RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   35::103     8e-05  29%  942 aa  SYI_PSEA6 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     8e-05  31%  938 aa  SYI_ECOUT RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     8e-05  31%  938 aa  SYI_ECOL6 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     8e-05  31%  938 aa  SYI_ECOL5 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     8e-05  31%  938 aa  SYI_ECOK1 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     8e-05  31%  938 aa  SYI_ECO81 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     8e-05  31%  938 aa  SYI_ECO45 RecName: Full=Isoleucyl-tRNA synthetase;       
   32::103     8e-05  31%  938 aa  SYI_ECO27 RecName: Full=Isoleucyl-tRNA synthetase;       
   22::103     8e-05  27%  938 aa  SYI_BUCAP RecName: Full=Isoleucyl-tRNA synthetase;       
   58::200     8e-05  28%  953 aa  SYI_AERS4 RecName: Full=Isoleucyl-tRNA synthetase;       
   58::200     8e-05  27%  953 aa  SYI_AERHH RecName: Full=Isoleucyl-tRNA synthetase;       
   28::148     8e-05  32%  471 aa  SYC_SULTO RecName: Full=Cysteinyl-tRNA synthetase;       
    2::140     1e-04  27%  509 aa  SYM_MYCPU RecName: Full=Methionyl-tRNA synthetase;       
    8::139     1e-04  24%  569 aa  SYM_CAUCR RecName: Full=Methionyl-tRNA synthetase;       
    8::139     1e-04  24%  569 aa  SYM_CAUCN RecName: Full=Methionyl-tRNA synthetase;       
   25::156     1e-04  26%  938 aa  SYI_SODGM RecName: Full=Isoleucyl-tRNA synthetase;       
   58::361     1e-04  31%  937 aa  SYI_PHOLL RecName: Full=Isoleucyl-tRNA synthetase;       
   15::145     1e-04  28%  493 aa  SYC_SYNSC RecName: Full=Cysteinyl-tRNA synthetase;       
  124::153     1e-04  57%  560 aa  SYR_METTH RecName: Full=Arginyl-tRNA synthetase;       
    8::64      1e-04  43%  572 aa  SYM_ROSDO RecName: Full=Methionyl-tRNA synthetase;       
    8::66      1e-04  34%  697 aa  SYM_PSYWF RecName: Full=Methionyl-tRNA synthetase;       
    2::73      1e-04  28%  545 aa  SYM_BUCBP RecName: Full=Methionyl-tRNA synthetase;       
   23::151     1e-04  23%  575 aa  SYMM_YEAST RecName: Full=Methionyl-tRNA synthetase, mitochondrial; 
   32::103     1e-04  31%  938 aa  SYI_ENTS8 RecName: Full=Isoleucyl-tRNA synthetase;       
   23::146     1e-04  30%  460 aa  SYC_COXBU RecName: Full=Cysteinyl-tRNA synthetase;       
   21::144     1e-04  30%  458 aa  SYC_COXBR RecName: Full=Cysteinyl-tRNA synthetase;       
   21::144     1e-04  30%  458 aa  SYC_COXBN RecName: Full=Cysteinyl-tRNA synthetase;       
  131::189     2e-04  41%  562 aa  SYR_STRM5 RecName: Full=Arginyl-tRNA synthetase;       
    2::139     2e-04  28%  726 aa  SYM_BORT9 RecName: Full=Methionyl-tRNA synthetase;       
    5::68      2e-04  33%  555 aa  SYM_BLOPB RecName: Full=Methionyl-tRNA synthetase;       
   32::103     2e-04  31%  938 aa  SYI_CITK8 RecName: Full=Isoleucyl-tRNA synthetase;       
   25::145     2e-04  30%  460 aa  SYC_VEREI RecName: Full=Cysteinyl-tRNA synthetase;       
   16::160     2e-04  26%  457 aa  SYC_DEHSB RecName: Full=Cysteinyl-tRNA synthetase;       
    9::122     2e-04  25%  532 aa  SYM_SYNY3 RecName: Full=Methionyl-tRNA synthetase;       
   11::139     2e-04  29%  726 aa  SYM_BORRA RecName: Full=Methionyl-tRNA synthetase;       
    2::139     2e-04  28%  726 aa  SYM_BORDL RecName: Full=Methionyl-tRNA synthetase;       
   58::103     2e-04  33%  940 aa  SYI_SHEAM RecName: Full=Isoleucyl-tRNA synthetase;       
   24::163     2e-04  29%  462 aa  SYC_RALEJ RecName: Full=Cysteinyl-tRNA synthetase;       
    3::144     2e-04  26%  456 aa  SYC_DECAR RecName: Full=Cysteinyl-tRNA synthetase;       
   23::136     2e-04  28%  482 aa  SYC_ANADF RecName: Full=Cysteinyl-tRNA synthetase;       
  131::175     3e-04  42%  562 aa  SYR_XYLFT RecName: Full=Arginyl-tRNA synthetase;       
  131::175     3e-04  42%  562 aa  SYR_XYLFA RecName: Full=Arginyl-tRNA synthetase;       
  131::175     3e-04  42%  562 aa  SYR_XYLF2 RecName: Full=Arginyl-tRNA synthetase;       
  110::154     3e-04  42%  569 aa  SYR_METBF RecName: Full=Arginyl-tRNA synthetase;       
   24::135     3e-04  28%  454 aa  SYC_THIDA RecName: Full=Cysteinyl-tRNA synthetase;       
   24::58      3e-04  46%  457 aa  SYC_NANEQ RecName: Full=Cysteinyl-tRNA synthetase;       
   25::179     3e-04  28%  481 aa  SYC_GEOSL RecName: Full=Cysteinyl-tRNA synthetase;       
   25::145     3e-04  28%  461 aa  SYC_DELAS RecName: Full=Cysteinyl-tRNA synthetase;       
  121::150     4e-04  53%  558 aa  SYR_METTP RecName: Full=Arginyl-tRNA synthetase;       
  125::154     4e-04  53%  569 aa  SYR_METMA RecName: Full=Arginyl-tRNA synthetase;       
  123::152     4e-04  53%  567 aa  SYR_METAC RecName: Full=Arginyl-tRNA synthetase;       
    8::90      4e-04  32%  572 aa  SYM_PARDP RecName: Full=Methionyl-tRNA synthetase;       
    2::72      4e-04  35%  568 aa  SYM_METS5 RecName: Full=Methionyl-tRNA synthetase;       
    9::120     4e-04  26%  704 aa  SYM_LEPBL RecName: Full=Methionyl-tRNA synthetase;       
    9::120     4e-04  26%  704 aa  SYM_LEPBJ RecName: Full=Methionyl-tRNA synthetase;       
   18::104     4e-04  31%  476 aa  SYC_PYRHO RecName: Full=Cysteinyl-tRNA synthetase;       
   10::140     4e-04  27%  458 aa  SYC_DEHE1 RecName: Full=Cysteinyl-tRNA synthetase;       
  263::322     4e-04  37%  465 aa  SYC_CLOTE RecName: Full=Cysteinyl-tRNA synthetase;       
  265::321     5e-04  41%  476 aa  SYC_THEGJ RecName: Full=Cysteinyl-tRNA synthetase;       
  263::319     5e-04  35%  464 aa  SYC_CLOAB RecName: Full=Cysteinyl-tRNA synthetase;       
  131::175     7e-04  40%  562 aa  SYR_XYLFM RecName: Full=Arginyl-tRNA synthetase;       
  130::196     7e-04  38%  561 aa  SYR_CHRSD RecName: Full=Arginyl-tRNA synthetase;       
    8::90      7e-04  32%  572 aa  SYM_SILPO RecName: Full=Methionyl-tRNA synthetase;       
    4::141     7e-04  24%  677 aa  SYM_SACD2 RecName: Full=Methionyl-tRNA synthetase;       
    8::64      7e-04  39%  572 aa  SYM_RHOSK RecName: Full=Methionyl-tRNA synthetase;       
    8::64      7e-04  39%  572 aa  SYM_RHOS5 RecName: Full=Methionyl-tRNA synthetase;       
    8::64      7e-04  39%  572 aa  SYM_RHOS4 RecName: Full=Methionyl-tRNA synthetase;       
    8::64      7e-04  39%  572 aa  SYM_RHOS1 RecName: Full=Methionyl-tRNA synthetase;       
    5::54      7e-04  36%  545 aa  SYM_BLOFL RecName: Full=Methionyl-tRNA synthetase;       
  351::392     7e-04  40%  575 aa  SYMM_DICDI RecName: Full=Probable methionyl-tRNA synthetase,
    9::74      7e-04  32%  528 aa  SYK_TREPA RecName: Full=Lysyl-tRNA synthetase;       
   46::364     7e-04  30%  944 aa  SYI_PSYIN RecName: Full=Isoleucyl-tRNA synthetase;       
   26::146     7e-04  28%  465 aa  SYC_RALSO RecName: Full=Cysteinyl-tRNA synthetase;       
   26::146     7e-04  28%  463 aa  SYC_RALPJ RecName: Full=Cysteinyl-tRNA synthetase;       
   12::144     7e-04  26%  476 aa  SYC_METM6 RecName: Full=Cysteinyl-tRNA synthetase;       
   23::144     7e-04  33%  494 aa  SYC_GEOSF RecName: Full=Cysteinyl-tRNA synthetase;       
   24::163     7e-04  29%  462 aa  SYC_CUPTR RecName: Full=Cysteinyl-tRNA synthetase;       
   12::105     7e-04  28%  457 aa  SYC_CHRVO RecName: Full=Cysteinyl-tRNA synthetase;       
   12::135     7e-04  27%  461 aa  SYC_AZOSE RecName: Full=Cysteinyl-tRNA synthetase;       
  130::159     8e-04  57%  629 aa  SYR_PYRHO RecName: Full=Arginyl-tRNA synthetase;       
  130::178     8e-04  37%  561 aa  SYR_MARAV RecName: Full=Arginyl-tRNA synthetase;       
  127::156     8e-04  53%  550 aa  SYR_LAWIP RecName: Full=Arginyl-tRNA synthetase;       
  131::199     8e-04  31%  561 aa  SYR_BORPD RecName: Full=Arginyl-tRNA synthetase;       
    2::117     8e-04  33%  571 aa  SYM_SULAC RecName: Full=Methionyl-tRNA synthetase;       
   11::67      8e-04  33%  734 aa  SYM_BORBZ RecName: Full=Methionyl-tRNA synthetase;       
   11::67      8e-04  33%  734 aa  SYM_BORBU RecName: Full=Methionyl-tRNA synthetase;       
   12::204     8e-04  24% 1060 aa  SYI_THEFY RecName: Full=Isoleucyl-tRNA synthetase;       
  106::192     8e-04  36%  561 aa  SYE_META3 RecName: Full=Glutamyl-tRNA synthetase;       
  266::322     8e-04  37%  459 aa  SYC_RHORT RecName: Full=Cysteinyl-tRNA synthetase;       
   24::67      8e-04  48%  477 aa  SYC_PYRFU RecName: Full=Cysteinyl-tRNA synthetase;       
   21::140     8e-04  27%  472 aa  SYC_EUBE2 RecName: Full=Cysteinyl-tRNA synthetase;       
   21::160     8e-04  27%  457 aa  SYC_DEHSC RecName: Full=Cysteinyl-tRNA synthetase;       
  232::301     4e-06  40%  955 aa  SYV_RALEJ RecName: Full=Valyl-tRNA synthetase;       (query 304->368)
  180::305     2e-06  34%  909 aa  SYV_SYNP6 RecName: Full=Valyl-tRNA synthetase;       (query 227->377)
  136::328     4e-06  33%  638 aa  SYM_THETN RecName: Full=Methionyl-tRNA synthetase;       (query 486->668)
  210::345     8e-05  26%  930 aa  SYI_LACF3 RecName: Full=Isoleucyl-tRNA synthetase;       (query 239->369)
    1::873

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYTINDVMAR
SYL_RALME       MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYTINDVMAR
SYL_RALEJ       MQDKYLPSAVEQAAQQHWQAIDAYRVPEHATGPDGKEKPKFYACSMLPYPSGKLHMGHVRNYTINDVMAR
SYL_RALPJ       MQDKYSPSDVEQQAQQHWQALDAYRVTEHARAADGSDKPKFYACSMLPYPSGKLHMGHVRNYTINDVMTR
SYL_RALSO       MQDKYSPSEVEXXXXXXXXXXXXYRVTEHARAADGSDKPKFYACSMLPYPSGKLHMGHVRNYTINDVMMR
SYL_BURP8       MHEKYVPSDVESAAQGQWRATDAYKTTETA------DKPKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURXL       MHEKYVPSDVESAAQGQWRAIDAYKTTEVT------DKPKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURVG       MHERYVPADVEXXXXXXXXXXXXYKTKEDS------QKPKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURCJ       MHERYVPADVEXXXXXXXXXXXXYKTKEDS------QKPKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURCC       MHERYVPADVEXXXXXXXXXXXXYKTKEDS------QKPKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURCH       MHERYVPADVEXXXXXXXXXXXXYKTKEDS------QKPKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURCA       MHERYVPADVEXXXXXXXXXXXXYKTKEDS------QKPKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURM1       MHERYVPADVEXXXXXXXXXXXXYKTQEDA------QKPKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_HERAR       MQDKYSPADVEKSAHDHWQATDAYKAVEHAXXXXXXXXXXFYACSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURA4       MHERYVPADVEXXXXXXXXXXXXYKTREDS------QKPKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_JANMA       MQDKYSPAEVEKSAHDHWQAIDAYKAVENAXXXXXXXXXXFYACSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURCM       MHERYVPADVEXXXXXXXXXXXXYKTREDS------QKPKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURPS       MHERYVPADVEXXXXXXXXXXXXYRSKEDA------NRKKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURP0       MHERYVPADVEXXXXXXXXXXXXYRSKEDA------NRKKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURTA       MHERYVPADVEXXXXXXXXXXXXYRSKEDA------NRKKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURM9       MHERYVPADVEXXXXXXXXXXXXYRSKEDA------NRKKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURM7       MHERYVPADVEXXXXXXXXXXXXYRSKEDA------NRKKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURMS       MHERYVPADVEXXXXXXXXXXXXYRSKEDA------NRKKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURMA       MHERYVPADVEXXXXXXXXXXXXYRSKEDA------NRKKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURS3       MHERYVPADVEXXXXXXXXXXXXYKTQEDS------QKPKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURP6       MHERYVPADVEXXXXXXXXXXXXYRSKEDA------NRKKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BURP1       MHERYVPADVEXXXXXXXXXXXXYRSKEDA------NRKKFYCVSMLPYPSGKLHMGHVRNYTINDVMYR
SYL_BORBR       MQERYQPNSVEAAAQQTWQARDAYLVHEHAKNPDGSEKPKFYACSMLPYPSGKLHMGHVRNYTINDMMAR
SYL_BORPA       MQERYQPNSVEAAAQQTWQARDAYLVHEHAKNPDGSEKPKFYACSMLPYPSGKLHMGHVRNYTINDMMAR
SYL_BORPE       MQERYQPNSVEAAAQQTWQARDAYLVHEHAKNPDGSEKPKFYACSMLPYPSGKLHMGHVRNYTINDMMAR
SYL_POLSQ       MSKDYDHRGIEAAAQADWERTQVYRVTENAVNASGKKKPKYYACSMLPYPSGKLHMGHVRNYTINDVMAR
SYL_BORPD       MQERYSPTAVEXXXXXXXXXXXXYRVTEHARNADGTEKPKFYACSMLPYPSGKLHMGHVRNYTINDMMAR
SYL_POLNS       MSKDYDYRSIEAAAQADWEGAQVYQVAENAVDAQGKKKSKYYACSMLPYPSGKLHMGHVRNYTINDVMAR
SYL_POLNA       MQDKYNHLDVERSAQTHWNAADAYRVTEDA------SRKKYYACSMLPYPSGKLHMGHVRNYTINDMLSR
SYL_BORA1       MQERYQPNLVEXXXXXXXXXXXXYLVHESAKNADGSEKPKFYACSMLPYPSGKLHMGHVRNYTINDMMAR
SYL_DIAST       MQDKYNHTEVERAAHAHWNANDAYRVTEDQAKP------KFYACSMLPYPSGKLHMGHVRNYTINDMLTR
SYL_ACIAC       MQDKYTPAEVERAAHSHWTARDAYRVTEDA------GKKKFYACSMLPYPSGKLHMGHVRNYTINDMLTR
SYL_ACISJ       MQDKYNHTEVERAAHAHWNANDAYRVTEDQAKP------KFYACSMLPYPSGKLHMGHVRNYTINDMLTR
SYL_RHOFD       MQEKYTPLDVEQAAQSHWTAMDAYRVTEDS------SKKKFYACSMLPYPSGKLHMGHVRNYTINDMLTR
SYL_POLSJ       MQDKYNHLDVERSAQAQWIAADAYRVTEDTSGK--KPRGKYYACSMLPYPSGKLHMGHVRNYTINDMLTR
SYL_LEPCP       MNEKYDPAAIESAAHAQWVAADAYRVDENARDSQGQLKPKFYACSMLPYPSGKLHMGHVRNYTINDMLTR
SYL_DELAS       MQEKYNHIDVERAAQDHWSARDAYRVTEDQAKP------KFYACSMLPYPSGKLHMGHVRNYTINDMLTR
SYL_METPP       -------------------------------------RPKFYACSMLPYPSGKLHMGHVRNYTINDMMAR
SYL_VARPS       MNPSYKPSDVEXXXXXXXXXXXXYRVTEDA------SRKKYYACSMLPYPSGKLHMGHVRNYTINDMLTR
SYL_AZOSB       MQDKYQPAAVETAAQQHWESTAAFRVTEDATRP------KYYCLSMFPYPSGKLHMGHVRNYTIGDVLAR
SYL_VEREI       MQDKYSPQDIEXXXXXXXXXXXXXXVTQDA------GKKKFYACSMLPYPSGKLHMGHVRNYTINDMLTR
SYL_AZOSE       MQDKYTPAAVEATAQQHWESTQAFKVAEDAGKP------KYYCLSMFPYPSGKLHMGHVRNYTIGDVLAR
SYL_DECAR       MQDKYTPADIERAAQQHWDKTGAARAVEDATKP------KYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_NITMU       MQEKYHPQEIESEAQQYWQQTAAFKAVE------APEKRKYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_THIDA       MQEKYLPSEIERAGQARWTADQTYRAA------DASDRPKYYCLSMFPYPSGKLHMGHVRNYTIGDVLAR
SYL_NITEU       MQEKYHPQEIERQARQSWQETNIFNVTEI---PD---RPKYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_PSEPG       MHEQYTPRDIEAAAQKFWDEQQSFAVTEQP------GKDTYYCLSMFPYPSGKLHMGHVRNYTIGDVIAR
SYL_PSEPK       MHEQYTPRDIEAAAQKFWDEQQSFAVTEQP------GKDTYYCLSMFPYPSGKLHMGHVRNYTIGDVIAR
SYL_PSEP1       MHEQYTPRDIEAAAQKFWDEQQSFAVTEQP------GKDTYYCLSMFPYPSGKLHMGHVRNYTIGDVIAR
SYL_METCA       MEETYNPKTVEETAQRIWEESGVFRAREDS----GREK--FYCLSMFPYPSGRLHMGHVRNYTIGDVIAR
SYL_NITEC       MQEKYHPQEIEQQARQSWQETGIFNTTEI---PD---KPKYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_PSEMY       MHEQYSPREIEAAAQSHWDAQKSFVVSEQP------GKDTFYCLSMFPYPSGKLHMGHVRNYTIGDVIAR
SYL_PSESM       MHELYQPREIEAAAQTFWDEQKSFEVSEQP----GKET--FYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_PSEAB       MHEQYQPLEIETQAQNYWKEHQSFLVREL---PD---KEKFYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_PSEA7       MHEQYQPLEIETQAQNYWKEHQSFLVREL---PD---KEKFYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_NEIM0       MQEQYRPAAIEPAAQKKWDDARIFNVSEDA------SKPKYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_PSEAE       MHEQYQPLEIETQAQNYWKEHQSFLVREL---PD---KEKFYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_PSEA8       MHEQYQPLEIETQAQNYWKEHQSFLVREL---PD---KEKFYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_LARHH       MHEQYQPRDIEVAAQQKWEKTAAFKAVEDASRP------KYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_PSEPW       MHEQYTPRDIEAAAQHFWDEQQSFAVTEQP------GKDTYYCLSMFPYPSGKLHMGHVRNYTIGDVIAR
SYL_NEIMB       MQEQYRPAAIEPAAQKKWDDARIFNVSEDA------SKPKYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_NEIG1       MQEHYQPAAIEPAAQKKWDDARISNVSEDA------SKPKYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_PSEE4       MHEQYTPRDVEAAAQNAWDEQQSFAVTEQP----GKET--YYCLSMFPYPSGKLHMGHVRNYTIGDVIAR
SYL_NEIG2       MQEHYQPAAIEPAAQKKWDDARISNVSEDA------SKPKYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_NEIMF       MQEHYQPAAIEPAAQKKWDDARIFNVSEDA------SKPKYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_PSEU5       MHEQYQPREIEAAAQSHWDSQKSFEVSEQP------GKDTFYCLSMFPYPSGKLHMGHVRNYTIGDVIAR
SYL_PSEFS       MHEHYQPREIENAAQSFWDEQKSFEVSEQP----GKET--FYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_CHRVO       MQEQYSPRAVEXXXXXXXXXXXXXXXVEDASRP------KYYALSMFPYPSGKLHMGHVRNYTITDVLAR
SYL_PSEF5       MHEHYQPREIEAAAQLFWDEQKSFEVSEQP----GKET--YYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_AZOVD       MHEQYQPREIEAAAQSIWDAQKSFEVREQP------GKDTFYCLSMFPYPSGKLHMGHVRNYTIGDVIAR
SYL_PSE14       MHELYQPREIEAAAQTFWDEQKSFEVSEQP------GKDTFYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_PSEU2       MHELYQPREIEAAAQTFWDEQKSFEVSEQP------GKDTFYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_PSEPF       MHEQYQPREIEAAAQSFWDEQKSFEVSEQP----GKET--YYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_NEIMA       MQEQYQPAAIEPAAQKKWDDARIFNVSEDA------SKPKYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_ACIAD       ---EYQANAIESQIQNDWENRKAFKVADTV---EGKHR---YILSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_DICNV       MQDTYQPXXXXXXXXXXXXXXXRFKA---VVNP---QKEKFYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_XYLFA       ----YDPQRIESTAQHYWDSTHAFEVNEHS------NKPKYYCLSMLPYPSGALHMGHVRNYTIGDVISR
SYL_XANC8       ----YDPQQVETSAQQFWDATRAFQVDENS------DKPKFYCLSMLPYPSGALHMGHVRNYTISDVVSR
SYL_XANAC       ----YDPQQVETSAQQFWDATRAFQVDENS------EKPKFYCLSMLPYPSGALHMGHVRNYTISDVVSR
SYL_XANC5       ----YDPQQVETSAQQFWDATRAFQVDENS------EKPKFYCLSMLPYPSGALHMGHVRNYTISDVVSR
SYL_XANCB       ----YDPQQVETSAQQFWDATRAFQVDENS------DKPKFYCLSMLPYPSGALHMGHVRNYTISDVVSR
SYL_XANOR       ----YDPHQVETSAQQFWDATRAFQVDENS------EKPKFYCLSMLPYPSGALHMGHVRNYTISDVVSR
SYL_XANOP       ----YDPHQVETSAQQFWDATRAFQVDENS------EKPKFYCLSMLPYPSGALHMGHVRNYTISDVVSR
SYL_THICR       ----YQPQSIEAAIQHVWDEQQVF------VAKEDDSKEKFYCLSMFPYPSGKLHMGHVRNYTIGDVVSR
SYL_XANOM       ----YDPHQVETSAQQFWDATRAFQVDESS------EKPKFYCLSMLPYPSGALHMGHVRNYTISDVVSR
SYL_XYLFT       ----YDPQRIESTAQHYWDSTHAFEVNEHS------NKPKYYCLSMLPYPSGALHMGHVRNYTIGDVISR
SYL_XYLF2       ----YDPQRIESTAQHYWDSTHAFEVNEHS------NKPKYYCLSMLPYPSGALHMGHVRNYTIGDVISR
SYL_ACIBY       ---EYQANTIEPSVQQDWENRKVFKVADTV---EGKHR---YILSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_ACIBC       ---EYQANTIEPSVQQDWENRKVFKVADTV---EGKHR---YILSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_ACIB5       ---EYQANTIEPSVQQDWENRKVFKVADTV---EGKHR---YILSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_ACIB3       ---EYQANTIEPSVQQDWENRKVFKVADTV---EGKHR---YILSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_XYLFM       ----YDPQRIESIAQHYWDSTHAFEVNEHS------NKPKYYCLSMLPYPSGALHMGHVRNYTIGDVISR
SYL_ACIBS       ---EYQANTIEPSVQQDWENRKVFKVADTV---EGKHR---YILSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_HAHCH       MEELYHPKKVEQEAQKFWEETDAFKVDEEP----GKEK--FYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_XANCP       ----YDPQQVETSAQQFWDATRAFQVDENS------DKPKFYCLSMLPYPSGALHMGHVRNYTISDVVSR
SYL_IDILO       MQEQYNPSKIESAMQKRWQEQDVFTAKEQP------GKDKFYCLSMFPYPSGKLHMGHVRNYTLGDVISR
SYL_CHRSD       MDAQYTPHAIESAAQTFWDKNQCFKAVEDAT------REKFYCLSMFPYPSGKLHMGHVRNYTIGDVVSR
SYL_STRMK       ----YDPQQVESAAQKYWDATRAFEVDETS------DKPKYYCLSMLPYPSGALHMGHVRNYTIGDVISR
SYL_STRM5       ----YDPQQVESAAQQYWDATRAFEVDE------ASDKPKYYCLSMLPYPSGALHMGHVRNYTIGDVISR
SYL_MARAV       MDEQYNPREVEQTARTFWETNETFKVKEEPGKP------KYYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_METFK       MQQQYPFRDIEQQAQQYWESNATFTATEVS------DKPKYYCLSMFPYPSGKLHMGHVRNYTIGDVLSR
SYL_ALTMD       --NQYNPKDIEQRVQQYWEENQSFKAN------DDVEKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVISR
SYL_ALHEH       MDASYQPEQIEAQAQRYWDEQQSFAAREE------REGEKFYCLSMFPYPSGRLHMGHVRNYTIGDVISR
SYL_SERP5       MQEQYRPEDIESNVQLHWQEKQTFKVTEDA------SKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_PSYWF       ----YHPQAIEAEQQAKWAADKRFEVSNDI----SKDANTRYMLSMFPYPSGKLHMGHVRNYTISDVLSR
SYL_FRATN       --NEYNFSDIEKSTQDYWRKNDTFKTIED------NTKEKFYCLSMLPYPSGTLHMGHVRNYTIGDVIAR
SYL_PSYA2       ---QYQPQLIEAAQQAKWATDKRFEVSN-----EPSDKPSRYMLSMFPYPSGKLHMGHVRNYTISDVLSR
SYL_FRATW       --NEYNFSDIEKSTQEYWRKNDTFKTIED------NTKEKFYCLSMLPYPSGTLHMGHVRNYTIGDVIAR
SYL_CELJU       MQEQYNPAEVEAQAQQYWEEHQSFNVIEDP----GKEK--FYCLAMFPYPSGKLHMGHVRNYTITDVIAR
SYL_SODGM       MQELYRPEEIESTVQQHWHENDTFKVTEDPC------KEKYYCLSMLPYPSGRLHMGHVRNYTIGDVIAR
SYL_FRATT       --NEYNFSDIEKSTQEYWRKNDTFKTIED------NTKEKFYCLSMLPYPSGTLHMGHVRNYTIGDVIAR
SYL_FRAT1       --NEYNFSDIEKSTQEYWRKNDTFKTIED------NTKEKFYCLSMLPYPSGTLHMGHVRNYTIGDVIAR
SYL_PSYIN       MQELYNPKEIEKKFQTNWDENQSFKATEDP------SKEKYYCLSMFPYPSGKLHMGHVRNYTIGDVISR
SYL_FRATO       --NEYNFSDIEKSTQEYWRKNDTFKTIED------NTKEKFYCLSMLPYPSGTLHMGHVRNYTIGDVIAR
SYL_FRATH       --NEYNFSDIEKSTQEYWRKNDTFKTIED------NTKEKFYCLSMLPYPSGTLHMGHVRNYTIGDVIAR
SYL_FRATF       --NEYNFSDIEKSTQEYWRKNDTFKTIED------NTKEKFYCLSMLPYPSGTLHMGHVRNYTIGDVIAR
SYL_YERE8       MQEQYRPEDIETQVQLHWQEKQTFKVTEDT------SKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_FRATM       --NEYNFSDIEKSTQEYWRKNDTFKTIED------NTKEKFYCLSMLPYPSGTLHMGHVRNYTIGDVIAR
SYL_YERPS       MQEQYRPEDIETQVQLHWQEKQTFKVTEDA------SKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_YERPP       MQEQYRPEDIETQVQLHWQEKQTFKVTEDA------SKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_YERPN       MQEQYRPEDIETQVQLHWQEKQTFKVTEDA------SKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_YERPG       MQEQYRPEDIETQVQLHWQEKQTFKVTEDA------SKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_YERPE       MQEQYRPEDIETQVQLHWQEKQTFKVTEDA------SKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_YERPB       MQEQYRPEDIETQVQLHWQEKQTFKVTEDA------SKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_YERPA       MQEQYRPEDIETQVQLHWQEKQTFKVTEDA------SKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_YERP3       MQEQYRPEDIETQVQLHWQEKQTFKVTEDA------SKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_YERPY       MQEQYRPEDIETQVQLHWQEKQTFKVTEDA------SKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_PSEHT       MQEQYNPQKIESKIQRYWEENKVFKVTED------ESKEKYYCLSMFPYPSGRLHMGHVRNYTIGDVVSR
SYL_ERWCT       MQEQYRPEEIEADVQLHWQEKQTFKVTEQL----GKEK--YYCLSMLPYPSGRLHMGHVRNYTIGDVISR
SYL_AERHH       MQEQYVPQSIEPAVQKHWDAKKTFKAVEKV------DKEKFYCLSMFPYPSGRLHMGHVRNYTIGDVISR
SYL_PSYCK       ---QYQPQLIEAQQQAKWATDKRFEVSN-----EPSDKPSRYMLSMFPYPSGKLHMGHVRNYTISDVLSR