[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rmet0:ABF09882.1

[Show Plain Result]


## Summary of Sequence Search
    1::302
  246::327     3e-04  34%  854 aa  CLPB_THET8 RecName: Full=Chaperone protein clpB;
  246::327     3e-04  34%  854 aa  CLPB_THET2 RecName: Full=Chaperone protein clpB;
  259::329     9e-04  30%  854 aa  CLPB_MEIRU RecName: Full=Chaperone protein clpB;
    1::302

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CLPB_THET8      ----------------------------------------------------------------------
CLPB_THET2      ----------------------------------------------------------------------
CLPB_MEIRU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEMEQLALAL
CLPB_THET8      -------------------------------------------------------------EFEERLKAV
CLPB_THET2      -------------------------------------------------------------EFEERLKAV
CLPB_MEIRU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LRKVGVRMLVIDELHNVLAGNSVXXXXXXXXXXXXXXXXXIPLVGVGTRDAYLAIRSDDQLENRFEPMML
CLPB_THET8      IQEVGEVILFIDELHTVVAGKAEGAVDAGNMLKPALARGELRLIGATTLDEYREIEKDPALERRFQPV--
CLPB_THET2      IQEVGEVILFIDELHTVVAGKAEGAVDAGNMLKPALARGELRLIGATTLDEYREIEKDPALERRFQPV--
CLPB_MEIRU      VQSAGQIILFIDEIHTVVAGKAEGAVDAGNMLKPALARGELHLIGATTLDEYREIEKDPALERRFQPVFV


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CLPB_THET8      ----------------------------------------------------------------------
CLPB_THET2      ----------------------------------------------------------------------
CLPB_MEIRU      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxx
CLPB_THET8      ----------------------
CLPB_THET2      ----------------------
CLPB_MEIRU      ----------------------