[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07116.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e32A.bssp"
#ERROR : Can't open dsspfile "3e2tA.bssp"
#ERROR : Can't open dsspfile "3eihC.bssp"
#ERROR : Can't open dsspfile "3eieA.bssp"
#ERROR : Can't open dsspfile "2eb0B.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"
#ERROR : Can't open dsspfile "3dzdA.bssp"
#ERROR : Can't open dsspfile "3eihA.bssp"
#ERROR : Can't open dsspfile "1e3aA.bssp"
#ERROR : Can't open dsspfile "2bjwA.bssp"
#ERROR : Can't open dsspfile "2c99A.bssp"
#ERROR : Can't open dsspfile "2bjvA.bssp"
#ERROR : Can't open dsspfile "2a33A.bssp"
#ERROR : Can't open dsspfile "3bijA.bssp"
#ERROR : Can't open dsspfile "2c96A.bssp"
#ERROR : Can't open dsspfile "2c9cA.bssp"
#ERROR : Can't open dsspfile "2c98A.bssp"
#ERROR : Can't open dsspfile "1do2A.bssp"
#ERROR : Can't open dsspfile "1e94E.bssp"
#ERROR : Can't open dsspfile "1b1cA.bssp"
#ERROR : Can't open dsspfile "2azpA.bssp"
#ERROR : Can't open dsspfile "1a5tA.bssp"
#ERROR : Can't open dsspfile "3cf0A.bssp"
#ERROR : Can't open dsspfile "3b9pA.bssp"
#ERROR : Can't open dsspfile "1a2oA.bssp"
#ERROR : Can't open dsspfile "2ce7A.bssp"
#ERROR : Can't open dsspfile "2chqA.bssp"
#ERROR : Can't open dsspfile "1dooE.bssp"
#ERROR : Can't open dsspfile "3eihB.bssp"
#ERROR : Can't open dsspfile "2chgB.bssp"
#ERROR : Can't open dsspfile "3eccA.bssp"
#ERROR : Can't open dsspfile "2ce7E.bssp"
#ERROR : Can't open dsspfile "3d8bA.bssp"
#ERROR : Can't open dsspfile "2chgC.bssp"
#ERROR : Can't open dsspfile "3cf1B.bssp"
#ERROR : Can't open dsspfile "2ce7B.bssp"
#ERROR : Can't open dsspfile "3clmA.bssp"
#ERROR : Can't open dsspfile "2cunA.bssp"
#ERROR : Can't open dsspfile "3d8bB.bssp"
#ERROR : Can't open dsspfile "2chgA.bssp"
#ERROR : Can't open dsspfile "3ec2A.bssp"
#ERROR : Can't open dsspfile "3co5A.bssp"
#ERROR : Can't open dsspfile "2ce7F.bssp"
#ERROR : Can't open dsspfile "3bosA.bssp"
#ERROR : Can't open dsspfile "3bosB.bssp"
#ERROR : Can't open dsspfile "3cf2A.bssp"
#ERROR : Can't open dsspfile "3dgeC.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "3co5B.bssp"
#ERROR : Can't open dsspfile "3b2nA.bssp"
#ERROR : Can't open dsspfile "1bqgA.bssp"
#ERROR : Can't open dsspfile "1d2nA.bssp"
#ERROR : Can't open dsspfile "3cnbC.bssp"
#ERROR : Can't open dsspfile "1d2iA.bssp"
#ERROR : Can't open dsspfile "2c9oB.bssp"
#ERROR : Can't open dsspfile "3cf1A.bssp"
#ERROR : Can't open dsspfile "3cnbA.bssp"
#ERROR : Can't open dsspfile "1dbwA.bssp"
#ERROR : Can't open dsspfile "1dbwB.bssp"
#ERROR : Can't open dsspfile "2a9oA.bssp"
#ERROR : Can't open dsspfile "3c3wB.bssp"
#ERROR : Can't open dsspfile "3dgfC.bssp"
#ERROR : Can't open dsspfile "2ce7C.bssp"
#ERROR : Can't open dsspfile "3cfyA.bssp"
#ERROR : Can't open dsspfile "1dcfA.bssp"
#ERROR : Can't open dsspfile "1dc7A.bssp"
#ERROR : Can't open dsspfile "3cu5A.bssp"
#ERROR : Can't open dsspfile "1bknA.bssp"
#ERROR : Can't open dsspfile "1be1A.bssp"
#ERROR : Can't open dsspfile "3cu5B.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "2a9rA.bssp"
#ERROR : Can't open dsspfile "2ayxA.bssp"
#ERROR : Can't open dsspfile "2auwB.bssp"
#ERROR : Can't open dsspfile "2ch4B.bssp"
#ERROR : Can't open dsspfile "3cz5B.bssp"
#ERROR : Can't open dsspfile "1d5wB.bssp"
#ERROR : Can't open dsspfile "2a9qA.bssp"
#ERROR : Can't open dsspfile "1c4wA.bssp"
#ERROR : Can't open dsspfile "1do0A.bssp"
#ERROR : Can't open dsspfile "2ce7D.bssp"
#ERROR : Can't open dsspfile "2c13A.bssp"
#ERROR : Can't open dsspfile "1dc8A.bssp"
#ERROR : Can't open dsspfile "2auwA.bssp"
#ERROR : Can't open dsspfile "3c2eA.bssp"
#ERROR : Can't open dsspfile "3c97A.bssp"
#ERROR : Can't open dsspfile "1ccwA.bssp"
#ERROR : Can't open dsspfile "2ayzA.bssp"
#ERROR : Can't open dsspfile "3b8mC.bssp"
#ERROR : Can't open dsspfile "1dcmA.bssp"
#ERROR : Can't open dsspfile "1e51A.bssp"
#ERROR : Can't open dsspfile "1b1aA.bssp"
#ERROR : Can't open dsspfile "2d00A.bssp"
#ERROR : Can't open dsspfile "1bmtA.bssp"
#ERROR : Can't open dsspfile "1b63A.bssp"
#ERROR : Can't open dsspfile "2c15A.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "1b62A.bssp"
#ERROR : Can't open dsspfile "1ab5A.bssp"
#ERROR : Can't open dsspfile "3cz5C.bssp"
#ERROR : Can't open dsspfile "1ec9D.bssp"
#ERROR : Can't open dsspfile "3cz5A.bssp"
#ERROR : Can't open dsspfile "1d4zA.bssp"
#ERROR : Can't open dsspfile "2ch4A.bssp"
#ERROR : Can't open dsspfile "3c3wA.bssp"
#ERROR : Can't open dsspfile "3cg0A.bssp"
#ERROR : Can't open dsspfile "2b4aA.bssp"
#ERROR : Can't open dsspfile "1chnA.bssp"
#ERROR : Can't open dsspfile "1e2hB.bssp"
#ERROR : Can't open dsspfile "1ab6A.bssp"
#ERROR : Can't open dsspfile "1cyeA.bssp"
#ERROR : Can't open dsspfile "1djmA.bssp"
#ERROR : Can't open dsspfile "3breB.bssp"
#ERROR : Can't open dsspfile "1e6mA.bssp"
#ERROR : Can't open dsspfile "1delA.bssp"
#ERROR : Can't open dsspfile "3cg4A.bssp"
#ERROR : Can't open dsspfile "3cg0B.bssp"
#ERROR : Can't open dsspfile "3chyA.bssp"
#ERROR : Can't open dsspfile "1ec7D.bssp"
#ERROR : Can't open dsspfile "3c3mA.bssp"
#ERROR : Can't open dsspfile "3breA.bssp"
#ERROR : Can't open dsspfile "2cheA.bssp"
#ERROR : Can't open dsspfile "1e2iB.bssp"
#ERROR : Can't open dsspfile "3dqqB.bssp"
#ERROR : Can't open dsspfile "1e51B.bssp"
#ERROR : Can't open dsspfile "1a04A.bssp"
#ERROR : Can't open dsspfile "5chyA.bssp"
#ERROR : Can't open dsspfile "3crnB.bssp"
#ERROR : Can't open dsspfile "1e6kA.bssp"
#ERROR : Can't open dsspfile "1ehcA.bssp"
#ERROR : Can't open dsspfile "6chyA.bssp"
#ERROR : Can't open dsspfile "2c13B.bssp"
#ERROR : Can't open dsspfile "1e1cA.bssp"
#ERROR : Can't open dsspfile "1e6lA.bssp"
#ERROR : Can't open dsspfile "3crnA.bssp"
#ERROR : Can't open dsspfile "3b8nA.bssp"
#ERROR : Can't open dsspfile "2c19B.bssp"
#ERROR : Can't open dsspfile "3e7lC.bssp"
#ERROR : Can't open dsspfile "1aw5A.bssp"
#ERROR : Can't open dsspfile "3e7lD.bssp"
#ERROR : Can't open dsspfile "3e7lA.bssp"
#ERROR : Can't open dsspfile "2a1tS.bssp"
#ERROR : Can't open dsspfile "3bk9B.bssp"
#ERROR : Can't open dsspfile "3czpA.bssp"
#ERROR : Can't open dsspfile "2dvyD.bssp"
#ERROR : Can't open dsspfile "1dv7A.bssp"
#ERROR : Can't open dsspfile "2chuA.bssp"
#ERROR : Can't open dsspfile "2c14B.bssp"
#ERROR : Can't open dsspfile "1eb3A.bssp"
#ERROR : Can't open dsspfile "2c15B.bssp"
#ERROR : Can't open dsspfile "2c18B.bssp"
#ERROR : Can't open dsspfile "1e2kB.bssp"
#ERROR : Can't open dsspfile "2c9yA.bssp"
#ERROR : Can't open dsspfile "1ec9A.bssp"
#ERROR : Can't open dsspfile "1ea6B.bssp"

## Summary of PDB Search
:444
    5e-56  13%  1e32A  [b.52.2 - d.31.1 - c.37.1] P97
    3e-51  11%  3e2tA  [x.x.x] TRYPTOPHAN 5-HYDROXYLASE 1
    6e-42   9%  3eihC  [x.x.x] VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
    9e-42   8%  3eieA  [x.x.x] VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
    3e-41   9%  2eb0B  [x.x.x] MANGANESE-DEPENDENT INORGANIC PYROPHOSPHATASE
    5e-41  14%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
    1e-38  33%  3dzdA  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    2e-38   9%  3eihA  [x.x.x] VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
    4e-36  11%  1e3aA  [d.153.1] PENICILLIN AMIDASE ALPHA SUBUNIT
    7e-36  44%  2bjwA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    2e-35  42%  2c99A  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    3e-35  43%  2bjvA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    8e-34  11%  2a33A  [x.x.x] HYPOTHETICAL PROTEIN
    2e-33   9%  3bijA  [x.x.x] UNCHARACTERIZED PROTEIN GSU0716
    1e-31  43%  2c96A  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    1e-31  44%  2c9cA  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    3e-31  42%  2c98A  [x.x.x] PSP OPERON TRANSCRIPTIONAL ACTIVATOR
    2e-29  12%  1do2A  [c.37.1] PROTEIN (HEAT SHOCK LOCUS U)
    3e-29  11%  1e94E  [c.37.1] HEAT SHOCK PROTEIN HSLU
    2e-28  13%  1b1cA  [c.23.5] PROTEIN (NADPH-CYTOCHROME P450 REDUCTASE)
    7e-28  11%  2azpA  [x.x.x] HYPOTHETICAL PROTEIN PA1268
    3e-27  12%  1a5tA  [x.x.x] DELTA PRIME
    3e-26  15%  3cf0A  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    4e-26  11%  3b9pA  [x.x.x] CG5977-PA, ISOFORM A
    3e-25  16%  1a2oA  [c.23.1 - c.40.1] CHEB METHYLESTERASE
    6e-25  16%  2ce7A  [x.x.x] CELL DIVISION PROTEIN FTSH
    6e-25  16%  2chqA  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
    9e-25  15%  1dooE  [c.37.1 (1g4bE)] HEAT SHOCK LOCUS U
    1e-23  10%  3eihB  [x.x.x] VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 4
    2e-23  16%  2chgB  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
    1e-22   8%  3eccA  [x.x.x] DNA REPLICATION PROTEIN DNAC
    1e-22  16%  2ce7E  [x.x.x] CELL DIVISION PROTEIN FTSH
    1e-21  15%  3d8bA  [x.x.x] FIDGETIN-LIKE PROTEIN 1
    1e-21  16%  2chgC  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
    3e-21  14%  3cf1B  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    4e-21  17%  2ce7B  [x.x.x] CELL DIVISION PROTEIN FTSH
    1e-20  11%  3clmA  [x.x.x] TRANSALDOLASE
    1e-20  16%  2cunA  [x.x.x] PHOSPHOGLYCERATE KINASE
    3e-20  15%  3d8bB  [x.x.x] FIDGETIN-LIKE PROTEIN 1
    6e-20  17%  2chgA  [x.x.x] REPLICATION FACTOR C SMALL SUBUNIT
    7e-20  11%  3ec2A  [x.x.x] DNA REPLICATION PROTEIN DNAC
    1e-19  25%  3co5A  [x.x.x] PUTATIVE TWO-COMPONENT SYSTEM TRANSCRIPTIONAL
    1e-18  15%  2ce7F  [x.x.x] CELL DIVISION PROTEIN FTSH
    2e-17  14%  3bosA  [x.x.x] PUTATIVE DNA REPLICATION FACTOR
    5e-17  14%  3bosB  [x.x.x] PUTATIVE DNA REPLICATION FACTOR
    1e-16  14%  3cf2A  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    3e-16  25%  3dgeC  [x.x.x] RESPONSE REGULATOR
    3e-16  29%  1b00A  [c.23.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    4e-16  24%  3co5B  [x.x.x] PUTATIVE TWO-COMPONENT SYSTEM TRANSCRIPTIONAL
    4e-16  23%  3b2nA  [x.x.x] UNCHARACTERIZED PROTEIN Q99UF4
    7e-16  11%  1bqgA  [x.x.x] D-GLUCARATE DEHYDRATASE
    1e-15  15%  1d2nA  [c.37.1] N-ETHYLMALEIMIDE-SENSITIVE FUSION PROTEIN
    1e-15  21%  3cnbC  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    2e-15   5%  1d2iA  [c.52.1] PROTEIN (RESTRICTION ENDONUCLEASE BGLII)
    3e-15  12%  2c9oB  [x.x.x] RUVB-LIKE 1
    3e-15   7%  3cf1A  [x.x.x] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE
    5e-15  20%  3cnbA  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    6e-15  44%  1dbwA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    8e-15  44%  1dbwB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-14  22%  2a9oA  [x.x.x] RESPONSE REGULATOR
    1e-14  25%  3c3wB  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    1e-14  25%  3dgfC  [x.x.x] RESPONSE REGULATOR
    2e-14  16%  2ce7C  [x.x.x] CELL DIVISION PROTEIN FTSH
    2e-14  30%  3cfyA  [x.x.x] PUTATIVE LUXO REPRESSOR PROTEIN
    3e-14  21%  1dcfA  [c.23.1] ETR1 PROTEIN
    3e-14  33%  1dc7A  [c.23.1] NITROGEN REGULATION PROTEIN
    3e-14  27%  3cu5A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    5e-14  11%  1bknA  [d.122.1 - d.14.1] MUTL
    5e-14  12%  1be1A  [c.23.6 (1fmfA)] GLUTAMATE MUTASE
    7e-14  27%  3cu5B  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    7e-14  37%  1d5wA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-13  19%  2a9rA  [x.x.x] DNA-BINDING RESPONSE REGULATOR
    1e-13  24%  2ayxA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    1e-13  13%  2auwB  [x.x.x] HYPOTHETICAL PROTEIN NE0471
    2e-13   5%  2ch4B  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    2e-13  23%  3cz5B  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    3e-13  37%  1d5wB  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    3e-13  19%  2a9qA  [x.x.x] RESPONSE REGULATOR
    3e-13  25%  1c4wA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    3e-13  12%  1do0A  [c.37.1] PROTEIN (HEAT SHOCK LOCUS U)
    5e-13  16%  2ce7D  [x.x.x] CELL DIVISION PROTEIN FTSH
    5e-13  13%  2c13A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    6e-13  30%  1dc8A  [c.23.1] NITROGEN REGULATION PROTEIN
    6e-13  13%  2auwA  [x.x.x] HYPOTHETICAL PROTEIN NE0471
    6e-13  12%  3c2eA  [x.x.x] NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
    6e-13  16%  3c97A  [x.x.x] SIGNAL TRANSDUCTION HISTIDINE KINASE
    7e-13  12%  1ccwA  [c.23.6] PROTEIN (GLUTAMATE MUTASE)
    7e-13  24%  2ayzA  [x.x.x] SENSOR KINASE PROTEIN RCSC
    7e-13  11%  3b8mC  [x.x.x] FERRIC ENTEROBACTIN (ENTEROCHELIN) TRANSPORT
    7e-13  44%  1dcmA  [c.23.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    1e-12  15%  1e51A  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    2e-12  12%  1b1aA  [x.x.x] GLUTAMATE MUTASE
    2e-12  15%  2d00A  [x.x.x] V-TYPE ATP SYNTHASE SUBUNIT F
    2e-12   5%  1bmtA  [a.46.1 - c.23.6] METHIONINE SYNTHASE
    2e-12  14%  1b63A  [d.122.1 - d.14.1] MUTL
    2e-12  13%  2c15A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    2e-12  21%  1dz3A  [c.23.1] STAGE 0 SPORULATION PROTEIN A
    2e-12  10%  1b62A  [d.122.1 - d.14.1] PROTEIN (MUTL)
    2e-12  28%  1ab5A  [c.23.1] CHEY
    2e-12  23%  3cz5C  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    3e-12   9%  1ec9D  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    3e-12  23%  3cz5A  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    4e-12  28%  1d4zA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-12   5%  2ch4A  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    5e-12  25%  3c3wA  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
    6e-12  28%  3cg0A  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    9e-12  20%  2b4aA  [x.x.x] BH3024
    1e-11  27%  1chnA  [x.x.x] CHEY
    1e-11  16%  1e2hB  [c.37.1] THYMIDINE KINASE
    2e-11  27%  1ab6A  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    2e-11  26%  1cyeA  [x.x.x] CHEY
    2e-11  27%  1djmA  [c.23.1] CHEMOTAXIS PROTEIN Y
    3e-11  23%  3breB  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    4e-11  25%  1e6mA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-11   9%  1delA  [c.37.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    5e-11  25%  3cg4A  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN (CHEY-
    9e-11  28%  3cg0B  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    1e-10  27%  3chyA  [c.23.1 (1a0oA)] CHEY
    1e-10   9%  1ec7D  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    2e-10  21%  3c3mA  [x.x.x] RESPONSE REGULATOR RECEIVER PROTEIN
    2e-10  20%  3breA  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    2e-10  28%  2cheA  [x.x.x] CHEY
    4e-10  16%  1e2iB  [c.37.1] THYMIDINE KINASE
    6e-10   8%  3dqqB  [x.x.x] PUTATIVE TRNA SYNTHASE
    6e-10  17%  1e51B  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    9e-10  14%  1a04A  [c.23.1 - a.4.6] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN
    1e-09  26%  5chyA  [x.x.x] CHEY
    2e-09  22%  3crnB  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    2e-09  28%  1e6kA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    2e-09  26%  1ehcA  [x.x.x] CHEY
    4e-09  27%  6chyA  [c.23.1] CHEY
    4e-09  13%  2c13B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    1e-08  13%  1e1cA  [c.1.19 - c.23.6] METHYLMALONYL-COA MUTASE ALPHA CHAIN
    1e-08  26%  1e6lA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    1e-08  24%  3crnA  [x.x.x] RESPONSE REGULATOR RECEIVER DOMAIN PROTEIN, CHEY-
    1e-08  11%  3b8nA  [x.x.x] FERRIC ENTEROBACTIN (ENTEROCHELIN) TRANSPORT
    2e-08  16%  2c19B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    3e-08  23%  3e7lC  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    7e-08  10%  1aw5A  [x.x.x] 5-AMINOLEVULINATE DEHYDRATASE
    8e-08  23%  3e7lD  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    1e-07  23%  3e7lA  [x.x.x] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY)
    2e-07   6%  2a1tS  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    4e-06  13%  3bk9B  [x.x.x] TRYPTOPHAN 2,3-DIOXYGENASE
    9e-06  24%  3czpA  [x.x.x] PUTATIVE POLYPHOSPHATE KINASE 2
    1e-05  13%  2dvyD  [x.x.x] RESTRICTION ENDONUCLEASE PABI
    2e-05  10%  1dv7A  [c.1.2] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    2e-05   4%  2chuA  [x.x.x] ENTEROCHELIN UPTAKE PERIPLASMIC BINDING PROTEIN
    3e-05  13%  2c14B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    3e-05  21%  1eb3A  [c.1.10] 5-AMINOLAEVULINIC ACID DEHYDRATASE
    4e-05  15%  2c15B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    8e-05  15%  2c18B  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    2e-04  17%  1e2kB  [c.37.1] THYMIDINE KINASE
    2e-04   9%  2c9yA  [x.x.x] ADENYLATE KINASE ISOENZYME 2, MITOCHONDRIAL
    3e-04  13%  1ec9A  [d.54.1 - c.1.11] GLUCARATE DEHYDRATASE
    5e-04  10%  1ea6B  [d.122.1 - d.14.1] PMS1 PROTEIN HOMOLOG 2
:444

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIAMQDGLRVLFVEDEPLVRQATAQSLELAGFSVLALPSAEAAMPHLGADFPGVLVTDVRLSGASGLDLL
1e32A           -------------------------------------VKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFL
3e2tA           ----------------------------------------------------------------------
3eihC           ----------------------------------------------------------------------
3eieA           ----------------------------------------------------------------------
2eb0B           ---------------------------------------LAYFLDCYPARL--GDINPETEFVLRKFGVM
3cwoX           -----------------------------RVLIVDDATNGREAVEKYKELKPDIVTMDITMPEMNGIDAI
3dzdA           --------RVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKK-IKELFFPVIVLDVWPDGDGVNFI
3eihA           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
2bjwA           ----------------------------------------------------------------------
2c99A           ----------------------------------------------------------------------
2bjvA           ----------------------------------------------------------------------
2a33A           ----------------------------------------------------------------------
3bijA           ---------------------------------------AEDAAIAAERGFAVTTLTKAATRAKVIDAIG
2c96A           ----------------------------------------------------------------------
2c9cA           ----------------------------------------------------------------------
2c98A           ----------------------------------------------------------------------
1do2A           ----------------------------------------------------------------------
1e94E           ----------------------------------------------------------------------
1b1cA           ----------------------------------------------------------------------
2azpA           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
3cf0A           ----------------------------------------------------------------------
3b9pA           ----------------------------------------------------------------------
1a2oA           ------KIRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLD------------
2ce7A           ----------------------------------------------------------------------
2chqA           ----------------------------------------------------------------------
1dooE           ----------------------------------------------------------------------
3eihB           ----------------------------------------------------------------------
2chgB           ----------------------------------------------------------------------
3eccA           ----------------------------------------------------------------------
2ce7E           ----------------------------------------------------------------------
3d8bA           ----------------------------------------------------------------------
2chgC           ----------------------------------------------------------------------
3cf1B           ----------------------------------------------------------------------
2ce7B           ----------------------------------------------------------------------
3clmA           ------EHESTGGKTGFVSLEV------SPELAKDAQGTVEEARRLH--AAIARKNAIKVPATDAGIDAL
2cunA           ----------------------------------------------------------------------
3d8bB           ----------------------------------------------------------------------
2chgA           ----------------------------------------------------------------------
3ec2A           ----------------------------------------------------------------------
3co5A           ----------------------------------------------------------------------
2ce7F           ----------------------------------------------------------------------
3bosA           ----------------------------------------------------------------------
3bosB           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
3dgeC           -------KKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVL
1b00A           ------ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
3co5B           ----------------------------------------------------------------------
3b2nA           --------SLIIAEDQNMLRQAMVQLIKLHGDFLADTDNGLDAMKLIEEYNPNVVILDIEMPGMTGLEVL
1bqgA           --DFKLKGGVLRGEDEIAAVTALSERFPDARITLDPNWSLKEAVALCRDQHHVLAYAEDPCGAENGYSGR
1d2nA           ----------------------------------------------------------------------
3cnbC           -------FSILIIEDDKEFADMLTQFLENPYAKIKIAYNPFDAGDLLHTVKPDVVMLDLMMVGMDGFSIR
1d2iA           ----------------------------------------------------------------------
2c9oB           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
3cnbA           -------FSILIIEDDKEFADMLTQFLENPYAKIKIAYNPFDAGDLLHTVKPDVVMLDLMMVGMDGFSIC
1dbwA           ------DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELL
1dbwB           ------DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELL
2a9oA           --------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVA
3c3wB           -------VKVFLVDDHEVVRRGLVDLLGADPDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELC
3dgfC           -------KKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVL
2ce7C           ----------------------------------------------------------------------
3cfyA           --------RVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKPQLIILDLKLPDMSGEDVL
1dcfA           MSNFT-GLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVV-SHEHKVVFMDVCMPGVENYQIA
1dc7A           ------RGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALL
3cu5A           -------LRILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAILKHPPNVLLTDVRMPRMDGIELV
1bknA           IALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTT
1be1A           -------LGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFIETKADLICVSSLYGQGEIDCKGL
3cu5B           -------LRILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAILKHPPNVLLTDVRMPRMDGIELV
1d5wA           ------DYTVHIVDDEEPVRKSLAFMLTMNGFAVKM-HQSAEAFLAFAPDVRNGVLVTLRMPDMSGVELL
2a9rA           --------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQF-EAEQPDIIILLMLPEIDGLEVA
2ayxA           ------------VDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLT
2auwB           ----------------------------------------------------------------------
2ch4B           --------DTILSISKEDIQRVQDRDVIVIRGEVVYRLWEVLQIEHKEELEEMEAVIVRVGNRKYGIVVD
3cz5B           -------ARIMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEAYRLYREPDIVVMDLTLPGPGGIEAT
1d5wB           ------DYTVHIVDDEEPVRKSLAFMLTMNGFAVKM-HQSAEAFLAFAPDVRNGVLVTLRMPDMSGVELL
2a9qA           --------KILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAL-----EQFEAEQPDIIILDLDGLEVA
1c4wA           -------LKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISWNMPNMDGLELL
1do0A           ----------------------------------------------------------------------
2ce7D           ----------------------------------------------------------------------
2c13A           ------------PFRDAVGSASNLGKGNKATYQMDPANSDEALHEVA--ADLAEGADMVMVPGMPYLDIV
1dc8A           ------RGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTP-DVLLSIRMPGMDGLALL
2auwA           ----------------------------------------------------------------------
3c2eA           -------------------IAGTRKTTPGLRRLEKYSMLVGGCDTHRYDLSSMVMLKDNHIWATGSITNA
3c97A           -------LSVLIAEDNDICRLVAAKALEKCTNDITVVTNGLQALQAYQNRQFDVIIMDIQMPVMDGLEAV
1ccwA           -------LGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLELFIKAAIETKADAILVSSLYQGEIDCKGL
2ayzA           ----NDDMMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLT
3b8mC           ---VRNKLEIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVYDDPDFSI--SLGADGI
1dcmA           -------YTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELL
1e51A           RVSVMSYSAKFASCFYGPFRDAAKSSPAFGRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIV
1b1aA           -------LGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQEVFIETKADAILLSSLYGQGEIDCKGL
2d00A           -------VRMAVIADPETAQGFRL--AGLEGYGASSAEEAQSLLETLVERGYALVAVDEALLPDPERAVE
1bmtA           KTNGKMVIATVKGDVHDIGKNIVGVVLQCNNYEIVVMVPAEKILRTAKEVNADLIGLSGLITPSLDEMVN
1b63A           ------DVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQ--ALAIEWQHGDLTLRGWVADPNH
2c15A           ------------PFRDAVGSASNLGKGNKATYQMDPANSDEALHEVA--ADLAEGADMVMVPGMPYLDIV
1dz3A           -------IKVCIADDNRELVSLLDEYISSQPEVIGTAYNGQDCLQMLEEKRPDILLLDIIMPHLDGLAVL
1b62A           ---ARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTT
1ab5A           -------LKFLVVDDNSTMRRITRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
3cz5C           -------ARIMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEAYRLYREPDIVVMDLTLPGPGGIEAT
1ec9D           ----------------------------------------------------------------------
3cz5A           -------ARIMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEAYYRETTPDIVVMDLTLPGPGGIEAT
1d4zA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
2ch4A           ---PIANIDTILSISKEDIQRVQDRDVIVIRGEVIPVYRLWEVIEHKEELEEMEAVIVRVGNRKYGIVVD
3c3wA           -------VKVFLVDDHEVVRRGLVDLLGADPEVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELC
3cg0A           -----DLPGVLIVEDGRLAAATLRIQLESLGYDVLGVFDGEEAVRCAPDLRPDIALVDIMLCGALDGVET
2b4aA           -------FRVTLVEDEPSHATLIQYHLNQLGAVTVHPSGSAFFQHRSQLSTCDLLIVSDQLVDLSIFSLL
1chnA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1e2hB           ----------------------------------------------------------------------
1ab6A           -------LKFLVVDDNSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1cyeA           -------LKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1djmA           ----DKELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
3breB           ---LDGAVMVLLVDDQAMIGEAVRRSLASEAIDFHFCSDPQQAVAVANQIKPTVILQDLVMPGVDGLTLL
1e6mA           -------LKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEGVDALNKLQAGGYGFVISAWNMPNMDGLELL
1delA           ----------------------------------------------------------------------
3cg4A           --------GDVIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIPG---DGWDTI
3cg0B           --------GVLIVEDGRLAAATLRIQLESLGYDVLGVFDGEEAVRCAPDLRPDIALVDIMLCGALDGVET
3chyA           ------ELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1ec7D           ----------------------------------------------------------------------
3c3mA           --------TILVVDDSPIVDVFVT--LERGGYRPITAFSGEECLEALNATPPDLVLLDIEPDGWETLERI
3breA           ------AVMVLLVDDQAMIGEAVRRSLAEAGIDFHFCSDPQQAVAVANQIKPTVILQDLVMPGVDGLTLL
2cheA           -------LKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEGVDALNKLQAGGFGFIISDWNMPNMDGLELL
1e2iB           ----------------------------------------------------------------------
3dqqB           --------KIGVIADDFTGATDIASFLVENGMPTVQINDVPTGTQPEGCDAVVISLKTRSCPAQEAIKQS
1e51B           LMAHGLGNRVSVMSYSAKFASCFYGPFRDAARRQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIV
1a04A           -----EPATILLIDDHPMLRTGVKQLISMAPTVVGEASNGEQGIELAESLDPDLILLDLNMPGMNGLETL
5chyA           ------ELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEGVDALNKLQAGGYGFVISDWNMPNMDGLELL
3crnB           --------RILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFIKLP-DEGTELLE
1e6kA           ---MRSELKFLVVADFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1ehcA           -------LKFLVVDKFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
6chyA           -------LKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
2c13B           ---------------GPFRDAVGSASGNKATYQMDPANSDEAL---HEVAADLAEGADMVMVPGMPYLDI
1e1cA           ---------KMGQDGHDRGQKVIATAYADLGFDVDVGPLFQETARQAVEADVHVVGVSSLAGGHLTLVPA
1e6lA           -------LKFLVVDAFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
3crnA           --------RILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFIKLPEGTELLEKA
3b8nA           ---VRNKLEIKTQFEKEKLAQDRIKMKNQLDA---NIQRLNYSLDIANAAGIKKPVYDPDFSISLGADGI
2c19B           ------------------FRDAVGSAGNKATYQMDPANSDEALHEVAADLAEGA-DMVMVKPGMPYLDIV
3e7lC           ----------------------------------------------------------------------
1aw5A           ------GAHCVAPSDIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGSEGADGIIVKPSTFYLDIV
3e7lD           ----------------------------------------------------------------------
3e7lA           ----------------------------------------------------------------------
2a1tS           -----GPAQCQETIRTALAMGADVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTG
3bk9B           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2dvyD           QSMVYVCIPLTNVEPSLAGRVARRNEVVKYEVPVDLMKELLKAFIIASETHKNDIVKFLR----------
1dv7A           -------------------RSRRVDVMDVMNRLILAMMNRDDALRVTGEVREYIDTVKIGYPLVLSAEFR
2chuA           ------------------------------------------NSEFILEKNPDYIFVVDRNVILGNKERA
2c14B           ------------------GPFRDAVGSANKATYQMDPANSDEALHEVAADLAEGADMVMVKPGMPYLDIV
1eb3A           ------------------------------------------------------------------LDIM
2c15B           -------------------PFRDAVGSNKATYQMDPANSDEALHEVAAD--LAEGADMVMVPGMPYLDIV
2c18B           ------------------PFRDAVGSANKATYQMDPANSDEALHEVA--ADLAEGADMVMVPGMPYLDIV
1e2kB           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1ec9A           -------------EEEAESIVALAQRFPQARITLDPNGALNEAIKIGKYLKGSLAYAEDPCGAEQGFSGR
1ea6B           YCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENIGSLQSLIPFVQLPPSDSVCEEYGLSCSDALHNL


                         .         .         *         .         .         .         .:140
query           QHCRNAAPGVPVILVTGHGDITMAVQAMREGAYDFIEKPFGADXXXXXXXXXXXXXXXXXXXXXXXXXXX
1e32A           EAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDVGGCR
3e2tA           ----------------------------------------------------------------------
3eihC           ----------------------------------------------------------------------
3eieA           ----------------------------------------------------------------------
2eb0B           EPELIESAKGKEIILVDHSEKSQSFDDLEEGKLIAIIDHH-KVGLTTTEPILYYAKPVGSTATVIAELYF
3cwoX           KEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVNTAAVENPSLITQIAQTFGSQAVVVAIDAKRVD
3dzdA           DFIKENSPDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPFSVERFLLTIKHAFEEYSKKA----------
3eihA           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
2bjwA           ----------------------------------------------------------------------
2c99A           ----------------------------------------------------------------------
2bjvA           ----------------------------------------------------------------------
2a33A           ----------------------------------------------------------------------
3bijA           KAAKALGKGDIFLSYSGHGGQVPDTSNDEPDGVDETWCLFDGELIDDELYALLGKFAAGVR---------
2c96A           ----------------------------------------------------------------------
2c9cA           ----------------------------------------------------------------------
2c98A           ----------------------------------------------------------------------
1do2A           ----------------------------------------------------------------------
1e94E           ----------------------------------------------------------------------
1b1cA           ----------------------------------------------------------------------
2azpA           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
3cf0A           ----------------------------------------------------------------------
3b9pA           ----------------------------------------------------------------------
1a2oA           ----------------------------------------------------------------------
2ce7A           ----------------------------------------------------------------------
2chqA           ----------------------------------------------------------------------
1dooE           ----------------------------------------------------------------------
3eihB           ----------------------------------------------------------------------
2chgB           ----------------------------------------------------------------------
3eccA           ----------------------------------------------------------------------
2ce7E           ----------------------------------------------------------------------
3d8bA           ----------------------------------------------------------------------
2chgC           ----------------------------------------------------------------------
3cf1B           ----------------------------------------------------------------------
2ce7B           ----------------------------------------------------------------------
3clmA           ETLVSDGISVNLTLLFSRAQTLKAYAAYARGIAKRLAAGQSVAHIQVVASFFISRVDSALDATLPDRLKG
2cunA           ----------------------------------------------------------------------
3d8bB           ----------------------------------------------------------------------
2chgA           ----------------------------------------------------------------------
3ec2A           ----------------------------------------------------------------------
3co5A           ----------------------------------------------------------------------
2ce7F           ----------------------------------------------------------------------
3bosA           ----------------------------------------------------------------------
3bosB           ----------------------------------------------------------------------
3cf2A           ----------------------------------------------------------------------
3dgeC           KKLQEKEERIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPS---------------------------
1b00A           KKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPK---------------------------
3co5B           ----------------------------------------------------------------------
3b2nA           AEIRKKHLNIKVIIVTTFKRPGYFEKAVVNDVDAYVLKERSIE---------------------------
1bqgA           EVMAEFRTGLRTATNMIATDWRQMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCN--------------
1d2nA           ----------------------------------------------------------------------
3cnbC           IKSTPATANIIVIAMTGALTDDNVSRIVALGAETCFGKPLNFT---------------------------
1d2iA           ------------------------IDITDYNHADEILNPQLWKEIEETLLKPLHVKASDQASKVGSLIFD
2c9oB           ----------------------------------------------------------------------
3cf1A           ----------------------------------------------------------------------
3cnbA           HRIKSTPANIIVIAMTGALTDDNVSRIVALGAETCFGKPLNFT---------------------------
1dbwA           RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDT---------------------------
1dbwB           RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDT---------------------------
2a9oA           KTIRKTSS-VPILMLSAKDSEFDKVIGLELGADDYVTKPFSNR---------------------------
3c3wB           RDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGM---------------------------
3dgfC           KKLQEKEERIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPS---------------------------
2ce7C           ----------------------------------------------------------------------
3cfyA           DWINQNDIPTSVIIATAHGSVDLAVNLIQKGAEDFLEKPINAD---------------------------
1dcfA           LRIHEKFTRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLD---------------------------
1dc7A           KQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDID---------------------------
3cu5A           DNILKLYPDCSVIF------MSGYSDKEYLRAIRYVEKPI------------------------------
1bknA           PALAEI---QYCYVNGRMMRDRLINHAIRQACEDKLGADQ------------------------------
1be1A           REKCDEAGLKGIKLFGKQNWPDVEQRFKAMGFDRVYPPGTSPE---------------------------
3cu5B           DNILKLYPDCSVIFMSGYSDKEYLKAAIKFRAIRYVEKPIDPS---------------------------
1d5wA           RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDT---------------------------
2a9rA           KTIRKTSS-VPILMLSAKDSEFDKVIGLELGADDYVTKPFSNR---------------------------
2ayxA           QRIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLD---------------------------
2auwB           ----------------------------------------------------------------------
2ch4B           DLLGQDDIVIKSL--GKVFSEVKEFSGAAILGDGSIALIINVS---------------------------
3cz5B           RHIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPA---------------------------
1d5wB           RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDT---------------------------
2a9qA           KTIRKTSSVPILML-SAKDSEFDKVIGLELGADDYVTKPFSNR---------------------------
1c4wA           KTIRGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
1do0A           ----------------------------------------------------------------------
2ce7D           ----------------------------------------------------------------------
2c13A           RRVK-DEFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLT---------------------------
1dc8A           KQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDID---------------------------
2auwA           ----------------------------------------------------------------------
3c2eA           VKNARAVCGFAVKIEVECLSEDEATEAIEAGADVIMLDNHFLL---------------------------
3c97A           SRNYERTHNTKRASIIAITADTIDDDRPGAELDEYVSKPLNPN---------------------------
1ccwA           RQKCDEAGLEGILLVGKQHWPDVEKRFKDMGYDRVYAPGTPPE---------------------------
2ayzA           QRIRQLGLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLD---------------------------
3b8mC           ERKLEKAVTDVAELNGELRNRQYLVEDVNFTPFKYQLSPS------------------------------
1dcmA           RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDT---------------------------
1e51A           REVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAM---------------------------
1b1aA           RQKCDEAGLEGILLVGKQHWPDVEKRFKDMGYDRVYAPGTPPE---------------------------
2d00A           RLMRGRDL--PVLLPIAGLKEAFQGHDVEGYMRELVRKTIGFD---------------------------
1bmtA           VAKGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTV---------------------------
1b63A           TTPALAEI-QYCYVNGRMMRDRLINHAIRQACEDKLGADQ------------------------------
2c15A           RRVKDEFRA-PTFVYQVSGEYAMHMGAIQNGWLAESVILESLT---------------------------
1dz3A           ERIRAGFEHPNVIMLTAFGQEDVTKKAVELGASYFILKPFDME---------------------------
1b62A           PALAYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEID---------------------------
1ab5A           KTIRADGAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
3cz5C           RHIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPA---------------------------
1ec9D           ----------------------------------------------------------------------
3cz5A           RHIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPA---------------------------
1d4zA           KTIRADGAMLPVLMVTAEAKKENVIAAAQAGASGYVVKPFTAA---------------------------
2ch4A           DLLGQDDI--VIKSLGKVFSEVKEFSGAAILGDGSIALIINVS---------------------------
3c3wA           RDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDI------------------------------
3cg0A           AARLAAGCNLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAAD---------------------------
2b4aA           DIVKEQTKQPSVLILTTGRL-----IESSEHNLSYLQKPFAIS---------------------------
1chnA           KTIRADGAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
1e2hB           ----------------------------------------------------------------------
1ab6A           KTIRADGAMLPVLMTTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
1cyeA           KTIRADGAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
1djmA           KTIRADGAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
3breB           AAYRGNPADIPIIVLSTKEEPTVKSAAFAAGANDYLVKLP------------------------------
1e6mA           KTIRADGAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
1delA           ----------------------------------------------------------------------
3cg4A           RAILDNSLEQGIAIVLTAKNAPDAKIGLQEYVVDYITKPFDNE---------------------------
3cg0B           AARLAAGCNLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAAD---------------------------
3chyA           KTIRADGAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
1ec7D           ----------------------------------------------------------------------
3c3mA           KTDPATRDIPVLL--TAKPLTPEEANEYGSYIEDYILKPTTHH---------------------------
3breA           AAYRGNPATRDIPIIVLSTKEEPTVKSAAFAAGANDYLV-------------------------------
2cheA           KTIRSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
1e2iB           ----------------------------------------------------------------------
3dqqB           LAALLKKQGCQQVYFKYCSTFDSTAEGNI-----------------------------------------
1e51B           REVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAM---------------------------
1a04A           DKLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAA----------------
5chyA           KTIRADGAMSAVLMVTAEAKKENIIAAAQAGASGWVVKPFTAA---------------------------
3crnB           KAHKLR---PGKKIVTGYASLENSVFSLNAGADAYI-KPVNPR---------------------------
1e6kA           KTIDGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
1ehcA           KTIRADGAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
6chyA           KTIRADGAALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAA---------------------------
2c13B           VRRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLT---------------------------
1e1cA           LRKELDKLGDILITVGGVIPEQDFDELRKDGAVEIYTPGTVIP---------------------------
1e6lA           KTIRADGAMSAVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
3crnA           HKLRP-----GKKIVTGYASLENSVFSLNAGADAYI-KPVNPR---------------------------
3b8nA           ERKLEKAVTDVAELNGELRNRQYNINDVNFTPFKYQLSPS------------------------------
2c19B           RRV-KDEFRAPTFVYQVSGEYAMHMGA---IQNGWLAESVILE---------------------------
3e7lC           ----------------------------------------------------------------------
1aw5A           RDASEICKDLPICAYHVS----GEYALHAAAEKGVVDLKTIAF---------------------------
3e7lD           ----------------------------------------------------------------------
3e7lA           ----------------------------------------------------------------------
2a1tS           QMTAGFLDWPQGTFASQVTLEGDKLKVERADGGLETLRLKLPA---------------------------
3bk9B           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1dv7A           KRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGF------------------------------
2chuA           QGILDLVAKTKAAIIYLDPEYWYLASGNGLESLKTMILEI------------------------------
2c14B           RRVKDEFR-APTFVYQVSGEYAMHMGAIQNG---WLAESVILE---------------------------
1eb3A           RDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDL--KTI------------------------------
2c15B           RRVKDEFR-APTFVYQVSGEYAMHMGAIQNGWLAESVILESLT---------------------------
2c18B           RRVKDEFRA-PTFVYQVSGEYAMHMGAIQNGWLAESVILESLT---------------------------
1e2kB           ----------------------------------------------------------------------
2c9yA           ----------------------------------------------------------------------
1ec9A           EVMAERATGLPTATNMIATDWRQMGHTLSLQSVDIPLADP------------------------------
1ea6B           FYISGFISQCTHGVGRSS---------TDRQFFFINRRPC------------------------------


                         +         .         .         .         .         *         .:210
query           GPAAGTRIIGRSPAIAQVRDLIANVAATDVPVMINGETGTGKELVARSLHALSTRRDQPFIALNCGAVPE
1e32A           KQLAQ-IKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVA----NETGAFFFLINGPEIM
3e2tA           ------------------------------------MYGSDLDADHPGFKDNVYRKRKYFADLAMNYKHG
3eihC           -------VAGLEGAKEALKEAVI--LPVKFPHLFKGNRKPTSGILLYGPPGTGKSYLAKAVATEANSTFF
3eieA           -------VAGLEGAKEALKEAVI--LPVKFPHLFKGNRKPTSGILLYGPPGTGKSYLAKAVATEANSTFF
2eb0B           KDAIDLIGGKKKELKPDLAGLLLSAIISDTVLFKSPTTTDLDKEMAKKLAEIAGISNIEEFG-MEILKAK
3cwoX           GEFMVFTKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGGAGKME
3dzdA           -PPQEEIEFVGEHPKILEIKRLIPKIAKSKAPVLITGESGTGKEIVARLIHRYSGRKGAFVDLNCASIPQ
3eihA           -------VAGLEGAKEALKEAVI--LPVKFPHLFKGNRKPTSGILLYGPPGTGKSYLAKAVATEANSTFF
1e3aA           ----------------------------------------------------------------------
2bjwA           --------LGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
2c99A           -------LLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
2bjvA           ---------GEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
2a33A           ----CGSSQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLGLVSQAVHDGGRHVIGIIP------KTL
3bijA           -VLVFSDSCHSGTVVKAYYNGIRYRAPQSVARTYRANREFYDTIQQKTKKVDLADVKASILLISGCQDNQ
2c96A           -------LLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
2c9cA           -------LLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
2c98A           -------LLGEANSFLEVLEQVSHLAPLDKPVLIIGERGTGKELIASRLHYLSSRWQGPFISLNCAALNE
1do2A           ------HIIGQDNAKRSVAIALRNHEVTPKNILMIGPTGVGKTEIAR---RLAKLANAPFIKVEATKFTE
1e94E           ------AIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIAR---RLAKLANAPFIKVEATKFTE
1b1cA           -------------------SFVEKMKKTGRNIIVFYGSQTGTEEFANRLSKDAHRYGMRGMSADPEEYDL
2azpA           -------------GHMQRIRIIDSHTGGERLVIGGFPDLGQGDMAERRRLLGERHDAWRAACIL------
1a5tA           ------WYPWLRPDFEKLVASYQA-GRGHHALLIQALPGMGDDALIY---ALSRYLLCQQPQGHKSCGHC
3cf0A           ------DIGGLEDVKRELQELVQYGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKG--------
3b9pA           ------ALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTS---
1a2oA           ----------------------------------------------------------------------
2ce7A           -------VGGAEEAIEELKEVVEFGARMPKGILLVGPPGTGKTLLA---RAVAGEANVPFFHISGSD---
2chqA           -------VVGQDEVIQRLKGYVE--RKNIPHLLFSGPPGTGKTATAIALARDLFGENWRDNFIEMNASDE
1dooE           ------HIIGQDNAKRSVAIALRNHEVTPKNILMIGPTGVGKTEIARRLAKLANA---PFIKVEATKFTE
3eihB           ------ALKEAVILPVKFPHLFKGNRKPTSGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDL-----
2chgB           -------VVGQDEVIQRLKGYVE--RKNIPHLLFSGPPGTGKTATAIALARDLFGENWRDNFIEMNASDE
3eccA           -------YHPKNVSQNRALLTIRVFVHEGKGLTFVGSPGVGKTHLAVATLKAIYEKKGIRGYFFDTKDLI
2ce7E           -------VGGAEEAIEELKEVVEFGARMPKGILLVGPPGTGKTLLAR---AVAGEANVPFFHISGSD---
3d8bA           ------TIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTS---
2chgC           -------VVGQDEVIQRLKGYVE--RKNIPHLLFSGPPGTGKTATAIALARDLFGENWRDNFIEMNASDE
3cf1B           ----------------------------SKGVLFYGPPGCGKTLLAKAIANECQANFISIKG--------
2ce7B           -------VGGAEEAIEELKEVVEFLARMPKGILLVGPPGTGKTLLAR---AVAGEANVPFFHISG-----
3clmA           KTAIAAKAAYQDWEQYFTAPEFAALEAQGANRVQLLWASTGVKNPAYPDTLYVDSLIGVH---TVNTVPD
2cunA           ----------------------------------------------------------------------
3d8bB           ------TIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIA---SQSGATFFSISASSLT-
2chgA           -------VVGQDEVIQRLKGYVE--RKNIPHLLFSGPPGTGKTATAI---ALARDLFGENWRDNF---IE
3ec2A           ------KNVSQNRALLTIRVFVHNFNPEGKGLTFVGSPGVGKTHLAVATLKAIYEKKGIRGYFFDTKDLI
3co5A           ---------GNSAAIQENREVEA-AAKRTSPVFLTGEAGSPFETVARYFHKNGTPWVSPARVEYL-----
2ce7F           -------VGGAEEAIEELKEVVEFLARMPKGILLVGPPGTGKTLLARAVAGEANVPFFHISGSDF-----
3bosA           -------YPGNDELIGALKSAAS--GDGVQAIYLWGPVKSGRTHLIHAACARANELERRSFYIPLGIHAS
3bosB           ------SYYPAAGNDELIGALKSAASGGVQAIYLWGPVKSGRTHLIHAACARANELERRSFYIPLGIHAS
3cf2A           -----------------PDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISI----------
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
3co5B           -----------NSAAIQENREVEAAAKRTSPVFLTGEAGSPFETVARYFHKNGTPW-------VSPARVE
3b2nA           ----------------------------------------------------------------------
1bqgA           --EWGLTWGSHSNNHFDISLAMFTHVAAAAPGNITAIDTHWIWQDGQRLTKEPLQIKGGLVEVP------
1d2nA           -------IIKWGDPVTRVLDDGELLVQPLVSVLLEGPPHSGKTALAA---KIAEESNFPFIKICSPDKMI
3cnbC           ----------------------------------------------------------------------
1d2iA           PVGTNQYIKDNIPIPKRFDFLGTDIDFGKRDTLVEVQFSNYPFLLNNTVRSELFHKSNDIDEEGKVAIII
2c9oB           ------GLVGQENAREACGVIVELIKSKKMAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYST
3cf1A           ----------------------------------------------------------------------
3cnbA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
2ce7C           -------VGGAEEAIEELKEVVEFLKDPSKGILLVGPPGTGKTLLARAVAGEA---NVPFFHISGS----
3cfyA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
2auwB           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1do0A           ------AIALRNRWRRMQLNEELRHEVTPKNILMIGPTGVGKTEIARRLAKLANA---PFIKVEATKFTE
2ce7D           -------VGGAEEAIEELKEVVEFLKDPSKGILLVGPPGTGKTLLAR---AVAGEANVPFFHISG-----
2c13A           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2auwA           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
2c15A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
1ec9D           --------------------------------QVPEKPGLGVEIDMDQVMKAHELYQKHGLGARDDAMGQ
3cz5A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1e2hB           -------------------------------VYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRV
1ab6A           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1delA           -------------------------------IFLSGVKRSGKDTTADNYSAVKYQLAGPIKDALAYAWGV
3cg4A           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1ec7D           --------------------------------QVPEKPGLGVEIDMDQVMKAHELYQKGLGARDDAMGMQ
3c3mA           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1e2iB           -------------------------------VYIDGPHGMGKTTTTQLLVALGSRDDIVYVP-EPMTYWR
3dqqB           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
1a04A           -GEMVLSEALTPVLAASLERDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLK
5chyA           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
3e7lC           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
3e7lD           ----------------------------------------------------------------------
3e7lA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3bk9B           ----------------------------------------------------------------------
3czpA           ------AVIELREALLEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWDPR---------------
2dvyD           ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
1e2kB           -------------------------------VYIDGPHGMGKTTTTQLLVALGSRDD--IVYVPEPMTYW
2c9yA           -------------------------------AVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVAS
1ec9A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SIFESEMFGHEAGAFTGAGKRRVGKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGTLERLGSNTSIPI
1e32A           SKLAGESESNLRKAFEEA--------EKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQ
3e2tA           DPIPEIEFTEEEIKTWGTVYRELNKLYPTHACREYLKNLPLLTKYCGYREDNIPQLEDVSRFLKERTGFT
3eihC           SVSSSDLVSKWMGESEKLVKQLFAMARENKPSIIFIDQVDALTGESEASRRIKTELLVQMNGVGNDSQGV
3eieA           SVSSSDLVSKWMGESEKLVKQLFAMARENKPSIIFIDQVDALTGTEASRRIKTELLVQMNGVGNDS--QG
2eb0B           SVVGKLKPEEIINMDFKNFDFNGKKVGIGQVEVIDVSEVESKKEDIYKLLEEKLKNEGLIVFLITDIMKE
3cwoX           HFLEAFLAGADASVFFREIDVRELKEYLKKHGNVRLEGLLEHH---------------------------
3dzdA           ELAESELFGHEKGAFTGALTRKKGKLELADQGTLFLDEVGELDQRVQAKLLRVLETGSFTRLGGNQKIEV
3eihA           SVSSSDLVSKWMGESEKLVKQLFAMARENKPSIIFIDQVDALTGTRGEGESEASRRIKTEQMNGVGNDSQ
1e3aA           ----------EIKIVRDEYGMPHIYANDTWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKF
2bjwA           NLLDSELFGHEKRHPG--------RFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQV
2c99A           NLLDSELFGHEAKRHP-------GRFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQV
2bjvA           NLLDSELFGHERHPG---------RFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGPLQVNV
2a33A           VGEVRAVADHQRKAEAK----HSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGL-------LNVDGY
3bijA           LSQDGAFNGAFTGQLLRVWKNGLYKGSYRSFHKAIVRRPPDQTPNFFTAGPAFLKQRPFTV---------
2c96A           NLLDSELFHPGRFE-------------RADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQV
2c9cA           NLLDSELFGHEAKRHPG-------RFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQV
2c98A           NLLDSELFGHEAQKR------HPGRFERADGGTLFLDELATAPMMVQEKLLRVIEYGELERVGGSQPLQV
1do2A           VGYVGKEVDSIIRDLTDA-----------AVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTE
1e94E           VGYVGKEVDSIIRDLTDA-----------AVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTE
1b1cA           ADLSSLPEIDNALVVFCMATYGEG--DPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKY
2azpA           ---EPRGSDVLVGALLCAPV-----DPEACAGVIFFNNSGYLGMCGHGTIGLVASLAHLGRIGETPVGEV
1a5tA           RGCQLMQAGTHPDYYTLA-PEKGKNTLGVDAVREVTEKLNEHARLGGAKVVWVTDAALLTDAAANALLKT
3cf0A           ----PELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIADRVINQILTEMDGMSTKKN
3b9pA           ---------KYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSEREASRRLKTEFLVEFDGLPRIVVLA
1a2oA           --------------------------NKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSGANYQIKI
2ce7A           ------FVELFVGVGAARVRDLFAQAKAHAPCIVFIDEIDAVGRHDEREQTLNQLLVEMDGFDSKEGIIV
2chqA           RGIDVVRHKIKEFART-------APIGGAPFKIIFLDEADALTADAQAALRRTMEMYSKSCRFILSCNYV
1dooE           VGYVGKEVDSIIRDLTDA-----------AVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTE
3eihB           -------VSKWMGESEKLVKQLFAMARENKPSIIFIDQVDALTGEGESEASRRIKTELLVQMNGVGNDSQ
2chgB           RGIDVVRHKIKEFARTAP-------IGGAPFKIIFLDEADALTADAQAALRRTMEMY-----------SK
3eccA           FRLKHLMDEGKDTKFLKTVLNSPVLV-------LDDLGSERLSDWQRELISYIITYRYNNLKSTIITTNY
2ce7E           ------FVELFVGVGAARVRDLFAQAKAHAPCIVFIDEIDAVGRHEREQTLNQLLVEMDGFDSKEG--II
3d8bA           ---------KWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQESSRRIKTEFLVQLDGSEDRILVVG
2chgC           RGIDVVRHKIKEFARTAP-------IGGAPFKIIFLDEADALTADAQAALRRTMEMYSKSCRFILSCNYV
3cf1B           ----PELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDG
2ce7B           ----SDFVELFVGVGAARVRDLFAQAKAHAPCIVFIDEIDAVGRDEREQTLNQLLVEMDGFDSKEG--II
3clmA           ATLK-AFIDHGTATLTESADEARARLAEIAALGIDVETLAARLQEAFEKLLAPL----------------
2cunA           -----------------------------------MFRLEDFNFHNKTVFLRVDLN----SPMKDGKIIS
3d8bB           -------------EGEKMVRALFAVARCQQPAVIFIDEIDSLLSSRRIKTEFLVQLDGAEDRILVVGATN
2chgA           MNASDERGIDVVRHKIKEFART-APIGGAPFKIIFLDEADALTADAQAALRRTMEMYS-----------K
3ec2A           FRLKHLDEGKDTKFLKTV--------LNSPVLVLDDLGSERLSDWQRELISYIITYRY----------NN
3co5A           --------------------IDPELLQKAEGGVLYVGDIAQYSRNIQTGITFIIGKAERCRVRVIASCSY
2ce7F           -------VELFVGVGAARVRDLFAQAKAHAPCIVFIDEIDAVGRDEREQTLNQLLVEMDGFDS--KEGII
3bosA           ISTALLEG-------------------LEQFDLICIDDVDAVAGHPLWEEAIFDLYNRVAEQKRGSLIVS
3bosB           -------------------ISTALLEGLEQFDLICIDDVDAVAGHPLWEEAIFDLYNR-------VAEQK
3cf2A           --KGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIADRVINQILTEMDGMSTKKNVFIIGANR
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
3co5B           YLIDPELL------------------QKAEGGVLYVGDIAQYSRNIQTGITFIIGKAER----------C
3b2nA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
1d2nA           GFSETAKCQAMKKIFDDAYKSQLSCV--------VVDDIERLLDYVPIGPRFSNLQALLVLLKKAPPQGR
3cnbC           ----------------------------------------------------------------------
1d2iA           FPASNSSLYYEQAQNQLNSLAEYNVFDVPIRLVGLIEDFETDIDIVSTTYA-----DKRYSRTITKRDTV
2c9oB           EIKKTEVLMEN--------FRRAIGLRIKETKEVYEGEVTELTPCSHVTKQLKLDPSIFESLQKERVEAG
3cf1A           ------------------------------------------------------RVINQILTEMDGMSTK
3cnbA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
2ce7C           -----DFVELFVGVGAARVRDLFAQAKAHAPCIVFIDEIDAVGREQTLNQLLVEMDGFDSKEGIIVMAAT
3cfyA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
2auwB           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1do0A           VGYVGKEVDS-----------IIRDLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTE
2ce7D           ----SDFVELFVGVGAARVRDLFAQAKAHAPCIVFIDEIDAVGEREQTLNQLLVEMDGFDSKEGIIVMAA
2c13A           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2auwA           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
2c15A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
1ec9D           YLIPGWTFDNKRPCM-------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1e2hB           LGASETIANIYTTQHRLD--QGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIF
1ab6A           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1delA           FAANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFN
3cg4A           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1ec7D           YLIPGWTFDNKRPCM-------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1e2iB           VLGASETIANIYTTQHRLDQGEISAGDAA-VVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIF
3dqqB           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
1a04A           SRVEAAVWVHQERIF-------------------------------------------------------
5chyA           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
3e7lC           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
3e7lD           ----------------------------------------------------------------------
3e7lA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3bk9B           ----------------------------------------------------------------------
3czpA           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
1e2kB           RVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIF
2c9yA           GSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEK----L
1ec9A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DVRIIAASKGDMEALVAQGTFRQDLLYRLNVVTIPLPPLRERREDIVPLFEHFMLVAAVRYQRPAPILSE
1e32A           RAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKMKLADDVDLEQVANETHGHVG
3e2tA           IRPVGYLSPRDFLAGLAFRVFHCTQYVRHSSDPLYTPECHELLGHVPLLAEPSFAQFSQEIGLASLGASD
3eihC           LVLGATNIPWQLDSAIRRRFERRIYIPLPDLAARTTMFEINVGDTPCVLTKEDYRTLG----AMTEGYSG
3eieA           VLVLGATNIPWQLDSAIRRRFERRIYIPLPDLAARTTMFEINVGDTPCVLTKE---DYRTLGAMTEGYSG
2eb0B           GSEALVVGNKEMFEKAFNVKVEGNSVF--------LEGVMSRKKQVVPPLERAY----------------
3cwoX           ----------------------------------------------------------------------
3dzdA           DIRVISATNKNLEEEIKKGNFREDLYYRLSVFQIYLPPLRERGKDVILLAEYFLKKFAKEYKKNCFELSE
3eihA           GVLVLGATNIWQLDSAIRRRFERRIYIPLPDLAARTTMFEINVGDTPCVLTKEDYRTLGAM---TEGYSG
1e3aA           DKDIRRNYWPDAIRAQLSPEDMSILQGYADGMNAWIDKVNTNPETLLPKQFNTFGFTP---KRWEPFDVA
2bjwA           NVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKPLFPGFTE
2c99A           NVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAQMCREIKLPLFPGFTE
2bjvA           RLVCATNA--DLPAMVNEGTFRADLLDALAFDVVQLPPLRERESDIMLMAEYFAIMCREIKLPLFPGFTE
2a33A           YNSLLSF----IDKAVEEGFISPTAREIIVSAPTA-KELVKKLEE-------------------------
3bijA           ----------------------------------------------------------------------
2c96A           NVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLFGFTE
2c9cA           NVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLFGFTE
2c98A           NVRLVCATNADLPAMVNEGTFRADLLDRLAFDVVQLPPLRERESDIMLMAEYFAIQMCREIKLPLFGFTE
1do2A           QQQEPSAARQAFRKKLREGQLDDKEIEKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGI
1e94E           QQQEPSAARQAFRKKLREGQLDDKEIEKQKARKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGI
1b1cA           VDKRLEQ---------------------------------------------------------------
2azpA           EATLHEDGSVS-VRNVPAYRYRRQV-------SVEVPGIGRVSGDIAWGGNWFFLVAGHGQR-----LAG
1a5tA           LEEPPAETW-FFLATREPERLLATLRSRCRLHYLAPPPEQYAVTWLSREVTMSALLAALRLSAGSPGAAL
3cf0A           VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSANLRKSPVAKDVDLEFLAKMTNGFSGADLTICQR
3b9pA           ATNRPQELDEAALRRFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLA--------KITDGYSG
1a2oA           HDGPPVNRHRPS---VDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMYQAGAWEASCVVFGMPREAI
2ce7A           MAATNRPDILD-PALLRPGRFDKKIVVDPPDMLGRKKILEIHTRNKPLAEDVNLEIIAKRTPG-------
2chqA           S-RIIEPIQSRCAVFRFKPVPKEAMKKRLLEI------CEKEGVKITEDGLEALIYISGGDFRKA-----
1dooE           QQQEPSAARQAFRKKLREGLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICKRGE
3eihB           GVLVLGATNPWQLDSAIRRRFERRIYIPLPDLAARTTMFEINVGDTPCVLTKEDYRTLGAM---TEGYSG
2chgB           SCRFILSCNYVSR-------IIEPIQSRCAVFRFKPVPKEAMKKRLLEICEKEG------------VKIT
3eccA           SLQRSSVRISADLASRLGENVVSKIYEMNELLVIKGSDLR------------------------------
2ce7E           VMAATNRPDILDPALLRPGRFDKKIVVDPPDMLGRKKILEIHTRNKPLAEDVNLEIIAKRTPG-------
3d8bA           ATNRP------------QEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEQIVQQSDAFSG
2chgC           S------------------RIIEPIQSRCAVFRFKPVPKEAMKKRLLEICEKEG-----------VKITE
3cf1B           MSNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKA--------------NLRKSPVAKD
2ce7B           VMAATNRPDILDPALLRPGRFDKKIVVDPPDMLGRKKILEIHTRNKPLAEDVNLEIIAKRTPG-------
3clmA           ----------------------------------------------------------------------
2cunA           DARFKAVLP-TIRYLIESG-------AKVVIGTHQGKPYSEDYTTTEEHARVLSELLDQHVEYIEDIFG-
3d8bB           RPQEIDEA--------ARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIV---QQSDAFSG
2chgA           SCRFILSCNYVSR-------IIEPIQSRCAVFRFKPVPKEAMKKRLLEICEKEGVKI------------T
3ec2A           LKSTIITTNYSLQRSS--VRISADLASRLGEN-VVSKIYENELLVI------------------------
3co5A           AAGS--------------DSCEEKLAGLFSESVVRIPPL-------------------------------
2ce7F           VMAATNRPDILDPALLRPGRFDKKIVVDPPDMLGRKKILEIHTRNKPLAEDVNLEIIAKRTPGFVG----
3bosA           ASASP-----------EAGFVLPDLVSRHWGLTYQLQPDDEK-------------LAALQ-RRAARGLQL
3bosB           RGSLIVSASASPE----AGFVLPDLVSRHWGLTYQLQPDDEK-------------LAALQ-RRAARGLQL
3cf2A           PDIIDPA-------ILRPGRLDQLIYIKSRVAILKANLRKSAKDDLTEICQRACKLAIRESIEVPEHFEE
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
3co5B           RVRVIASCSYA----AGSDSCEEKLAGLFSESVVRIPPL-------------------------------
3b2nA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
1d2nA           KLLIIGTTSRKDVLQEM-------EMLNAFSTTIHVPNIATGEQELLGNFKDKERTTIAQQVKGKKVWIG
3cnbC           ----------------------------------------------------------------------
1d2iA           KGKVIDTNTPNTRRRKRGTIV-------------------------------------------------
2c9oB           DVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDINKVVNKYIDQGIA
3cf1A           KNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVA---------------KD
3cnbA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
2ce7C           NRILDPALLRPGRFDKKIVVDPPDMLGRKKILEIHTRNKPLAEDVNLEIIAKR-----------------
3cfyA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
2auwB           ----------------------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1do0A           QQQEPSAARQAFRKKLREGQLDDKEIEAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKICK
2ce7D           TNRPDILDPALLRPGRFDKKIVVDPPDMLGRKKILEIHTRNKPLAEDVNLEII-----------------
2c13A           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2auwA           ----------------------------------------------------------------------
3c2eA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
2c15A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1e2hB           DRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRYGLLANTVRYLQCGGSWRE
1ab6A           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1delA           KITDVINNIEDQWSVRRLMQALGT-----DLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTR--QD
3cg4A           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1e2iB           DRHPIAALLCYPAARYLMGSMTPQAVLAFVLGALPEDRHIDRLAKRERLDLAMLAAIRRVYGLLANTVRY
3dqqB           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
3e7lC           ----------------------------------------------------------------------
1aw5A           ----------------------------------------------------------------------
3e7lD           ----------------------------------------------------------------------
3e7lA           ----------------------------------------------------------------------
2a1tS           ----------------------------------------------------------------------
3bk9B           ------------IHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQ-AQTSELWLKLLAHELR
3czpA           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
1e2kB           DRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRL--------------
2c9yA           DSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT
1ec9A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           MQRQQLMQRPWPGNVRELRNAADRLVLGVPEGGHAGGKADPVDESTPLRERMERYERAVIADTLARTGGA
1e32A           ADLAALCSEAALQAIRKKMDLIDLEDE-------------------------------------------
3e2tA           EAVQKLATCYFFGLCKQEGQLRVYGAGLLSSIS------ELKHSLSGSAK-----VKPFDPKVTCKQECL
3eihC           SDIAVVVKDALMQPIRKIQSATHFKDV-----STEDDETRKLTPCSPDDGAIEMSWTDIEADELKEPDLT
3eieA           SDIAVVVKDALMQPIRKIQSATHFKDVSPCSPGDDGAIEMSWTDIEADELKEPDLTIKDFLKAIKSTRPT
2eb0B           ----------------------------------------------------------------------
3cwoX           ----------------------------------------------------------------------
3dzdA           ET-KEYLKQEWKGNVRELKNLIERAVI-------------------------------------------
3eihA           SDIAVVVKDALMQPIRKIQSATHFGDDGAIEMSWTDIEADELKEPDLTIKDFLKAIKSTRPTVNEDDLLK
1e3aA           MIFVGTMANRFSDSTSEIDNLALLTALKDKYWLVNPSAPTTIAVQESNYPLKFNQQNSQTAALLPRYDLP
2bjwA           RARETLLNYRWPGNIRELKNVVERSVY-------------------------------------------
2c99A           RARETLLNYRWPGNIRELKNVVERSVY-----RHGTSDYPLDDIIIDPFKR-------------------
2bjvA           RARETLLNYRWPGNIRELKNVVERSVY-------------------------------------------
2a33A           ----------------------------------------------------------------------
3bijA           ----------------------------------------------------------------------
2c96A           RARETLLNYRWPGNIRELKNVVERSVY-------------------------------------------
2c9cA           RARETLLNYRWPGNIAELKNVVERSVY-------------------------------------------
2c98A           RARETLLNYRWPGNIRELKNVVERSVY-----RHGTSDYPLDDIIIDPFKR-------------------
1do2A           VFIDEIDKICKRGESSGPDVSREGVQ--------------------------------------------
1e94E           VFIDEIDKICKRGESSGPDVSRE-----------------------------------------------
1b1cA           ----------------------------------------------------------------------
2azpA           DNLDALTAYTVAQALDDQDIRGEDGGAILFADDPHADSRNFVLCPGKAYDRSPCGTGTSAKLACLAADGK
1a5tA           A--------LFQGDNWQARETLCQALALNHEQAPARLHWLATLLMDAVPGLVAELANHLSPSRLQAILGD
3cf0A           ACKLAIRESIESEIVPEIRRDHFEEAMR------------------------------------------
3b9pA           SDLTALAKDAALEPIRELNISAMRAIT-----EQDFHSSLKRIRRSVAPQSLNSYEK-------------
1a2oA           NMGGVSEVVDLSQVSQQMLAKISA----------------------------------------------
2ce7A           ----------------------------------------------------------------------
2chqA           --INALQGAAAIGEVVDADTIYQIT---------------------------------------------
1dooE           SSGPDVSREGVQRDLLPLVEGCTVST--------------------------------------------
3eihB           SDIAVVVKDALMQPIRKIQSATHFKDV-----STEDDETRKLTPCSPDDGAIEMSWTDIEADELKEPDLT
2chgB           EDGLEALIYISGGDFRKAINALQGAAA-------------------------------------------
3eccA           ----------------------------------------------------------------------
2ce7E           ----------------------------------------------------------------------
3d8bA           ADMTQLCREASLGPIRSLQTVRPIAYI------DFENAFRTVRPS-VSPKDLELYEN-------------
2chgC           DGLEALIYI-SGGDFRKAINALQGAAA-------------------------------------------
3cf1B           VDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIVPEIRRDH-FEEAMRFARRSVSDNDIRK----
2ce7B           ----------------------------------------------------------------------
3clmA           ----------------------------------------------------------------------
2cunA           RYAREKIKELKSGEVAILEN--------------------------------------------------
3d8bB           ADMTQLCREASLGPIRSLQTAATITPDQVRAYIDFENAFRTVRPS-VSPKDLELYENW------------
2chgA           EDGLEALIYISGGDFRKAINALQGAAA-------------------------------------------
3ec2A           ----------------------------------------------------------------------
3co5A           ----------------------------------------------------------------------
2ce7F           ----------------------------------------------------------------------
3bosA           PEDVGRFLLNRARDLRTLFDVLDRLDK-------------------------------------------
3bosB           PEDVGRFLLNRARDLRTLFDVLDRLDK-------------------------------------------
3cf2A           AMEM------------------------------------------------------------------
3dgeC           ----------------------------------------------------------------------
1b00A           ----------------------------------------------------------------------
3co5B           ----------------------------------------------------------------------
3b2nA           ----------------------------------------------------------------------
1bqgA           ----------------------------------------------------------------------
1d2nA           IKKEMSLQMDPEYRVRKFLALLREEG--------------------------------------------
3cnbC           ----------------------------------------------------------------------
1d2iA           ----------------------------------------------------------------------
2c9oB           ELVPGVLFVDEVHMLDIECF--------------------------------------------------
3cf1A           VDLEFLAKMTNGFSGADLTEICQRACK-LAIRESIESEIVPEIRRDHFEEAMRFARRSVSDNDIRK----
3cnbA           ----------------------------------------------------------------------
1dbwA           ----------------------------------------------------------------------
1dbwB           ----------------------------------------------------------------------
2a9oA           ----------------------------------------------------------------------
3c3wB           ----------------------------------------------------------------------
3dgfC           ----------------------------------------------------------------------
2ce7C           ----------------------------------------------------------------------
3cfyA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1dc7A           ----------------------------------------------------------------------
3cu5A           ----------------------------------------------------------------------
1bknA           ----------------------------------------------------------------------
1be1A           ----------------------------------------------------------------------
3cu5B           ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
2a9rA           ----------------------------------------------------------------------
2ayxA           ----------------------------------------------------------------------
2auwB           ---------PKLTAVEALAPYRLRTTWSTGEVLEEWFDTEFGRDNVYAWAKEQAGEVSHEFGDWHRNNLS
2ch4B           ----------------------------------------------------------------------
3cz5B           ----------------------------------------------------------------------
1d5wB           ----------------------------------------------------------------------
2a9qA           ----------------------------------------------------------------------
1c4wA           ----------------------------------------------------------------------
1do0A           RGESSGPDVSR-----------------------------------------------------------
2ce7D           ----------------------------------------------------------------------
2c13A           ----------------------------------------------------------------------
1dc8A           ----------------------------------------------------------------------
2auwA           ---------PKLTAVEALAPYRLRTTWSTGEVLEEWFDTEFGRDNVYAWAKEQAGEVSHEFGDWHRNNLS
3c2eA           ----------------------------------------------------------------------
3c97A           ----------------------------------------------------------------------
1ccwA           ----------------------------------------------------------------------
2ayzA           ----------------------------------------------------------------------
3b8mC           ----------------------------------------------------------------------
1dcmA           ----------------------------------------------------------------------
1e51A           ----------------------------------------------------------------------
1b1aA           ----------------------------------------------------------------------
2d00A           ----------------------------------------------------------------------
1bmtA           ----------------------------------------------------------------------
1b63A           ----------------------------------------------------------------------
2c15A           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1b62A           ----------------------------------------------------------------------
1ab5A           ----------------------------------------------------------------------
3cz5C           ----------------------------------------------------------------------
1ec9D           ----------------------------------------------------------------------
3cz5A           ----------------------------------------------------------------------
1d4zA           ----------------------------------------------------------------------
2ch4A           ----------------------------------------------------------------------
3c3wA           ----------------------------------------------------------------------
3cg0A           ----------------------------------------------------------------------
2b4aA           ----------------------------------------------------------------------
1chnA           ----------------------------------------------------------------------
1e2hB           DWGQLSGPQSNAGPRPHIG---DTLFTLFRAPELLAPNGDLYNVFAWALDVLAKRLRSMHVFILDYDQSP
1ab6A           ----------------------------------------------------------------------
1cyeA           ----------------------------------------------------------------------
1djmA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
1e6mA           ----------------------------------------------------------------------
1delA           HEMDAARAMGATVIHVVRPGQKSND---------------------------------------------
3cg4A           ----------------------------------------------------------------------
3cg0B           ----------------------------------------------------------------------
3chyA           ----------------------------------------------------------------------
1ec7D           ----------------------------------------------------------------------
3c3mA           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
2cheA           ----------------------------------------------------------------------
1e2iB           LQCGGSWREDWSGPQSNAGPRPDTLFTLFRAPELLAPNGDLYNVFAWALDVLAKRLRSMHVFILDYDQSP
3dqqB           ----------------------------------------------------------------------
1e51B           ----------------------------------------------------------------------
1a04A           ----------------------------------------------------------------------
5chyA           ----------------------------------------------------------------------
3crnB           ----------------------------------------------------------------------
1e6kA           ----------------------------------------------------------------------
1ehcA           ----------------------------------------------------------------------
6chyA           ----------------------------------------------------------------------
2c13B           ----------------------------------------------------------------------
1e1cA           ----------------------------------------------------------------------
1e6lA           ----------------------------------------------------------------------
3crnA           ----------------------------------------------------------------------
3b8nA           ----------------------------------------------------------------------
2c19B           ----------------------------------------------------------------------
3e7lC           -----------------------------------------------LKEAKKEFEKIFIEEKLREYDYD
1aw5A           ----------------------------------------------------------------------
3e7lD           -----------------------------------------------LKEAKKEFEKIFIEEKLREYDYD
3e7lA           -----------------------------------------------LKEAKKEFEKIFIEEKLREYDYD
2a1tS           ----------------------------------------------------------------------
3bk9B           AAIVHLQRDEVWQCRKVLAR--------------------------------------------------
3czpA           ----------------------------------------------------------------------
2dvyD           ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
2chuA           ----------------------------------------------------------------------
2c14B           ----------------------------------------------------------------------
1eb3A           ----------------------------------------------------------------------
2c15B           ----------------------------------------------------------------------
2c18B           ----------------------------------------------------------------------
1e2kB           ----------------------------------------------------------------------
2c9yA           QTTPLIEYYRKRGIHSAIDASQTP----------------------------------------------
1ec9A           ----------------------------------------------------------------------
1ea6B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VSQAADLLQVGKATLYDKIKRYGL
1e32A           ------------------------
3e2tA           ITTFQEVYFVSESEAKEKMREFA-
3eihC           IKDFLKAIKSTRPTVNEDDLLK--
3eieA           VNEDDL------LKQEQFTRDFG-
2eb0B           ------------------------
3cwoX           ------------------------
3dzdA           ------------------------
3eihA           QEQFTRDFGQEG------------
1e3aA           APMLD-------------------
2bjwA           ------------------------
2c99A           ------------------------
2bjvA           ------------------------
2a33A           ------------------------
3bijA           ------------------------
2c96A           ------------------------
2c9cA           ------------------------
2c98A           ------------------------
1do2A           ------------------------
1e94E           ------------------------
1b1cA           ------------------------
2azpA           LLPGQPWRQASVIGSQFEGRYEW-
1a5tA           VCHIREQLMS--------------
3cf0A           ------------------------
3b9pA           ------------------------
1a2oA           ------------------------
2ce7A           ------------------------
2chqA           ------------------------
1dooE           ------------------------
3eihB           IKDFLKAIKSTRPTVNEDLLKQ--
2chgB           ------------------------
3eccA           ------------------------
2ce7E           ------------------------
3d8bA           ------------------------
2chgC           ------------------------
3cf1B           ------------------------
2ce7B           ------------------------
3clmA           ------------------------
2cunA           ------------------------
3d8bB           ------------------------
2chgA           ------------------------
3ec2A           ------------------------
3co5A           ------------------------
2ce7F           ------------------------
3bosA           ------------------------
3bosB           ------------------------
3cf2A           ------------------------
3dgeC           ------------------------
1b00A           ------------------------
3co5B           ------------------------
3b2nA           ------------------------
1bqgA           ------------------------
1d2nA           ------------------------
3cnbC           ------------------------
1d2iA           ------------------------
2c9oB           ------------------------
3cf1A           ------------------------
3cnbA           ------------------------
1dbwA           ------------------------
1dbwB           ------------------------
2a9oA           ------------------------
3c3wB           ------------------------
3dgfC           ------------------------
2ce7C           ------------------------
3cfyA           ------------------------
1dcfA           ------------------------
1dc7A           ------------------------
3cu5A           ------------------------
1bknA           ------------------------
1be1A           ------------------------
3cu5B           ------------------------
1d5wA           ------------------------
2a9rA           ------------------------
2ayxA           ------------------------
2auwB           LTTAAEALGISRRVSYYRTAHKII
2ch4B           ------------------------
3cz5B           ------------------------
1d5wB           ------------------------
2a9qA           ------------------------
1c4wA           ------------------------
1do0A           ------------------------
2ce7D           ------------------------
2c13A           ------------------------
1dc8A           ------------------------
2auwA           LTTAAEALGISRRVSYYRTAHKII
3c2eA           ------------------------
3c97A           ------------------------
1ccwA           ------------------------
2ayzA           ------------------------
3b8mC           ------------------------
1dcmA           ------------------------
1e51A           ------------------------
1b1aA           ------------------------
2d00A           ------------------------
1bmtA           ------------------------
1b63A           ------------------------
2c15A           ------------------------
1dz3A           ------------------------
1b62A           ------------------------
1ab5A           ------------------------
3cz5C           ------------------------
1ec9D           ------------------------
3cz5A           ------------------------
1d4zA           ------------------------
2ch4A           ------------------------
3c3wA           ------------------------
3cg0A           ------------------------
2b4aA           ------------------------
1chnA           ------------------------
1e2hB           AGCRDALLQLTSGMVQ--------
1ab6A           ------------------------
1cyeA           ------------------------
1djmA           ------------------------
3breB           ------------------------
1e6mA           ------------------------
1delA           ------------------------
3cg4A           ------------------------
3cg0B           ------------------------
3chyA           ------------------------
1ec7D           ------------------------
3c3mA           ------------------------
3breA           ------------------------
2cheA           ------------------------
1e2iB           AGCRDALLQLTSGMVQ--------
3dqqB           ------------------------
1e51B           ------------------------
1a04A           ------------------------
5chyA           ------------------------
3crnB           ------------------------
1e6kA           ------------------------
1ehcA           ------------------------
6chyA           ------------------------
2c13B           ------------------------
1e1cA           ------------------------
1e6lA           ------------------------
3crnA           ------------------------
3b8nA           ------------------------
2c19B           ------------------------
3e7lC           LKRTAEEIGIDLSNLYRKIKSLNI
1aw5A           ------------------------
3e7lD           LKRTAEEIGIDLSNLYRKIKSLNI
3e7lA           LKRTAEEIGIDLSNLYRKIKSLNI
2a1tS           ------------------------
3bk9B           ------------------------
3czpA           ------------------------
2dvyD           ------------------------
1dv7A           ------------------------
2chuA           ------------------------
2c14B           ------------------------
1eb3A           ------------------------
2c15B           ------------------------
2c18B           ------------------------
1e2kB           ------------------------
2c9yA           ------------------------
1ec9A           ------------------------
1ea6B           ------------------------