[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07164.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1d4zA.bssp"
#ERROR : Can't open dsspfile "3cfyA.bssp"
#ERROR : Can't open dsspfile "3cu5A.bssp"
#ERROR : Can't open dsspfile "1e6kA.bssp"
#ERROR : Can't open dsspfile "1e51B.bssp"
#ERROR : Can't open dsspfile "3dgeC.bssp"
#ERROR : Can't open dsspfile "3cz5B.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "3chyA.bssp"
#ERROR : Can't open dsspfile "1ab6A.bssp"
#ERROR : Can't open dsspfile "1djmA.bssp"
#ERROR : Can't open dsspfile "2a9rA.bssp"
#ERROR : Can't open dsspfile "1chnA.bssp"
#ERROR : Can't open dsspfile "2ch4B.bssp"
#ERROR : Can't open dsspfile "1ehcA.bssp"
#ERROR : Can't open dsspfile "2cheA.bssp"
#ERROR : Can't open dsspfile "1ab5A.bssp"
#ERROR : Can't open dsspfile "1e6lA.bssp"
#ERROR : Can't open dsspfile "3cg0A.bssp"
#ERROR : Can't open dsspfile "1cyeA.bssp"
#ERROR : Can't open dsspfile "6chyA.bssp"
#ERROR : Can't open dsspfile "1e1cA.bssp"
#ERROR : Can't open dsspfile "3cg0B.bssp"
#ERROR : Can't open dsspfile "2a9oA.bssp"
#ERROR : Can't open dsspfile "5chyA.bssp"
#ERROR : Can't open dsspfile "1e6mA.bssp"
#ERROR : Can't open dsspfile "3cnbC.bssp"
#ERROR : Can't open dsspfile "2c15A.bssp"
#ERROR : Can't open dsspfile "1e51A.bssp"
#ERROR : Can't open dsspfile "3cnbA.bssp"
#ERROR : Can't open dsspfile "1c4wA.bssp"

## Summary of PDB Search
:219
    7e-07  20%  1d4zA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    9e-07  15%  3cfyA  [x.x.x] PUTATIVE LUXO REPRESSOR PROTEIN
    2e-06  17%  3cu5A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATOR, ARAC
    3e-06  20%  1e6kA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    6e-06  12%  1e51B  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    1e-05  16%  3dgeC  [x.x.x] RESPONSE REGULATOR
    1e-05  20%  3cz5B  [x.x.x] TWO-COMPONENT RESPONSE REGULATOR, LUXR FAMILY
    2e-05  22%  1b00A  [c.23.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    2e-05  20%  3chyA  [c.23.1 (1a0oA)] CHEY
    2e-05  20%  1ab6A  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    3e-05  21%  1djmA  [c.23.1] CHEMOTAXIS PROTEIN Y
    4e-05  17%  2a9rA  [x.x.x] DNA-BINDING RESPONSE REGULATOR
    4e-05  21%  1chnA  [x.x.x] CHEY
    4e-05   7%  2ch4B  [x.x.x] CHEMOTAXIS PROTEIN CHEA
    5e-05  18%  1ehcA  [x.x.x] CHEY
    6e-05  19%  2cheA  [x.x.x] CHEY
    7e-05  20%  1ab5A  [c.23.1] CHEY
    7e-05  20%  1e6lA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    8e-05  16%  3cg0A  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    8e-05  19%  1cyeA  [x.x.x] CHEY
    9e-05  19%  6chyA  [c.23.1] CHEY
    1e-04  14%  1e1cA  [c.1.19 - c.23.6] METHYLMALONYL-COA MUTASE ALPHA CHAIN
    1e-04  16%  3cg0B  [x.x.x] RESPONSE REGULATOR RECEIVER MODULATED DIGUANYLATE
    2e-04  20%  2a9oA  [x.x.x] RESPONSE REGULATOR
    3e-04  19%  5chyA  [x.x.x] CHEY
    3e-04  21%  1e6mA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
    4e-04  11%  3cnbC  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    5e-04  10%  2c15A  [x.x.x] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    7e-04  14%  1e51A  [c.1.10] DELTA-AMINOLEVULINIC ACID DEHYDRATASE
    8e-04  12%  3cnbA  [x.x.x] DNA-BINDING RESPONSE REGULATOR, MERR FAMILY
    0.001  17%  1c4wA  [c.23.1] CHEMOTAXIS PROTEIN CHEY
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxLRILLVRDPHEADPLNVETIRAGLAQAGFTEVQTVDADLRLP
1d4zA           ----------------------------LKFLVVDD----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
3cfyA           -----------------------------RVLLVED----STSLAILYKQYVKDEPYDIFHVETGRDAI-
3cu5A           ----------------------------LRILIVDD----EKLTRDGLIANINWKALDQIDQADDGINAI
1e6kA           ----------------------------LKFLVVAD----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
1e51B           --------------------------------------SYSAKFASCFYGPFRDAARRCQLPPGARGLAL
3dgeC           ----------------------------KKVLLVDD----SAVLRKIVSFNLKKEGY-EVIEAENGQIAL
3cz5B           ----------------------------ARIMLVDD----HPIVREGYRRLIERRPGYAVVAEAADAEAY
1b00A           ----------------------------RRILVVED----EAPIREMVCFVLEQNGFQPVEAEDYDSAV-
3chyA           ----------------------------LKFLVVDD----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
1ab6A           ----------------------------LKFLVVDD----NSTMRRIVRNLLKELGFNNVEEAEDGVDAL
1djmA           ----------------------------LKFLVVDD----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
2a9rA           -----------------------------KILIVDD----EKPISDIIKFNMTKEGYEVVTAFNGREAL-
1chnA           ----------------------------LKFLVVDD----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
2ch4B           ----------------------------------------KEDIQRVQDRDVIVIRGEVIPVYRLWEVLI
1ehcA           ----------------------------LKFLVVDK----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
2cheA           ----------------------------LKFLVVDD----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
1ab5A           ----------------------------LKFLVVDD----NSTMRRITRNLLKELGFNNVEEAEDGVDAL
1e6lA           ----------------------------LKFLVVDA----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
3cg0A           -----------------------------GVLIVED----GRLAAATLRIQLESLGYDVLGVFDNGEEAV
1cyeA           ----------------------------LKFLVVDD----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
6chyA           ----------------------------LKFLVVDD----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
1e1cA           -----------------------------RILLAKMGQDGHDRGQKVIATAYADLGFDVGPLFQTPEETA
3cg0B           -----------------------------GVLIVED----GRLAAATLRIQLESLGYDVLGVFDNGEEAV
2a9oA           -----------------------------KILIVDD----EKPISDIIKFNMTKEGY-EVVTAFNGREAL
5chyA           ----------------------------LKFLVVDD----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
1e6mA           ----------------------------LKFLVVDD----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
3cnbC           ----------------------------FSILIIED----DKEFADMLTQFLENLFPAKIKIAYNPFDAG
2c15A           ----------------------------------------DAVGSASNLGKGNKATYQMDPANSDEALH-
1e51A           ----------------------------------------YGPFRDAAKSSPAFGDRCYQLPPGARGLAL
3cnbA           ----------------------------FSILIIED----DKEFADMLTQFLENLFPAKIKIAYNPFDAG
1c4wA           ----------------------------LKFLVVDD----FSTMRRIVRNLLKELGFNNVEEAEDGALNK


                         .         .         *         .         .         .         .:140
query           DTITASQPDLVIIASESAARDTIEHVCVSTQHAPRPIVLFTDNDDAQRIKAALSAGITAYIVDGLRAERV
1d4zA           NKLQAGGYGFVISDWNMPNMDGLELLKTIRADGALPVLMVTAEAKKENVIAAAQAGASGYVVKPFTAATL
3cfyA           QFIERSKPQLIILDLKLPDMSGEDVLDWINQNDIPSVIIATAHGSVDLAVNLIQKGAEDFLEKPINADRL
3cu5A           QIALKHPPNVLLTDVRMPRMDGIELVDNILKLYPDCSVIFMSGYSD-----KEYLRAIRYVEKPIDPSEI
1e6kA           NKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL
1e51B           RAVDRDVREGADMLMVKPGMPYLDVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMRA
3dgeC           EKLSEFTPDLIVLDIMMPVMDGFTVLKEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQF
3cz5B           RLYRETTPDIVVMDLTLPGPGGIEATHIRQWDGAARILIFTMHQGSAFALKAFEAGASGYVTKSSDPAEL
1b00A           NQLNEPWPDLILLDWMLPGGSGIQHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKEL
3chyA           NKLQAGGYGFVISDWNMPNMDLLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL
1ab6A           NKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALMTTAEAKKENIIAAAQAGASGYVVKPFTAATL
1djmA           NKLQAGGYGFVISDWNMPNMDGLETIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL
2a9rA           -EQFEAEQPDIIILLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNREL
1chnA           NKLQAGGYGFVISDWNMPNMDGLELLKTIRADGALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL
2ch4B           EHKEELEEMEAVIVRVGNRKYGIV-VDDLLGQDDIVIKSLGKVFSEVKEFSGAAILGDGSIA--------
1ehcA           NKLQAGGYGFVISMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL
2cheA           NKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALMVTAEAKKENIIAAAQAGASGYVVKPFTAATL
1ab5A           NKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL
1e6lA           NKLQAGGYGFVISDWNMPNMDGLELLKTDGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL
3cg0A           RCAPDLRPDIALVDIMLCGALDGVETAARLAAGCLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAADTL
1cyeA           NKLQAGGYGFVISMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL
6chyA           NKLQAGGYGFVISDWNMPNMDGLELLKTIRADGALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATL
1e1cA           RQAVEADVHVVGVSSLAGGHLTLVPALLDKLGRPDILITVGGVIPEQDFDELRKDGAVEIYTPGTVPESA
3cg0B           RCAPDLRPDIALVDIMLCGALDGVETARLAAGCNLPIIFITSSQDVETFQRAKRVNPFGYLAKPVAADTL
2a9oA           EQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNREL
5chyA           NKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSVLMVTAEAKKENIIAAAQAGASGWVVKPFTAATL
1e6mA           NKLQAGGYGFVISAWNMPNMDLLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL
3cnbC           DLLHTVKPDVVMLDLMMVGMDGFSICHRIKSTPATAVIAMTGALTDDNVSRIVALGAETCFGKPLNFTLL
2c15A           --EVAADLAEGADMVMVPGMPYLDIVRRVKDEFRAPTFVYQVSGEYAMHMGAIQNGWLAESVILESLTAF
1e51A           RAVDRDVREGADMLMVKPGMPYLDIVRVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMRA
3cnbA           DLLHTVKPDVVMLDLMMVGMDGFSRIKSTPATANIIVIAMTGALTDDNVSRIVALGAETCFGKPLNFTLL
1c4wA           LQAGGYGFVISWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL


                         +         .         .         .         .         *         .:210
query           KTVLDVAYARFQLDQQLRAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1d4zA           EEKLNKIFEKLGM---------------------------------------------------------
3cfyA           KTSVALHLKRAKLEDLVEG---------------------------------------------------
3cu5A           MDALKQSIQTVLQHQAQQ----------------------------------------------------
1e6kA           EEKLNKIFEKLGM---------------------------------------------------------
1e51B           GADIIITYYTPQLLQWLK----------------------------------------------------
3dgeC           IEEV------------------------------------------------------------------
3cz5B           VQAIEAILAGRRAMSPDIAQ--------------------------------------------------
1b00A           VARIKAVMRR------------------------------------------------------------
3chyA           EEKLNKIFEKLGM---------------------------------------------------------
1ab6A           EEKLNKIFEKLGM---------------------------------------------------------
1djmA           EEKLNKIFEKLGM---------------------------------------------------------
2a9rA           QARVKALLRR------------------------------------------------------------
1chnA           EEKLNKIFEKLGM---------------------------------------------------------
2ch4B           ----------------------------------------------------------------------
1ehcA           EEKLNKIFEKLGM---------------------------------------------------------
2cheA           EEKLNKIFEKLGM---------------------------------------------------------
1ab5A           EEKLNKIFEKLGM---------------------------------------------------------
1e6lA           EEKLNKIFEKLGM---------------------------------------------------------
3cg0A           HRSIEMAIHKKKLEE-------------------------------------------------------
1cyeA           EEKLNKIFEKLGM---------------------------------------------------------
6chyA           EEKLNKIFEKLGM---------------------------------------------------------
1e1cA           ISLVKKLRAS------------------------------------------------------------
3cg0B           HRSIEMAIHKKKLEE-------------------------------------------------------
2a9oA           QARVKALLRR------------------------------------------------------------
5chyA           EEKLNKIFEKLGM---------------------------------------------------------
1e6mA           EEKLNKIFEKLGM---------------------------------------------------------
3cnbC           EKTIKQLVEQ------------------------------------------------------------
2c15A           KRAGADGILTYFAKQAAE----------------------------------------------------
1e51A           GADIIITYYTPQLLQWLK----------------------------------------------------
3cnbA           EKTIKQLVEQKK----------------------------------------------------------
1c4wA           EEKLNKIFEKLGM---------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxx
1d4zA           ---------
3cfyA           ---------
3cu5A           ---------
1e6kA           ---------
1e51B           ---------
3dgeC           ---------
3cz5B           ---------
1b00A           ---------
3chyA           ---------
1ab6A           ---------
1djmA           ---------
2a9rA           ---------
1chnA           ---------
2ch4B           ---------
1ehcA           ---------
2cheA           ---------
1ab5A           ---------
1e6lA           ---------
3cg0A           ---------
1cyeA           ---------
6chyA           ---------
1e1cA           ---------
3cg0B           ---------
2a9oA           ---------
5chyA           ---------
1e6mA           ---------
3cnbC           ---------
2c15A           ---------
1e51A           ---------
3cnbA           ---------
1c4wA           ---------