[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07169.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bccA.bssp"
#ERROR : Can't open dsspfile "3cwbA.bssp"
#ERROR : Can't open dsspfile "3cwbN.bssp"
#ERROR : Can't open dsspfile "3cwbO.bssp"
#ERROR : Can't open dsspfile "3e50A.bssp"
#ERROR : Can't open dsspfile "3cwwA.bssp"
#ERROR : Can't open dsspfile "3cwbB.bssp"
#ERROR : Can't open dsspfile "3e4aA.bssp"
#ERROR : Can't open dsspfile "1be3B.bssp"
#ERROR : Can't open dsspfile "3e4zA.bssp"
#ERROR : Can't open dsspfile "3e50B.bssp"
#ERROR : Can't open dsspfile "3d3yA.bssp"
#ERROR : Can't open dsspfile "3cx5A.bssp"
#ERROR : Can't open dsspfile "1bccB.bssp"
#ERROR : Can't open dsspfile "3cx5B.bssp"
#ERROR : Can't open dsspfile "3e4zB.bssp"

## Summary of PDB Search
:454
    6e-56  15%  1bccA  [d.185.1 - d.185.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    5e-55  15%  3cwbA  [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
    7e-55  15%  3cwbN  [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
    2e-54  14%  3cwbO  [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
    4e-52  13%  3e50A  [x.x.x] INSULIN-DEGRADING ENZYME
    4e-52  14%  3cwwA  [x.x.x] INSULIN-DEGRADING ENZYME
    1e-51  16%  3cwbB  [x.x.x] MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
    1e-51  11%  3e4aA  [x.x.x] INSULIN-DEGRADING ENZYME
    2e-51  14%  1be3B  [d.185.1 - d.185.1] CYTOCHROME BC1 COMPLEX
    2e-51  14%  3e4zA  [x.x.x] INSULIN-DEGRADING ENZYME
    2e-50  13%  3e50B  [x.x.x] INSULIN-DEGRADING ENZYME
    1e-48  14%  3d3yA  [x.x.x] UNCHARACTERIZED PROTEIN
    1e-47  17%  3cx5A  [d.185.1 - d.185.1 (1kb9A)] CYTOCHROME B-C1 COMPLEX SUBUNIT
    4e-47  15%  1bccB  [d.185.1 - d.185.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    7e-41  13%  3cx5B  [d.185.1 - d.185.1 (1ezvB)] CYTOCHROME B-C1 COMPLEX SUBUNIT
    8e-17  17%  3e4zB  [x.x.x] INSULIN-DEGRADING ENZYME
:454

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPIESWTASTGAKVFFVPSPSIPMLDVNIDFDAG
1bccA           --------------------------------------TQVSQLDNGVRVASEQSSQ-PTCTVGVWIDAG
3cwbA           --------------------------------------TNVTTLDNGLRVASEESSQ-PTCTVGVWIGAG
3cwbN           --------------------------------------TNVTTLDNGLRVASEESSQ-PTCTVGVWIGAG
3cwbO           --------------------------------------LEITKLPNGLIIASLENFS-PASRIGVFIKAG
3e50A           --------------------------------------YRGLELANGIKVLLISDPTTDKSSAALDVHIG
3cwwA           -------------------------------------EYRGLELANGIKVLLISDPTTDKSSAALDVHIG
3cwbB           --------------------------------------LEITKLPNGLIIASLENFS-PASRIGVFIKAG
3e4aA           --------------------------------------PALIKDTAMSKLWFKQDDFLPKANLNFEFFSP
1be3B           -------------------------------------DLEFTRLPNGLVIASLENYA-PASRIGLFIKAG
3e4zA           -------------------------------------EYRGLELANGIKVLLISDPTTDKSSAALDVHIG
3e50B           -------------------------------------EYRGLELANGIKVLLISDPTTDKSSAALDVHIG
3d3yA           ---------------------------------------ASVQLVKGVNLHVIPTEKYKTVRLLVRFNTR
3cx5A           ---------------------------------------EVTQLSNGIVVATEHNPSAHTASVGVVFGSG
1bccB           -------------------------------------DLEITKLPNGLVIASLENYS-PGSTIGVFIKAG
3cx5B           ----------------------------------------------------------------------
3e4zB           ----------------------------------------------GIKVLLISDPTTDKSSAALDVHIG


                         .         .         *         .         .         .         .:140
query           SRYDPPXXXXXXXXXXXXXXXXXSAQDGQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPER
1bccA           SRYESEKNNGAGYFLEHLAFKGT---KNRPQNALEKEVESMGAHLNAYSSREHTAYYIK-----ALSKDV
3cwbA           SRYENEKNNGAGYFVEHLAFKGT---KKRPCAAFEKEVESMGAHFNGYTSREQTAFYIK-----ALSKDM
3cwbN           SRYENEKNNGAGYFVEHLAFKGT---KKRPCAAFEKEVESMGAHFNGYTSREQTAFYIK-----ALSKDM
3cwbO           SRYETTANLGTAHLLRLASPLTT---KGASSFRITRGIEAVGGSLSVYSTREKMTYCVE-----CLRDHV
3e50A           SLSDPPNIAGLSHFCQHMLF---LGTKKYPKENE----YSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHL
3cwwA           SLSDPPNIAGLSHFLQHMLF---LGTKKYPKENE----YSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHL
3cwbB           SRYETT----------------------------------------------------------------
3e4aA           FAYVDPLHSNMAYLYLELLKDSLNEYAYAAELAGLSYDLQNTIYGMYLSVK-------------GYNDKQ
1be3B           SRYENSNNLGTSHLLRLASSLTTKGASFKITRGIEAVGGKLSVTSTRENMAYTVE---------CLRDDV
3e4zA           SLSDPPNIAGLSHFLQHMLF---LGTKKYPKENE----YSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHL
3e50B           SLSDPPNIAGLSHFCQHMLF---LGTKKYPKENE----YSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHL
3d3yA           LNHETITKRTLLSSLETNSLNYPNQVKLSERLAELYGASFGIGVSKKGNQHWFNISNIVNDHYLQDSQVL
3cx5A           AANENP----------------------------------------------------------------
1bccB           SRYENSSNLGTSHLLRLASSLTTKGASFKITRGIEAVGGKLSVESTRENMAYTVE---------CLRDDV
3cx5B           ----------------------------------------------------------------------
3e4zB           SLSDPPNIAGLSHFLQHMLFLGTK---KYPKENEYSQFLSEHAGSSNAFTSGEHTNYYF-----DVSHEH


                         +         .         .         .         .         *         .:210
query           EQSLRLAAQLIKSPTYPDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSIT
1bccA           PKAVELLADIVQNCSLEDSQIEKERDVIVRELQENDTSMREVVFNYLHATAFQGTGLAQSGPSENIRKLS
3cwbA           PKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTGTTENIKHLT
3cwbN           PKVVELLADVVQNCALEESQIEKERGVILQELKEMDNDMTNVTFDYLHATAFQGTALARTGTTENIKHLT
3cwbO           DTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVGVLENL-HAAAYKTALANPCPDYRIGKIT
3e50A           EGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGNKYTLETRV
3cwwA           EGALDRFAQFFLSPLFDESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGNKYTLETRV
3cwbB           DTVMEYLLNVTTAPEFRPWEVTDLQPQLKVDKAVAFQSPQVGVLENL-HAAAYKTALANPCPDYRIGKIT
3e4aA           PILLKKIIEKMATFEIDEKRFEIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEALDDVT
1be3B           DILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENL-HAAAYRNALANSCPDYRIGKVT
3e4zA           EGALDRFAQFFLSPLFDESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGNKYTLETRV
3e50B           EGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGNKYTLETRV
3d3yA           AEAVDFLKEIIFAPNFEAETFQREKENLKAYLESIVEDKQTYASLALQSVYFNQSEDQKIPSFGTVAALA
3cx5A           DKSLDFLNQSFIQQLLSSSNFEATKKSVLKQVQDFDNDHPNRVLEHLHSTAFQNTPLSLPGTLESLENLV
1bccB           EILMEFLLNVTTAPEFRPWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYR-NALADSCPDYRIGKVT
3cx5B           PYYVNALADVLYKTAFKPHELTESVLPAARYYAVAEQCPVKSAEDQLYAITFR-KGLGNPLLYDGVERVS
3e4zB           EGALDRFAQFFLSPLFDESAKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTKYTLETRV


                         .         .         .         +         .         .         .:280
query           HDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPHPAQQ
1bccA           RADLTEYLSTHYTAPRMVLAAAGGVEHQQLLELAQKHFGGVPFTYDDDAVPTLSKCRFTGSQIRHRGLPL
3cwbA           RADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSEIRARALPV
3cwbN           RADLASYIDTHFKAPRMVLAAAGGISHKELVDAARQHFSGVSFTYKEDAVPILPRCRFTGSEIRDDALPV
3cwbO           SEQLHHFVQNNFTSARMALVGIGVKH-SDLKQVAEQFLNIRSGAGTSSAKATY----WGGEIREQNGHSL
3e50A           RQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKNVPPEFPEFQEEHLKQLYKIVPIKDI
3cwwA           RQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKNVPPEFPEFQEEHLKQLYKIVPIKDI
3cwbB           SEQLHHFVQNNFTSARMALVGIGVKHSD-LKQVAEQFLNIRSGAGTSSAKATY----WGGEIREQNGHSL
3e4aA           LPRLKAFIPQLLSRLHIEALLHGNITKQAALGIMQMVEDTLIEHAHTKPLLPSQVQLPDRGWFVYQQRNE
1be3B           PVELHDYVQNHFTSARMALIGLGVSH-PVLKQVAEQFLNIRGGLGLSGAKA----KYHGGEIREQNGDSL
3e4zA           RQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKNVPPEFPEFQEEHLKQLYKIVPIKDI
3e50B           RQELLKFHSAYYSSNLMAVCVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPQEEHLKQKIVPIKDI
3d3yA           EETAASLYYQKLAEDQVDIFVLGDVNEAELVPLFKQLPFTPREEGKAAIFYNQPIRNVIEERTEREVLAQ
3cx5A           VADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFL-GSEVRLRDDTLPK
1bccB           SVELHDFVQNHFTSARMALVGLGVSH-PVLKNVAEQLLNIRGGLGLSGAKAKY----RGGEIREQNGDSL
3cx5B           LQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSE-----PKFFLGEENRVRF
3e4zB           RQELLKFHSAYYSSNLMAVVVLGRESLDDLTNLVVKLFSEVENKNVPPEFPEHPFQEEHLKQLYKIPIKD


                         .         *         .         .         .         .         +:350
query           ASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTK
1bccA           AHVAIAVEGPGWAHPDLVALQVANAIIGHYDHSSSPLASIAVTNKLCQSFQTFSICYSETGLFGFYFVCD
3cwbA           AHVALAVEGPGWADPDNVVLHVANAIIGRYDHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLFGFHFVAD
3cwbN           AHVALAVEGPGWADPDNVVLHVANAIIGRYDHLSSRLAALAVEHKLCHSFQTFNTSYSDTGLFGFHFVAD
3cwbO           VHAAVVTEGAAVGSAEANAFSVLQHVLGAGPVTSKLYQGVAKATTQPFDASAFNVNYSDSGLFGFYTISQ
3e50A           RNLYVTFPPDLQKYYKSNPGHYLGHLIGHE-GPGSLLSELKSKGWVNTLVGGQKEGARGFMFFIINVDLG
3cwwA           RNLYVTFPIDLQKYYKSNPGHYLGHLIGHE-GPGSLLSELKSKGWVNTLVGGQKAGARGFMFFIINVDLT
3cwbB           VHAAVVTEGAAVGSAEANAFSVLQHVLGAGPVTSKLYQGVAKATTQPFDASAFNVNYSDSGLFGFYTISQ
3e4aA           VHNNSGIEIYYQTDMQSTS-ENMFLELFAQIISEPAFNTLRTKEQLGYIVFSGPRRANGIQGLRFIIQSE
1be3B           VHAALVAESAAIGSAEANAFSVLQHVLGAGPATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQ
3e4zA           RNLYVTFPPDLQKYYKSNPGHYLGHLIGHE-GPGSLLSELKSKGWVNTLVGGQKEGARGFMFFIINVDLT
3e50B           RNLYVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKSKGWVNTLVGGQKEGARGFMFFIINVDLG
3d3yA           SKLNLAYNTIYYGDSYYFA-LQVFNGIFGGFPHSKL-FNVREKEHLAYYASSSIDTFRG---FTVQTGID
3cx5A           AWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAGIKLLDNIQEY-QLCDNFNHFSLSYKDSGLWGFSTATR
1bccB           VHAAIVAESAAIGGAEANAFSV---------LQHVLGANPHVKRGNPFDVSAFNASYSDSGLFGFYTISQ
3cx5B           IGDSVAAIGIPVNKASLAQYEV---------LANYLTSALSELSGLISSAKLD--KFTDGGLFTLFVRD-
3e4zB           IYVTFPIPDLQKNPGHYLGHLIGHEG------PGSLLSELKSKGWVNTLVGGQKEGARGFMFFIINVDTE


                         .         .         .         .         *         .         .:420
query           KENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWT
1bccA           RMSIDDMMFVLQGQWMR-LCTSISESEVLRGKNFLRNALVSHLDGTTPVCEDIGRELLTYGRRIPLEEWE
3cwbA           PLSIDDMMFCAQGEWMR-LCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWD
3cwbN           PLSIDDMMFCAQGEWMR-LCTSTTESEVKRAKNHLRSAMVAQLDGTTPVCETIGSHLLNYGRRISLEEWD
3cwbO           AAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVVA
3e50A           LLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAE
3cwwA           LLHVEDIILHMFQYIQKLRAEGPQEWVFQELKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAE
3cwbB           AAHAGEVIRAAMNQLKAAAQGGVTEEDVTKAKNQLKATYLMSVETAQGLLNEIGSEALLSGTHTAPSVVA
3e4aA           KHYLESRVEAFLITMEK-SIEDMTEEAFQKHIQALAIRRLDKPKKLSAESAKYWEIISQQYNFDRDNTEV
1be3B           AASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVL
3e4zA           LLHVEDIILHMFQYIQKLRAEGPQEWVFQELKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAE
3e50B           LLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAVAFRFKDKERPRGYTSKIAGILHYYPLEEVLTAE
3d3yA           GKNRNQVLRLISTELENIRLGKIRELEIEQTK-ALKNQYILALDNAGAWLE---KEYLNELPTLTAEEWI
3cx5A           NTMIDDLIHFTLKQWNR-LTISVTDTEVERAKSLLKLQLGQLYESGNPDANLLGAEVLIKGSKLSLGEAF
1bccB           AAYAGQVIKAAYNQVKTIAQGNVSNENVQAAKNKLKAKYLMSVESSEGFLEEVGSQALAAGSYNPPSTVL
3cx5B           -----QDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAV
3e4zB           ELHVEDIILHMFQYIQKLRAEGPQEWVFQELKDLNAVAF--RFKDKERPRGYTSKI--------------


                         .         .         +         .         .         .         .:490
query           SQINKVTREQVRAAFQRHVHPDAMATVIVGGPEK
1bccA           ERLAEVDARMVREVCSKYIYDQCPAVAGPGPIEQ
3cwbA           SRISAVDARMVRDVCSKYIYDKCPALAAVGPIEQ
3cwbN           SRISAVDARMVRDVCSKYIYDKCPALAAVGPIEQ
3cwbO           QKIDSVTSADVVNAAKKFV-SGKKSMAASGDLGS
3e50A           YLLEEFRPDLIEMVLDKLRPENVRVAIVSKSFEG
3cwwA           YLLEEFRPDLIEMVLDKLRPENVRVAIVSKSFEG
3cwbB           QKIDSVTSADVVNAAKKFV-SGKKSMAASGDLGS
3e4aA           AYLKTLTKEDIIKFYKEMLAVDAPRRHKV-----
1be3B           QQIDAVADADVINAAKKFVSGR-KSMAASGNLGH
3e4zA           YLLEEFRPDLIEMVLDKLRPENVRVAIVSK----
3e50B           YLLEEFRPDLIEMVLDKLRPENVRVAIVSK----
3d3yA           ARINAVTIPEIQEVAKRLE-LQAIFFLEGETEN-
3cx5A           KKIDAITVKDVKAWAGKRLWDQDIAIAGTGQIEG
1bccB           QQIDAVADADVIKAAKKFVSRQKSMAAS--GNLG
3cx5B           GDVSNLPYLDE-----------------------
3e4zB           ----------------------------------