[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07698.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3chxA.bssp"
#ERROR : Can't open dsspfile "2awgA.bssp"
#ERROR : Can't open dsspfile "3b7xA.bssp"
#ERROR : Can't open dsspfile "1c9hA.bssp"
#ERROR : Can't open dsspfile "1bkfA.bssp"
#ERROR : Can't open dsspfile "1bl4A.bssp"
#ERROR : Can't open dsspfile "2dg4A.bssp"
#ERROR : Can't open dsspfile "2dg9A.bssp"
#ERROR : Can't open dsspfile "2d9fA.bssp"
#ERROR : Can't open dsspfile "3cgmA.bssp"
#ERROR : Can't open dsspfile "3cgnA.bssp"
#ERROR : Can't open dsspfile "2d9rA.bssp"

## Summary of PDB Search
:115
    6e-36   8%  3chxA  [x.x.x] PMOB[MASQUE : MEMB(X) 46 / COIL(x) 0]
    3e-31  33%  2awgA  [x.x.x] 38 KDA FK-506 BINDING PROTEIN
    7e-31  30%  3b7xA  [x.x.x] FK506-BINDING PROTEIN 6
    6e-30  50%  1c9hA  [d.26.1] FKBP12.6
    5e-29  53%  1bkfA  [x.x.x] FK506 BINDING PROTEIN
    1e-28  53%  1bl4A  [d.26.1] PROTEIN (FK506 BINDING PROTEIN)
    2e-28  53%  2dg4A  [x.x.x] FK506-BINDING PROTEIN 1A
    8e-28  53%  2dg9A  [x.x.x] FK506-BINDING PROTEIN 1A
    1e-27  33%  2d9fA  [x.x.x] FK506-BINDING PROTEIN 8 VARIANT
    6e-20  23%  3cgmA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    9e-19  23%  3cgnA  [x.x.x] PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    6e-08  13%  2d9rA  [x.x.x] CONSERVED HYPOTHETICAL PROTEIN
:115

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xQTTPSGLQFEDTVVGSGDEAKAGKHVTVHYTGWLFENGQAGRKFDSSKDRNDPFVFPLGAGHVIRGWDE
3chxA           --PLTPIIVTAELKGGVYKVPGRELTIQVKVGEYTAAGLRFPDVFTTKDYLLADRGLSTDPTPLAPGETK
2awgA           --LGNGLLRKKTLVPGPPGSPVKGQVVTVHLQTSL-ENGT---RVQEEP----ELVFTLGDCDVIQALDL
3b7xA           -ISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRP---FDSNLMK--------LEDITLWGMEL
1c9hA           ------GVEIETISPGDGRTPKKGQTCVVHYTGMLQN----GKKFDSSRDRNKPFKFRIGKQEVIKGFEE
1bkfA           ------GVQVETISPGDGRTPKRGQTCVVHYTGMLED----GKKFDSSRDKNKPFKFMLGKQEVIRGWEE
1bl4A           ------GVQVETISPGDGRTPKRGQTCVVHYTGMLED----GKKVDSSRDRNKPFKFMLGKQEVIRGWEE
2dg4A           ------GVQVETISPGDGRTPKRGQTCVVHYTGMLED----GKKFDSSRDRNKPFKFMLGKQEVIRGFEE
2dg9A           ------GVQVETISPGDGRTPKRGQTCVVHYTGMLED----GKKFDSSRDRNKPFKFMLGKQEVIRGLEE
2d9fA           -ILGNGLLRKKTLVPGPPGSSRPGQVVTVHLQTSL-ENGT---RVQEEP----ELVFTLGDCDVIQALDL
3cgmA           -------------------KVGQDKVVTIRYTLQV-----EGEVLDQGE-----LSYLHGHRNLIPGLEE
3cgnA           -------------------KVGQDKVVTIRYTLQV-----EGEVLDQG-----ELSYLHGHRNLIPGLEE
2d9rA           --------EFDAIIRQVP---DDAAYVEIPFDVKT----VYGKGRVRVNATFDTGYIVRGLPCHILGLRQ


                         .         .         *         .         .         .         .:140
query           GVQGMKVGGTRRLVIPADLGYGARGAGGVIPPNATLLFEVELLAV
3chxA           TIEVKVQDARWDIERLSDLAYDTDSIGGLLMFFSPSGKRYATE--
2awgA           SVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTA
3b7xA           GLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDF
1c9hA           GAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNL
1bkfA           GVAQMSVGQRAKLTISPDYAYGATGVPGIIPPHATLVFDVELLKL
1bl4A           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL
2dg4A           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL
2dg9A           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL
2d9fA           SVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTA
3cgmA           ALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVP
3cgnA           ALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVP
2d9rA           DIRGKQPGDSVYVTLL-----------------------------