[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07717.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2cvsA.bssp"
#ERROR : Can't open dsspfile "4csmA.bssp"
#ERROR : Can't open dsspfile "2cj9A.bssp"
#ERROR : Can't open dsspfile "2e1bA.bssp"
#ERROR : Can't open dsspfile "3bboL.bssp"
#ERROR : Can't open dsspfile "1bbwA.bssp"
#ERROR : Can't open dsspfile "2bj3B.bssp"
#ERROR : Can't open dsspfile "2du4A.bssp"
#ERROR : Can't open dsspfile "1c0aA.bssp"
#ERROR : Can't open dsspfile "1apyA.bssp"
#ERROR : Can't open dsspfile "3d5bN.bssp"
#ERROR : Can't open dsspfile "2cimB.bssp"
#ERROR : Can't open dsspfile "2cjbA.bssp"
#ERROR : Can't open dsspfile "2bj9A.bssp"
#ERROR : Can't open dsspfile "3c9iF.bssp"
#ERROR : Can't open dsspfile "2bj3C.bssp"
#ERROR : Can't open dsspfile "2aagB.bssp"
#ERROR : Can't open dsspfile "2bj7A.bssp"
#ERROR : Can't open dsspfile "2cj9B.bssp"

## Summary of PDB Search
:884
    1e-85  13%  2cvsA  [x.x.x] RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE LARGE CHAIN
    2e-53  11%  4csmA  [a.130.1] CHORISMATE MUTASE
    9e-41  11%  2cj9A  [x.x.x] SERYL-TRNA SYNTHETASE
    5e-39  24%  2e1bA  [x.x.x] 216AA LONG HYPOTHETICAL ALANYL-TRNA SYNTHETASE
    1e-36  16%  3bboL  [x.x.x] RIBOSOMAL PROTEIN L13
    5e-31  12%  1bbwA  [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
    3e-29  11%  2bj3B  [x.x.x] NICKEL RESPONSIVE REGULATOR
    1e-28  15%  2du4A  [x.x.x] O-PHOSPHOSERYL-TRNA SYNTHETASE
    2e-28   7%  1c0aA  [b.40.4 - d.104.1 - d.74.4] ASPARTYL TRNA SYNTHETASE
    1e-27  15%  1apyA  [d.153.1] ASPARTYLGLUCOSAMINIDASE
    1e-26  13%  3d5bN  [x.x.x] 50S RIBOSOMAL PROTEIN L13
    1e-24   5%  2cimB  [x.x.x] SERYL-TRNA SYNTHETASE
    2e-20   9%  2cjbA  [x.x.x] SERYL-TRNA SYNTHETASE
    4e-20  12%  2bj9A  [x.x.x] NICKEL RESPONSIVE REGULATOR
    8e-20  12%  3c9iF  [x.x.x] TAIL NEEDLE PROTEIN GP26
    7e-15  14%  2bj3C  [x.x.x] NICKEL RESPONSIVE REGULATOR
    8e-10  17%  2aagB  [x.x.x] MALONATE SEMIALDEHYDE DECARBOXYLASE
    6e-07  12%  2bj7A  [x.x.x] NICKEL RESPONSIVE REGULATOR
    4e-04  11%  2cj9B  [x.x.x] SERYL-TRNA SYNTHETASE
:884

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxRRRLRPHNMKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYVRA
2cvsA           ------------IYDTLKECALISKTAGGIGLHIHNIRSTGSYIAGTNGNGLIPMIRVFNNTRYVDEPWH
4csmA           ----------------------------------------------------------------------
2cj9A           -----HGPQSARIRTFEKIVLEELEPLGYREMIFPKLVTWEYPEIYYVCPPQTRDPDYWEEVADYYKVTH
2e1bA           ----------------------------------------------------------------------
3bboL           --------------------------KKWYVVDATDLILGRMASTIA-IHIRGKNLASYTPSDMGAFVIV
1bbwA           ----------------------LDLDMYLRIAPELYLKRLVVGGFE----RVFEINRNFRNEGISVHNPE
2bj3B           ----------------------------------------------------------------------
2du4A           --VGFSFGKEHPLFATIQRLREAYLSIGFSEVVNPLIVEDVHVKKQFGREALAVLDRCFYLATLPKFKKP
1c0aA           ----------------------------------------------------------------------
1apyA           ----------------------------------------------------------------------
3d5bN           ----------------------LIDAEGKTLGRLATKI---------ATLLRGKHRPDWTPVAMGDFVVV
2cimB           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2bj9A           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
2bj3C           ----------------------------------------------------------------------
2aagB           ----------------------------------------------------------------------
2bj7A           ----------------------------------------------------------------------
2cj9B           -----HGPQSARIFRTFEKIVELLEPLGYREMIFPKLVTWEMKSGHAKGVYPEIYYVCPPQTRDPDYWEE


                         .         .         *         .         .         .         .:140
query           TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKVYQLPADKLWVTVYA
2cvsA           ADIFDFIDI--RKNHGKEEI---RARDLFP--ALWIPDLFMKRVEENGTWTLLSDCYGDEFEALYTRYEK
4csmA           ----------------------------------------------------------------------
2cj9A           EVPTKLIKEKIAEPIGGMCYAQCPPFWMYVAVKVFDRSGTSHRYESGGIHGIERVDEFHRIEIVWIGTKE
2e1bA           ----------------------------------------------------------------------
3bboL           VNADKVAVSGKKRTQKL----YRRHSGRPGGLKEETFDQLQKRRIIEHAVRGMLPKGRLGRYLFHLKVYK
1bbwA           FTMMELYMAYADYKDLIELTESLFRTLAQDILGKLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKA
2bj3B           ----------------------------------------------------------------------
2du4A           ISSTLTLRSHMTTGWFITLSHIADKLPLPIKL--FSIDRCFRREQGEDATRLYT---YFSASCVLVDEEL
1c0aA           ------------------------DILDRTAAQDGDMIFFGADNKKIVADAMGALRLKVGKDLGLTDESK
1apyA           EQCDGSVGFGGSPDELGETTLDAMIMDGTTMDVGAVGDLRRIKNAIGVARKVLEHTTHTLLVGESATTFA
3d5bN           VNADKIRVTGKKLEQKIYT----RYSGYPGGLKKIPLEKMLATRVLEHAVKGMLPKGPLGRRLFRLKVYA
2cimB           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2bj9A           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
2bj3C           ----------------------------------------------------------------------
2aagB           ----------------------------------------------------------------------
2bj7A           ----------------------------------------------------------------------
2cj9B           VADYYKVTHEVPEPIGGMCYAQCPPFWMYVAGETLPNEEISHRYESGGIHGIERVDE---FHRIEIVWIG


                         +         .         .         .         .         *         .:210
query           EDDEAYDIWAKEVGVPADRIVRIGDNKGARYASDNFWQMADTGPCGPCSEIFYDHGPDVWXXXXXXXXXX
2cvsA           ETIKAQKLWYSILEAQTETGTPFVVYKDACNRKSNQKNLGVIKSSNLCCEIVEYSAPDETSEDGKTSTYN
4csmA           ------------------------------------------------SIIFKFIERSHFATCPSVYEAN
2cj9A           EVLKCAEELHDR----YMHIFNDILDIEWRKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPDGE
2e1bA           ----------------------------------------------------------------------
3bboL           GAEHPHQAQ-------------------------------------------------------------
1bbwA           IAESIGIHVEKSWGLGRIVTEIFEEVAEAHLIQPTFARRNDVNPEITDRFEFFIGGREIGNGFSELND--
2bj3B           ----------------------------------------------------------------------
2du4A           SVDDGKAVAE-------ALLRQFGFE-------NFRFRKDEKRSKYYIPDTQTEVFAFH-PKLVGSSTKY
1c0aA           WAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGDM
1apyA           Q-SMGFINEDLSTSASQALHSDWLARNCQ----PNYWRNVIPDPSKYCGPY-------------------
3d5bN           GPDHPHQAQRPEK---------------------------------------------------------
2cimB           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2bj9A           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
2bj3C           ----------------------------------------------------------------------
2aagB           ----------------------------------------------------------------------
2bj7A           ----------------------------------------------------------------------
2cj9B           TKEEVLKCAEELHDRYMHIFNDIL-DIEWRKARVTPWFMAQEGLLGLAEENTVGTTDYEACLPYRGPDGE


                         .         .         .         +         .         .         .:280
query           XXRYIEIWNLVFMQFNRDEQGTMTPLPKPCVDTGMGLERIAAVLQHVHSNYEIDLFQALIKGAGRETHIA
2cvsA           FKKLHEIAKVVTRNLNRVIDRNYYPVEEAHRPIALGVQGLADTFMLLRLPFDSEEARLLNIEASCELAQK
4csmA           HPLEIPNFKGSFLDWALSNLEIAHSRIRR-----FESPDETPFFPDKIQKSFLPSIN-YPQILAPYAPEV
2cj9A           WLEFQNVSINGDKYPKGFNVKLQSGDELWSGCSGVGLERWAAVFLAQKGLDPANWPEEFRN---------
2e1bA           ----------------------------------------------------------------------
3bboL           ----------------------------------------------------------------------
1bbwA           --AEDQAQRFLDQVYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILF--------------
2bj3B           ----------------------------------------------------------------------
2du4A           SDGWIEIATFGIYSPTALAEY---DIPYPVMNLGLGVERLAMI--LYGYDDVRKMVYPQIH---------
1c0aA           QQTVFGILGINEEEQREKFGFLLDALTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLMTAPS
1apyA           ----------------------------------------------------------------------
3d5bN           ----------------------------------------------------------------------
2cimB           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2bj9A           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
2bj3C           ----------------------------------------------------------------------
2aagB           ------------------------------------------LFYGRTDAQIKSLLDAAHGAMVDAFGV-
2bj7A           ----------------------------------------------------------------------
2cj9B           WLEFQNVSINGDKYPKGFNVKLQSGDELWSGCSGVGLERAAVFLAQKGLDPANWP---------------


                         .         *         .         .         .         .         +:350
query           DLNQNSLKVIADHIRACSFLIVDGVIPGNEGRGYVLRRIVRRAIRHGYKLGQKTPFFHKLVGDLVAQMGE
2cvsA           DGPYETFQGSPASQGILQFDMWDQKPYGMWDWDTLRKDIMKHGVRNSLTMAPMPTASTSQILGYNECFEP
4csmA           NYNDKIKKVYIEKIIPL-ISKRDGDDKNNFGSVATRDIECLQSLSR------RIHFGKFVAEAKFQSDIP
2cj9A           ----------------------------------------------------------------------
2e1bA           ----------------------------------------------------------------------
3bboL           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2bj3B           ----------------------------------------------------------------------
2du4A           GEIKLSDLDIAREIKVKEVPQTAVGLK-------IAQSIVETAEKHASEPSPCSFLAFEG-----EMMG-
1c0aA           FANPTALAELSIQVV-------------------------------------------------------
1apyA           ----------------------------------------------------------------------
3d5bN           ----------------------------------------------------------------------
2cimB           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2bj9A           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
2bj3C           ----------------------------------------------------------------------
2aagB           --PANDRYQTVSQHRPGEMVLEDTGLGYGRSSAVVLLTVISRPRSE----EQKVCFYKLLTGALERDCG-
2bj7A           ----------------------------------------------------------------------
2cj9B           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AYPELAEAQSRVVEVLKAEEERFFETIENGMSILDAAVADLKAKGGKVLDGELAFKLHDTFGFPLDLTQD
2cvsA           VTS-----NMYSFQVVNPYLLRDLVDLGIWDEGMKQYLITQNGQGLPNVPQELKDLYKTVWEISQKTIIN
4csmA           LYTKLIKSKDVKNITNSAVEEKILERLTKKAEVYG------VDPTERRITPEYLVKIYKEIVIPI-----
2cj9A           ----------------------------------------------------------------------
2e1bA           ----------------------------------------------------------------------
3bboL           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2bj3B           ----------------------------------------------------------------------
2du4A           ----------RNVRVYVVEEEE---------NTKLCGPAYAN---------EVVVYKGDIYGIPKTKKWR
1c0aA           ----------------------------------------------------------------------
1apyA           ----------------------------------------------------------------------
3d5bN           ----------------------------------------------------------------------
2cimB           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2bj9A           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
2bj3C           ----------------------------------------------------------------------
2aagB           ----------------------------------------------------------------------
2bj7A           ----------------------------------------------------------------------
2cj9B           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VAREQEITVDEAAFDAAMTRQREQARAAGKFKMAAGLEYSGEKTVFHGYDALSMDGVRVTALYVDGASVD
2cvsA           MAADRSVYIDQSHLRAPTMGKLTSMHYGWKKGLKTGMYY-------------------------------
4csmA           ----------------------------------------------------------------------
2cj9A           ----------------------------------------------------------------------
2e1bA           ------------------------------------------MTRKLYYEDAYLKE-----------AKG
3bboL           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2bj3B           ----------------------------------------------------------------------
2du4A           SFFEEGVPTGIRYIDGFAYYAARKVEEA--AMREQEEVKVKARIVENLSD--------------------
1c0aA           ----------------------------------------------------------------------
1apyA           ----------------------------------------------------------------------
3d5bN           ----------------------------------------------------------------------
2cimB           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2bj9A           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
2bj3C           ----------------------------------------------------------------------
2aagB           ----------------------------------------------------------------------
2bj7A           ----------------------------------------------------------------------
2cj9B           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TMQPGQSGVVVLDNTPFYAESGGQVGDQGTLVSGPAVFAVADTTKIQSDVFGHQGTLANGALKVGXXXXX
2cvsA           ----------------------------------------------------------------------
4csmA           ----------------------------------------------------------------------
2cj9A           ----------------------------------------------------------------------
2e1bA           RVLEIRDNAILLDQTIFYPTGGGQPHDRGTIN----GVEVLDVYKDEEGNVWH-VVKEPEKFKVGDEVEL
3bboL           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2bj3B           ----------------------------------------------------------------------
2du4A           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
1apyA           ----------------------------------------------------------------------
3d5bN           ----------------------------------------------------------------------
2cimB           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2bj9A           ----------------------------------------------------------------------
3c9iF           ----------------------------------------------------------------------
2bj3C           ----------------------------------------------------------------------
2aagB           ----------------------------------------------------------------------
2bj7A           ----------------------------------------------------------------------
2cj9B           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXNHSATHLMHKALREVLGTHVQQKGSLVDPDKTRFDFSHNAPLTDAQIRQIEEIVNAEI
2cvsA           ----------------------------------------------------------------------
4csmA           ----------------------------------------------------------------------
2cj9A           ------------------------------------------HMKLQFNLKAYFAKDAIAALFEEANSTL
2e1bA           KIDWDYRYKLMRIHTGLHLLEHVLNEVLGENWQLVGSGMSVEKGRYDIAYPENLNK-YKEQIISLFNKYV
3bboL           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2bj3B           -------------ENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI
2du4A           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
1apyA           ----------------------------------------------------------------------
3d5bN           ----------------------------------------------------------------------
2cimB           --------------SHMKLQFNLAYFKTSADPTPAKDAIAALFEEANSTLLTRGAPEGQGAKVTEWKDRI
2cjbA           --------------------------KLQ-FNLKAYFKTKDIAALFEEANSTLLTRGAPEGQGATEWDRI
2bj9A           ------------YENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI
3c9iF           ----------------------------------------------------------------------
2bj3C           -------------ENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI
2aagB           ----------------------------------------------------------------------
2bj7A           -------------ENRSEAIRDLIRDFIIRHEWEVGNEEVAGTITIVYNHDEGDVVKALLDLQHEYLDEI
2cj9B           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LSNAPTVAQVMPFDDAVKSGAMALFGEKYADDVRVLSIGTSKELCGGTHVTRTGDIGLFKIVVEAGVAAG
2cvsA           ----------------------------------------------------------------------
4csmA           ----------------------------------------------------------------------
2cj9A           LTRGAPEGQGAKVTEWDLQSGRYVRVHDAIFRLRKQLAEGELRMLKVPYIKSMENIEGGIQLELEV----
2e1bA           DEGGEVKIWWEGDRRYTQIRDF------------------EVIPCGGTHVKDIKEIGHIKKLKRSSIGRG
3bboL           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2bj3B           ISSLH-----VHMDEHNCLEVIVVKGEA--KKIKMIAD----KLLSLKGVKHGKLVMTSTG---------
2du4A           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
1apyA           ----------------------------------------------------------------------
3d5bN           ----------------------------------------------------------------------
2cimB           ELTLQSGRYVRVHDAIFRLRKQLAEKYIEVESFIIKVPDHELRMLKVPYIKSMENIEGGIQL--------
2cjbA           ELTLQSGRYVRVHDAIFR--LRKQLAEIEVESFIIKVPDHELRMLKVPYIKSMENIEGGIQ---------
2bj9A           ISS-----LHVHMDEHNCLEVIVVKGEAKKIKMIAD------KLLSLKGVKHG-----------------
3c9iF           ----------------------------------------------------DPSLNNPVVIQATRLDAS
2bj3C           ISS-----LHVHMDEHNCLEVIVVKGEA----KKIKMI--ADKLLSLKGV--------------------
2aagB           ----------------------------------------------------------------------
2bj7A           ISSL-----HVHMDEHNCLEVIVVKGEA------------------------------------------
2cj9B           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           IRRVEAITGDNALHYLQSLDXXXXXXXXXXXXQPSELVPRIGQVQDQVRXXXXXXXXXXXXXXXXQGDEL
2cvsA           ----------------------------------------------------------------------
4csmA           ----------------------------------------------------------------------
2cj9A           ----------------------------------------------------------------------
2e1bA           KQRLEM----------------------------------------------------------------
3bboL           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2bj3B           ----------------------------------------------------------------------
2du4A           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
1apyA           ----------------------------------------------------------------------
3d5bN           ----------------------------------------------------------------------
2cimB           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2bj9A           ----------------------------------------------------------------------
3c9iF           ILPRNVFSKSYL-LYVIAQGTDVGAIAGKANEAGQGAYDAQVKNDEQDVELADHEARIKQLRIDVDDSRI
2bj3C           ----------------------------------------------------------------------
2aagB           ----------------------------------------------------------------------
2bj7A           ----------------------------------------------------------------------
2cj9B           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           AAQAVDVKGLKVLAAQLDGADVKTLRETMDKLKDKLQSAAIVLAAVADGKVSLIAGVTADATSKVKAGEL
2cvsA           ----------------------------------------------------------------------
4csmA           ----------------------------------------------------------------------
2cj9A           ----------------------------------------------------------------------
2e1bA           ----------------------------------------------------------------------
3bboL           ----------------------------------------------------------------------
1bbwA           ----------------------------------------------------------------------
2bj3B           ----------------------------------------------------------------------
2du4A           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
1apyA           ----------------------------------------------------------------------
3d5bN           ----------------------------------------------------------------------
2cimB           ----------------------------------------------------------------------
2cjbA           ----------------------------------------------------------------------
2bj9A           ----------------------------------------------------------------------
3c9iF           TANTKAITALNVRVTTAEG-EIASLQTNVSALDGRVTTAENNISALQADYVSKTATTSQSLASPYSVGGK
2bj3C           ----------------------------------------------------------------------
2aagB           ----------------------------------------------------------------------
2bj7A           ----------------------------------------------------------------------
2cj9B           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           VNFVAQQVGGKGGGRPDMAQAGGTDPANLPKALAGVTEWVSAxx
2cvsA           --------------------------------------------
4csmA           --------------------------------------------
2cj9A           --------------------------------------------
2e1bA           --------------------------------------------
3bboL           --------------------------------------------
1bbwA           --------------------------------------------
2bj3B           --------------------------------------------
2du4A           --------------------------------------------
1c0aA           --------------------------------------------
1apyA           --------------------------------------------
3d5bN           --------------------------------------------
2cimB           --------------------------------------------
2cjbA           --------------------------------------------
2bj9A           --------------------------------------------
3c9iF           KVVGARQTGWTATGTANKGVFDASEIQAIANALITERRRTKA--
2bj3C           --------------------------------------------
2aagB           --------------------------------------------
2bj7A           --------------------------------------------
2cj9B           --------------------------------------------