[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07787.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3b6cA.bssp"
#ERROR : Can't open dsspfile "3b6cB.bssp"
#ERROR : Can't open dsspfile "3c2bB.bssp"
#ERROR : Can't open dsspfile "3b6aA.bssp"
#ERROR : Can't open dsspfile "3c07A.bssp"
#ERROR : Can't open dsspfile "3e7qB.bssp"
#ERROR : Can't open dsspfile "3bjbF.bssp"
#ERROR : Can't open dsspfile "3bjbE.bssp"
#ERROR : Can't open dsspfile "3c2bA.bssp"
#ERROR : Can't open dsspfile "3c07B.bssp"
#ERROR : Can't open dsspfile "3bjbC.bssp"
#ERROR : Can't open dsspfile "3bhqA.bssp"
#ERROR : Can't open dsspfile "3colA.bssp"
#ERROR : Can't open dsspfile "3e7qA.bssp"
#ERROR : Can't open dsspfile "3bjbB.bssp"
#ERROR : Can't open dsspfile "1bjyB.bssp"
#ERROR : Can't open dsspfile "1bjzA.bssp"
#ERROR : Can't open dsspfile "3ccyA.bssp"
#ERROR : Can't open dsspfile "3br6A.bssp"
#ERROR : Can't open dsspfile "3dpjE.bssp"
#ERROR : Can't open dsspfile "3dpjA.bssp"
#ERROR : Can't open dsspfile "3b6aB.bssp"
#ERROR : Can't open dsspfile "3dcfB.bssp"
#ERROR : Can't open dsspfile "2dg7A.bssp"
#ERROR : Can't open dsspfile "1du7A.bssp"
#ERROR : Can't open dsspfile "3cwrB.bssp"
#ERROR : Can't open dsspfile "3br5E.bssp"
#ERROR : Can't open dsspfile "3br0B.bssp"
#ERROR : Can't open dsspfile "1a6iA.bssp"
#ERROR : Can't open dsspfile "3br0A.bssp"
#ERROR : Can't open dsspfile "3b81A.bssp"
#ERROR : Can't open dsspfile "3dcfA.bssp"
#ERROR : Can't open dsspfile "3bjbA.bssp"
#ERROR : Can't open dsspfile "3bruA.bssp"
#ERROR : Can't open dsspfile "1bj0A.bssp"
#ERROR : Can't open dsspfile "3cjdB.bssp"
#ERROR : Can't open dsspfile "3cdlA.bssp"
#ERROR : Can't open dsspfile "3bt9B.bssp"
#ERROR : Can't open dsspfile "3dpjB.bssp"
#ERROR : Can't open dsspfile "3cjdA.bssp"
#ERROR : Can't open dsspfile "3bruB.bssp"
#ERROR : Can't open dsspfile "3cwrA.bssp"
#ERROR : Can't open dsspfile "3br5D.bssp"
#ERROR : Can't open dsspfile "3br3A.bssp"
#ERROR : Can't open dsspfile "3dpjF.bssp"
#ERROR : Can't open dsspfile "3br5A.bssp"
#ERROR : Can't open dsspfile "3br2E.bssp"
#ERROR : Can't open dsspfile "3btiB.bssp"
#ERROR : Can't open dsspfile "3br2D.bssp"
#ERROR : Can't open dsspfile "3br3B.bssp"
#ERROR : Can't open dsspfile "3bqzA.bssp"
#ERROR : Can't open dsspfile "2d6yB.bssp"
#ERROR : Can't open dsspfile "2eh3A.bssp"
#ERROR : Can't open dsspfile "2dtzD.bssp"
#ERROR : Can't open dsspfile "3br2A.bssp"
#ERROR : Can't open dsspfile "3dewA.bssp"
#ERROR : Can't open dsspfile "2dtzB.bssp"
#ERROR : Can't open dsspfile "3cdlB.bssp"
#ERROR : Can't open dsspfile "3bniA.bssp"
#ERROR : Can't open dsspfile "3br1D.bssp"
#ERROR : Can't open dsspfile "2dg8A.bssp"
#ERROR : Can't open dsspfile "3bqzB.bssp"
#ERROR : Can't open dsspfile "2dg8D.bssp"
#ERROR : Can't open dsspfile "2d6yA.bssp"
#ERROR : Can't open dsspfile "2dg8B.bssp"
#ERROR : Can't open dsspfile "3br5B.bssp"
#ERROR : Can't open dsspfile "3colB.bssp"
#ERROR : Can't open dsspfile "2dg8C.bssp"
#ERROR : Can't open dsspfile "3bniB.bssp"
#ERROR : Can't open dsspfile "3crjD.bssp"
#ERROR : Can't open dsspfile "3egqB.bssp"
#ERROR : Can't open dsspfile "3bqyA.bssp"
#ERROR : Can't open dsspfile "3egqA.bssp"
#ERROR : Can't open dsspfile "2dt5A.bssp"
#ERROR : Can't open dsspfile "3crjB.bssp"
#ERROR : Can't open dsspfile "3br2B.bssp"
#ERROR : Can't open dsspfile "1aerB.bssp"
#ERROR : Can't open dsspfile "3crjA.bssp"
#ERROR : Can't open dsspfile "3br1B.bssp"
#ERROR : Can't open dsspfile "3bjbD.bssp"
#ERROR : Can't open dsspfile "3br6B.bssp"
#ERROR : Can't open dsspfile "3crjC.bssp"
#ERROR : Can't open dsspfile "2bjcA.bssp"
#ERROR : Can't open dsspfile "1cjgA.bssp"

## Summary of PDB Search
:236
    6e-18  15%  3b6cA  [x.x.x] ACTII PROTEIN
    8e-18  15%  3b6cB  [x.x.x] ACTII PROTEIN
    8e-18  15%  3c2bB  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    1e-17  17%  3b6aA  [x.x.x] ACTR PROTEIN
    2e-17  18%  3c07A  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    2e-17  12%  3e7qB  [x.x.x] TRANSCRIPTIONAL REGULATOR
    2e-17  10%  3bjbF  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    5e-17  10%  3bjbE  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    7e-17  14%  3c2bA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    8e-17  21%  3c07B  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    1e-16  11%  3bjbC  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    1e-16  11%  3bhqA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    2e-16  14%  3colA  [x.x.x] PUTATIVE TRANSCRIPTION REGULATOR
    2e-16  12%  3e7qA  [x.x.x] TRANSCRIPTIONAL REGULATOR
    2e-16   9%  3bjbB  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    3e-16  15%  1bjyB  [a.4.1 - a.121.1] TETRACYCLINE REPRESSOR
    7e-16  14%  1bjzA  [x.x.x] TETRACYCLINE REPRESSOR
    7e-16  13%  3ccyA  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    7e-16  18%  3br6A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    9e-16  14%  3dpjE  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    9e-16  16%  3dpjA  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    1e-15  15%  3b6aB  [x.x.x] ACTR PROTEIN
    1e-15  18%  3dcfB  [x.x.x] TRANSCRIPTIONAL REGULATOR OF THE TETR/ACRR
    1e-15  16%  2dg7A  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    2e-15  15%  1du7A  [a.4.1 - a.121.1] PROTEIN (TETRACYCLINE REPRESSOR PROTEIN
    2e-15  15%  3cwrB  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    2e-15  19%  3br5E  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-15  18%  3br0B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-15  13%  1a6iA  [x.x.x] TETRACYCLINE REPRESSOR PROTEIN CLASS D
    4e-15  19%  3br0A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    4e-15  13%  3b81A  [x.x.x] TRANSCRIPTIONAL REGULATOR, ACRR FAMILY
    4e-15  18%  3dcfA  [x.x.x] TRANSCRIPTIONAL REGULATOR OF THE TETR/ACRR
    4e-15  10%  3bjbA  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    4e-15  13%  3bruA  [x.x.x] REGULATORY PROTEIN, TETR FAMILY
    4e-15  13%  1bj0A  [x.x.x] TETRACYCLINE REPRESSOR
    5e-15  13%  3cjdB  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    6e-15  16%  3cdlA  [x.x.x] TRANSCRIPTIONAL REGULATOR AEFR
    1e-14  18%  3bt9B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-14  16%  3dpjB  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    2e-14  12%  3cjdA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    2e-14  14%  3bruB  [x.x.x] REGULATORY PROTEIN, TETR FAMILY
    2e-14  16%  3cwrA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    2e-14  19%  3br5D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-14  18%  3br3A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-14  14%  3dpjF  [x.x.x] TRANSCRIPTION REGULATOR, TETR FAMILY
    3e-14  19%  3br5A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-14  19%  3br2E  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-14  18%  3btiB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    4e-14  19%  3br2D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    5e-14  19%  3br3B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    5e-14  18%  3bqzA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    5e-14  15%  2d6yB  [x.x.x] PUTATIVE TETR FAMILY REGULATORY PROTEIN
    6e-14  20%  2eh3A  [x.x.x] TRANSCRIPTIONAL REGULATOR
    9e-14  19%  2dtzD  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    1e-13  19%  3br2A  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-13  15%  3dewA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    2e-13  15%  2dtzB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-13  16%  3cdlB  [x.x.x] TRANSCRIPTIONAL REGULATOR AEFR
    2e-13  16%  3bniA  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    2e-13  18%  3br1D  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    2e-13  17%  2dg8A  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    3e-13  19%  3bqzB  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    3e-13  17%  2dg8D  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    4e-13  15%  2d6yA  [x.x.x] PUTATIVE TETR FAMILY REGULATORY PROTEIN
    5e-13  17%  2dg8B  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    6e-13  18%  3br5B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    7e-13  15%  3colB  [x.x.x] PUTATIVE TRANSCRIPTION REGULATOR
    7e-13  19%  2dg8C  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATORY
    9e-13  16%  3bniB  [x.x.x] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    1e-12  12%  3crjD  [x.x.x] TRANSCRIPTION REGULATOR
    1e-12  23%  3egqB  [x.x.x] TETR FAMILY TRANSCRIPTIONAL REGULATOR
    2e-12  16%  3bqyA  [x.x.x] PUTATIVE TETR FAMILY TRANSCRIPTIONAL REGULATOR
    2e-12  23%  3egqA  [x.x.x] TETR FAMILY TRANSCRIPTIONAL REGULATOR
    2e-12   8%  2dt5A  [x.x.x] AT-RICH DNA-BINDING PROTEIN
    2e-12  12%  3crjB  [x.x.x] TRANSCRIPTION REGULATOR
    2e-12  17%  3br2B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    8e-12   7%  1aerB  [d.166.1] EXOTOXIN A
    8e-12  14%  3crjA  [x.x.x] TRANSCRIPTION REGULATOR
    4e-11  18%  3br1B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    5e-11  16%  3bjbD  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    3e-10  16%  3br6B  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR QACR
    6e-08  11%  3crjC  [x.x.x] TRANSCRIPTION REGULATOR
    1e-06  17%  2bjcA  [x.x.x] LACTOSE OPERON REPRESSOR
    2e-06  17%  1cjgA  [a.35.1] PROTEIN (LAC REPRESSOR)
:236

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxAKPQAGPRRTRDRILDVSLRLFNELGEPNVTTTTIAEAMEISPGNLYYHFRNKDDIINSIFVRFEQEM
3b6cA           ---------PLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEV
3b6cB           ---------PLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEV
3c2bB           ---------SPRQNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAAITFQQSKVD
3b6aA           ---------PLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEV
3c07A           ----------EQTRALILETARLFQERG-YDRTTRAIAQEAGVSVGNAYYYFAGKEHLIQGFYDRIAAEH
3e7qB           --RFSRLEPEQRKALLIEATLACLKRHGFQGASVRKICAEAGVSVGLINHHYDGKDALVAEAYLAVTGRV
3bjbF           --------EQRARHVRLEAAIELATEKELAR-VQHEVAKRAGVAIGTLYRYFPSKTHLFVAVVDQIDRGV
3bjbE           --------EQRARHVRLEAAIELATEKELAR-VQHEVAKRAGVAIGTLYRYFPSKTHLFVAVVDQIDRGV
3c2bA           ----------PRQNAVLDQALRLLVEGGEKALTTSGLARAANCSKESLYKWFGDRDGLLAAITFQQSKVR
3c07B           ----------EQTRALILETARLFQERG-YDRTTRAIAQEAGVSVGNAYYYFAGKEHLIQGFYDRIAAEH
3bjbC           ----------RARHVRLEAAIELATEKELAR-VQHEVAKRAGVAIGTLYRYFPSKTHLFVAVVDQIDRGV
3bhqA           --------SARKDREIIQAATAAFISKG-YDGTSEEIATKAGASKQTVYKHFTDKETLFGEVVLSTASQV
3colA           -----------KQVKIQDAVAAIILAEGPAGVSTTKVAKRVGIAQSNVYLYFKNKQALIDSVYARETNRI
3e7qA           --RFSRLEPEQRKALLIEATLACLKRHGFQGASVRKICAEAGVSVGLINHHYDGKDALVAEAYLAVTGRV
3bjbB           --------EQRARHVRLEAAIELATEKELAR-VQHEVAKRAGVAIGTLYRYFPSKTHLFVAVVDQIDRGV
1bjyB           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARH
1bjzA           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARH
3ccyA           ------------IRDTIIERAAAFARQGYSETSIGDIARACECSKSRLYHYFDSKEAVLRDLTTHVDSLL
3br6A           -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
3dpjE           ---------AQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLART
3dpjA           -----NAVQAQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLART
3b6aB           ---------PLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEV
3dcfB           -----------RRTQIIKVATELFREKGYYATSLDDIADRIGFTKPAIYYYFKSKEDVLFAIVNSIVDEA
2dg7A           --------DPGAEQRLKRAALELYSEHGYDNVTVTDIAERAGLTRRSYFRYFPDKREVLFGGSELLPPAV
1du7A           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARH
3cwrB           --------DAVVRESIVGAAQRLLSSGGA--AATEGVASEAGIAKKTLYRFASGRADLIGLLVESWIAPI
3br5E           -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
3br0B           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
1a6iA           ---------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEILARH
3br0A           -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
3b81A           --------FNNKRTELANKIWDIFIANGYENTTLAFIINKLGISKGALYHYFSSKEECADAAIENRVAFF
3dcfA           -----------RRTQIIKVATELFREKGYYATSLDDIADRIGFTKPAIYYYFKSKEDVLFAIVNSIVDEA
3bjbA           ------SEEQRARHVRLEAAIELATEKELAR-VQHEVAKRAGVAIGTLYRYFPSKTHLFVAVVDQIDRGE
3bruA           --------ASLAHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYF
1bj0A           ---------RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARH
3cjdB           ----------ALREKLIDLAEAQIEAEGLASLRARELARQADCAVGAIYTHFQDLNALTLEVNGRTFARL
3cdlA           ---------DQKRESIVQAAIAEFGDRG-FEITSDRIAARAEVSKRTVYNHFPSKEELFAELQRLWNCAE
3bt9B           -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIQESKW
3dpjB           ----------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLART
3cjdA           ----------ALREKLIDLAEAQIEAEGLASLRARELARQADCAVGAIYTHFQDLNALTLEVNGRTFARL
3bruB           -----------AHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGEAYDTYFARLL
3cwrA           ----PAVPDAVVRESIVGAAQRLLSSGGA--AATEGVASEAGIAKKTLYRFASGRADLIGLLVESWIAPI
3br5D           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
3br3A           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
3dpjF           ----------QTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLART
3br5A           -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
3br2E           -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
3btiB           -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKW
3br2D           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
3br3B           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
3bqzA           -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
2d6yB           --------PEATKARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYYGNKGELFASVLEKKLDLA
2eh3A           -----------TKERILEVSKELFFEKGYQGTSVEEIVKRANLSKGAFYFHFKSKEELITEIIERTHKKI
2dtzD           -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
3br2A           -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
3dewA           ------------CRSRLEVATELFAQKGFYGVSIRELAQAAGASIS-ISYHFGGKEGLYAAVLQEQFACF
2dtzB           -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLFKTKENFLEILNIEESKWQEQW
3cdlB           ---------DQKRESIVQAAIAEFGDRG-FEITSDRIAARAEVSKRTVYNHFPSKEELFAELQRLWNCYR
3bniA           ---------AERLTRILDACADLLDEVGYDALSTRAVALRADVPIGSVYRFFGNKRQMADALAQRNLERY
3br1D           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
2dg8A           ----------QRRERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHI
3bqzB           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKW
2dg8D           ----------QRRERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHI
2d6yA           ----------ATKARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYYGNKGELFASVLEKKLDLA
2dg8B           ----------QRRERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHI
3br5B           ------------KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYFKT--KENLFLEILNIEESKW
3colB           ------------QVKIQDAVAAIILAEGPAGVSTTKVAKRVGIAQSNVYLYFKNKQALIDSVYARETNRI
2dg8C           ----------QRRERILAATLDLIAEEGIARVSHRRIAQRAGVPLGSMTYHFTGIEQLLREAFGRFTDHI
3bniB           -----------RLTRILDACADLLDEVGYDALSTRAVALRADVPIGSVYRFFGNKRQMADALAQRNLERY
3crjD           ----------SDQTEEIQATYRALREHGYADLTIQRIADEYGKSTAAVHYYYDTKDDLLDYLLERFVDSI
3egqB           -----------QSVRIIEAALRLYKKPP-HEVSIEEIAREAKVSKSLIFYHFESKQKLLEEAVHAFRKEE
3bqyA           ------------RARTVQTALDLLNESGLDTLTRRLAQA--DVQAGALYRYFAAKQDLLTAAETGDGDWS
3egqA           -----------QSVRIIEAALRLYKKPP-HEVSIEEIAREAKVSKSLIFYHFESKQKLLEEAVHAFRKEE
2dt5A           -----VPEAAISRLITYLRILEELEAQGVHRTSSEQLGGLAQVTAFQVRKDLSYFGSYGTRGVGYTVPVL
3crjB           -----------DQTEEIQATYRALREHGYADLTIQRIADEYGKSTAAVHYYYDTKDDLLAAFLDYLLERF
3br2B           -------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYTKENLFLEILNIEESKWQEQW
1aerB           ---RARSQDLDAIWRGFYIAGDPALAYG---YAQDQEPDRGRIRNGALLRVYVPRSSLPGFYRTSLTLAA
3crjA           ---------FSDQTEEIQATYRALREHGYADLTIQRIADEYGKSTAAVHYYYDTKDDLLAAFLDYLLERF
3br1B           -------------DKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYFKT--KENLFLEILNIEESKW
3bjbD           ------------RHVRLEAAIELATEKELAR-VQHEVAKRAGVAIGTLYRYFPSKTHLFVAVVDQIDRPP
3br6B           ------------KDKILGVAKELFIN-GYNATTTGEIVKLSESSKGNLYFKT--KENLFLEILNIEESKW
3crjC           ------------QTEEIQATYRALRD-----LTIQRIAD--EYSTAAVHYYYDTKDDLLAAFLDYLLERF
2bjcA           ------------------------------PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM
1cjgA           ------------------------------PVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAM


                         .         .         *         .         .         .         .:140
query           ERRLKMPEDHKATLGESWGYLQYMSEFLWNYRFLYRDINDLLARNRMLETNFKRIVDQKKRFALEICRQF
3b6cA           EVPEPEPGRWAEQVKE---MCRSLRRMFLAHRDLAR----IAIDRVPLGPNGMVGME---RTMNLLRSGG
3b6cB           EVPEPEPGRWAEQVKEMCSLRRMFLAHRDLARIAIDRVPLGPNGMVGME---------------RTMNLL
3c2bB           RVSAPQLADHLEVFAHDLDVLAGDVSLALNRLAIGQASRDGSKLGDLLLERGRRQIDRRAR---GLIEAG
3b6aA           EVPEPEPGRWAEQVKE---MCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTM-----------NLL
3c07A           RAAVREVLARETDLEARAGVLKVWLDIATPYHEFAVQFFKNAADPDSPLSPFSPESEHARVEAIGIHRAV
3e7qB           MRLLGAIDTAPGGARPRSAFFEASFSAELLDPQLLDAWLAFWGSIEAIGRVHDHSYGEYRALLVGVLRQL
3bjbF           GPPGESPQDA----------VYNVLVRATRGLLRRPALSTAIQSTSTANVASVPDAGKVDRAFRQILDAA
3bjbE           PPGESPQDAVYNVLVR---ATRGLLRRPALSTAIQSTSTANVASVPDAGKVDRAFR--------QILDAA
3c2bA           TFEKAGDRVSAPQLADHEVFAHDLLDVLAGDVSLALNRLAIGQARKLGDLLLERGRRQIDRRARGLIEAG
3c07B           RAAVREVLARETDLEARAGVLKVWLDIATPYHEFAVQFFKNAADPDSPLSPFSPESEHARVEAIGIHRAV
3bjbC           GFKKS-ADAVYNVLVRAT-------RGLLRRPALST----AIQSTSTANVASVPDAGKVDRAFRQILDAA
3bhqA           NDIIETTLLSEAIFEGGQQLARRLIAVLDEELLKLRRLIIANADRPQLGRAWYEKGFERLASTASCFQKL
3colA           LSTTDLDRLSDST-IDVTTRIRLYVQQVYDYSLANPDSLTIIQQIKALNGQDADPNNI----VANLLTAA
3e7qA           MRLLGAIDTAPGGARPRSAFFEASFSAELLDPQLLDAWLAFWGSIEAIGRVHDHSYGEYRALLVGVLRQL
3bjbB           GFKKSAESPQDAVYNVLVRATRGLLRRPALSTAIQSTSTANVASVPDAGKVDRAFR--------QILDAA
1bjyB           HDYSLPAAG-ESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLY
1bjzA           HDYSL-PAAGESWQSFLRNNAMSFRRALLRYRDGAK-VHLGTRPDEKQYDTVETQLRFMTENGFSLRDGL
3ccyA           ERCRQVLYGSNEPKTRFLQIVKLFLEIYATSRDRHVVLTCLDALPEDQRKALIAKQRELIAYVRDALLQL
3br6A           QEQWKSEQIKAKTNREKFLYNELSLTTEYYYPLQNAIEFYTEYYTNSINEKMNKLQNKYIDAYHVIFKEG
3dpjE           AQLADWQGTGDSPRARIASFIDLINRAKITRYGCPVGSLCTELSKLDHA--AQGQANGLFTLFRDWLQRQ
3dpjA           AQLADWQGTGDSPRARIASFIDLINRAKITRYGCPVGS--LCTELSKLDHAAQGQANGLFTLFRDWLQRQ
3b6aB           EVPEPEPGRWAEQVKE---MCRSLRRMFLAHRDLARIAIDRVPLGPNGM-----------VGMERTMNLL
3dcfB           LERFHAIAAGPGSPGERIALLVEHTRTILRNLDANT-----LFYNLSPERERERKREREYTEIQRLYAEG
2dg7A           ARAVLAADPGAAPLTAVLDASQVGAQLVAQVEGAAQ-RRAVIDASPELQERERTKSAAISRAVQDALVRR
1du7A           HDYSLPAAG-ESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLY
3cwrB           FPEADPQDAAAALERIVYDIAQAVLSREAVSLFRL--ASDADLRNRFLPAYNANGIERSRRELARWLDQQ
3br5E           QEQWKSEQIKCKTNREKFLYNELSLTTQYYYPLQNAEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEG
3br0B           QEQWKSEQIKAKTNREKFLYNELSLTTEYYYPLQNAEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKEG
1a6iA           HDYSL-PAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDT-VETQLRFMTENGFSLRDGL
3br0A           QEQWKSEQIKAKTNREKYLYNELSLTTEYYYPNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKEG
3b81A           SNEVLKESEEGLNSIERL-------------KKILLAGIINSPSNKIFHQKLVAIIKYFAPIYADIISQG
3dcfA           LERFHAIAAGPGSPGERIALLVEHTRTILRNLDANT-----LFYNLSPERERERKREREYTEIQRLYAEG
3bjbA           SPQDAVTRGLLRRPALSTAIQSTSTANVASVPDVDRAFRQILDAAGHPTEEDLTALRLLVQLWFGVIQSC
3bruA           ARLLDQAFLDGSLAPLARLFTRAEEGARFRRGCLVGNLGQEGALPDDFRAALIGVLETWQRRTAQLFREA
1bj0A           HDYSLPAAG-ESWQSFLRNNAMSFRRALLRYRDGAKVHL-GTRPDEKQYDTVETQLRFMTENGFSLRDGL
3cjdB           GAAVGAVDHPNERLIASHAYLAFAREHPKLWRALFDVERSDGPVPQ-----WYGHAAQLFSYITTPLAKI
3cdlA           VVYRPLVSLREQLLELLWKRNLTDSSFLDLARVVVGATIHSPERAQ----------VWLEETFSAWIRAA
3bt9B           QEQWKKEQIKAKTNREKFLYNELSLTTEYYYPNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEG
3dpjB           AQLADWQGTGDSPRARIASFIDLINRAKITRYGCPVGS--LCTELSKLDHAAQGQANGLFTLFRDWLQRQ
3cjdA           GAAV-----GDDHPNERLIASHAYLAFAREHPKLWRALFDVERSDGPVPQ-WYGHAAQLFSYITTPLAKI
3bruB           DQAFLDGSLAPLARLRLFTRAEEGARHGFRRGCLVGNLGQEGALPDDFRAALIGVLETWQRRTAQLFREA
3cwrA           FPGFEADPQDAAAALERIVYDIAQAVLSREAVSLFRLASDADLRNRFLPAYNANGIERSRRELARWLDQQ
3br5D           QEQWKSEQIKCKTNREKYLYNELSLTTQYYYPLQNAEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEG
3br3A           QEQWKSEQIKAKTNREKYLYNELSLTTQYYYPNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEG
3dpjF           AQLADWQGTGDSPRARIASFIDLINRAKITRYGCPVLCTELSKLDHAAQGQANGLFTLFRDWLQRQFAEA
3br5A           QEQWKSEQIKCKTNREKYLYNELSLTTQYYYPLQNAEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEG
3br2E           QEQWKKEQIKAKTNREKFLYNELSLTTEYYYPNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKEG
3btiB           QEQWKKEQIKAKTNREKFLYNELSLTTEYYYPNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEG
3br2D           QEQWKKEQIKAKTNREKFLYNELSLTTEYYYPNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKEG
3br3B           QEQWKSEQIKAKTNREKYLYNELSLTTQYYYPLQNAEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEG
3bqzA           QEQWKKEQIKAKTNREKFLYNELSLTTQYYYPNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEG
2d6yB           ISVPVDPDDIEGWIDR---LLDYHAAHPELLRLLFWEGEYGTAELP-----HEAERQEHYARKVAAVRDG
2eh3A           ISLFEENKEKTPEE------LLEFLEVLYREKKVVYIFLFDLLCSEKFRNIYFEKIEDAKRRFEKFLEKH
2dtzD           QEQWKKEQIKAKTNREKYLYNELSLTTEYYYPNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEG
3br2A           QEQWKKEQIKAKTNREKFLYNELSLTTEYYYPNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKEG
3dewA           GQLDDIRGQAPLAVTAYLWTIQRHRNNPQLLRFYTS---ELTNPTPCFAAIVSPAIASVIRLLAESIEAG
2dtzB           KKEQIKAKTNREKF---YLYNELSLTTEYYYPLQNAIEFYTEYKTNSINEKMNKLENKYIDAYHVIFKEG
3cdlB           -PLVSLREQLLELLWGK--RNLTDSSFLDLARVVVGATIHSPERAQ------VWLARINEETFSAWIRAA
3bniA           AERVTERLTEAGD-GGWRGALDTVLDEYLAMKRTAPGFSLIDFGRVAERLTLGRRPDDDLRRVFLVAVET
3br1D           QEQWKKEQIKAKTNREKFLYNELSLTTQYYYPNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEG
2dg8A           VAVFDEHLGAAADRDEAEAVADLVHELSEDSQRDLVLTQELYTLAA-RQPAYRELTHEWMRRSRVHLEKH
3bqzB           QEQWKKEQIKAKTNREKFLYNELSLTTQYYYPLQNAIIE--FYTEYTNINEMNKLENKYIDAYHVIFKEG
2dg8D           VAVFDEHLGAAADRDEAEAVADLVHELSEDSQRDLVLTQELYTLAARQPA-YRELTHEWMRRSRVHLEKH
2d6yA           ISVPVDPDDIEGWIDR---LLDYHAAHPELLRLLFWEGEYGTAELP-----HEAERQEHYARKVAAVRDG
2dg8B           VAVFDEHLGAAADRDEAEAVADLVHELSEDSQRDLVLTQELYTLAARQPA-YRELTHEWMRRSRVHLEKH
3br5B           QEQWKSEQIKCKTNREKYLYNELSLTTQYYYPLQNAIEFYTEYKTNSINEKMNKLENKYIDAYHVIFKEG
3colB           LSTTDLDRLSDST-IDVTTRIRLYVQQVYDYSLANPDSLTIIQQIKALNPNANLLTAAIDAKVIKQLPVS
2dg8C           VAVFDEHLGAAADRDEAADLVHELSEDSQRDLVLTQELYTLAARQPAYRELTHEWMRRSRVHLEKHFDPG
3bniB           AERVTERLTEAGDRGALDTVLDEYLAMKRTAPGFSLGHRVAERLTELLSGYLGRRPDDDLRRVFLVAVET
3crjD           HDVETTDPEARLNLLLDELLVKPQENPDLSVALLERSQAPYKEAFSDRFRQNDEYVRY----LKAVINHG
3egqB           FNPRSVEE----VVDYGIGFIAERREFIEFYALSQVRIEELERFGEALE---------------------
3bqyA           ERTARLARALRAALLAHAGTHATGPNTLRFADGLVGVLREAGFGDGDAARALYSVANFTVGHTLEEQAAL
3egqA           F----NPRSVEEVVDYGIGFIAERREFIEFYALSQVRIEELERFGEALE---------------------
2dt5A           KRELRHILGLNRKWGLGMGRLGSALADYPGFGESFELRGFFDVDPEKVGRPVRGGVIEHVDLLPQRVPGR
3crjB           VDSIHDVETTDPEARLNLLLDELLVKPQENPDLSVALLERSQAPYKEAFSDRFRQNDEYVRYLKAVINHG
3br2B           KKEQIKAKTNREKFYL---YNELSLTTEYYYPLQNAIIEFYTEYTNSINEKMNKLQNKYIDAYHVIFKEG
1aerB           PEAAGEVERLIGHPLPLRLDAGPRLETILGWPLAERTVVIPSAIPTDPRNVGGDLDPSSIPDK-------
3crjA           VDSIHETTDPEARLNLLLDELLVKPQENP-DLSVALLERSQAPYKEAFSDRFRQNDEYVRYLKAVINHGI
3br1B           QEQWK-KEQIKA--KTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYNEKMNKLENKYIDAYHVIFKEG
3bjbD           GESP------------------------------------------------------------------
3br6B           QEQWKSEQIKAKTNREKFLYNELSLTTEYYYPLQNAIEFYTEYYTNSINEKMNKLQNKYIDAYHVIFKEG
3crjC           VDSIHDVETTDPEARLNLLLDELLVKPQENPDLSVALLERSQAPYKEAFSDRFRQNDEYVRYLKAVINHG
2bjcA           AELNYIPNRCAQQL--------------------------------------------------------
1cjgA           AELNYIPNRVAQQL--------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QEDGDMDATPEQVDAICTNIVVIATYWLSFQFVQHPRQYNDPEQIRGYLHGSSYHIFSILAPYLRGKARE
3b6cA           LHDELAAYGGDLLST----FVTAEALEQSSRVFADQLHGYLKSLPATSFP----NLVHLAGPITSLDSDR
3b6cB           RSGGLHDELAAYGGDLLSTFVTAEALEQSSRGVFADQ---LHGYLKSLPATSFPNLVHLAGPITSLDSDR
3c2bB           RRSGYLRFDDAEEAY---RSFYGLIVSDLHVRLLGEAPDDFSARAK--------KAVVAFLTLYGTEKVH
3b6aA           RSGGLHDELAAYGDLLSTFVTAEALEQSSRQGREQAGVFADHGYLKSLPATSFPNLVHLAGPITSLDSDR
3c07A           LAGAK-TKVPEELRDILPELWLSQGLVLYWIFDRTEGRERSYRLAERGARLTARGVVLARFRVLRPLVRE
3e7qB           AEEGGWADFDAELAAISLSALLDG---LWLESGLNPATF-TPRQGVQICE----AWVDGLEAGAHRRFR-
3bjbF           GIEHPTEEDLTALRLLVQLWFGVIQSCLNGRVSIPDAESDIRRACDLLLVNLSH----------------
3bjbE           GIEHPTEEDLTALRLLVQLWFGVIQSCLNGRVSIPDAESDIRRACDLLLVNLSH----------------
3c2bA           RRSGYLR--FDDAEEAYRSFYGLIVSDLHVRLLGEAPDKDFSARAK--------KAVVAFLTLYGTEKVH
3c07B           LAGAKTKVPEELRDILPELWLSQGLYWIFDRTEGRERSYRLAERARLTARGVVLARFRVLRPLVR-----
3bjbC           GIEHPTEEDLTALRLLVQLWFGVIQSCLNGRVSIPDAESDIRRACDLLLVNLSH----------------
3bhqA           TNRGLIQTGDPYLAAS---HLFGLLWIPNEAFTGSNRR--SKAELERHAD----ASVEAFLAVY------
3colA           IDAKVIKQLPVSLHGVVFSTIHTHTTNISKGRYAQDQY--TFGDIFQIWDA-------------------
3e7qA           AEEGGWADFDAELAAISLSALLDG---LWLESGLNPATF-TPRQGVQICE----AWVDGLEAGAHRRFR-
3bjbB           GIEHPTEEDLTALRLLVQLWFGVIQSCLNGRVSIPDAESDIRRACDLLLVN-------------------
1bjyB           AISAVSHFTLGAVLEQQEHTAALNLPPLLREALQIMDSDDGEQAFL--------HGLESLIRGFEVQLTA
1bjzA           YAISAV---SHFTLGAVLEQQEHNLPPLLREALQIMDSDDGEQAFL--------HGLESLIRGFEVQLTA
3ccyA           RPDAANR--TLAHVDTLFFGINWTYTWYKADGSVSPDAL-------------------------------
3br6A           NLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNG-------------------
3dpjE           FAEAGCTTEAPALAHLLARSQGAATLAQSFHDEGFLRSEVADHRW-------------------------
3dpjA           FAEAGCTTEAPALAHLLARSQGAATLAQSFH---------------------------------------
3b6aB           RSGGLHDELAAYGGDLLSTFVTAEALEQSSRNPGTAGVFADHGYLKSLPATSFPNLVHLAGPITSLDSDR
3dcfB           VATGELLDVDPTVAT---ATLLGAAIWTYRWYDPEGR---------------------------------
2dg7A           QVDADTA--ELVAQLATVAFGSAFRRWIDAEGHADFGSCLDTDRLRAVLTG-------------------
1du7A           AISAVSHFTLGAVLEQQEHTADENLPPLLREALQIMDSDDGEQAFL--------HGLESLIRGFEVQLTA
3cwrB           ASAGRLPLPIPAERVADLLLSAVIAEPLRQITLGLREP-LPAWDIAPRVA----DAVRLIAP--------
3br5E           NLNGEWSINDVNAVS---KIAANAVNGIVTFTHEQNINERINKFSQIFLNG-------------------
3br0B           NLNGEWSINDVNAVS---KIAANAVNGIVTFTHEQNIN-ERIKLMNKFSQ--------------------
1a6iA           YAISAVSHFTLGAVL----EQQEHLPPLLREALQIMDSDDGEQAFL--------HGLESLIRGFEVQLTA
3br0A           NLNGEWSINDVNAVS---KIAANAVNGIVTFTHEQNINERINKFSQIFLNG-------------------
3b81A           NEEGVF---KVKYPLETAEIILTLSHFYLDEDLFKWKKE-DSLKLTAFK---------------------
3dcfA           VATGELLDVDPTVAT---ATLLGAAIWTYRWYDPEGR---------------------------------
3bjbA           LNGRVSIPDAESDIRRACDLLL------------------------------------------------
3bruA           QACGELS--ADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGR--------------------
1bj0A           YAISAVSHFTLGAVL----EQQEHLPPLLREALQIMDSDDGEQAFLHGLE----SLIRGFEVQLTALLQI
3cjdB           FPESDDAE---LDLTRTLFSSVHGIVLLGLENRISGVPGEQLKTIRLLLEQ-------------------
3cdlA           QKDGRLKPVDPGFAA---TQHALLKSFAFWPQVTFNAALLTPQEQSNVVE----SALNFLGWYEI-----
3bt9B           NLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNG-------------------
3dpjB           FAEAGCTTEAPALAHLLARSQGAATLAQSFH---------------------------------------
3cjdA           FPESDDAE---LDLTRTLFSSVHGIVLLGLENRISGVPGEQLKTIRLLLEQ-------------------
3bruB           QACGELSADHDPDALAEAFWIGWEGAILRAKLELRP----------------------------------
3cwrA           ASAGRLPLPIPAERV--ADLLLSAVIAEPLRQITLGLREPLPAWD-------------------------
3br5D           NLNGEWSINDVNAVSKIAANAVNGIVTFTEQNINERIKLMN-KFSQIFLNG-------------------
3br3A           NLNGEWSINDVNAVS---KIAANAVNGIVTFTHEQNIN-ERIKLMNKFSQ--------------------
3dpjF           GCTTEAPALA-------HLLARSQGAATLAQSFHDEGFLRSEVADHRWL---------------------
3br5A           NLNGEWSINDVNA-------VSKIAANAVNGIVTFTQNINERIKLM------------------------
3br2E           NLNGEWSINDVNAVS---KIAANAVNGIVTFTHEQNINERIKKFSQIFLNG-------------------
3btiB           NLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNG-------------------
3br2D           NLNGEWSINDVNAVS---KIAANAVNGIVTFTHEQNINERINKFSQIFLNG-------------------
3br3B           NLNGEWSINDVNAVSKIAANAVNGIVTFTEQNINERIKLMN-KFSQIFLNG-------------------
3bqzA           NLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNG-------------------
2d6yB           QERGVITDAIPAPDL--LFLLVAANWAVVVPQKRILVG-GGDAGTDGLRD----SIKKAARRIVD-----
2eh3A           FPSK------------------------------------------------------------------
2dtzD           NLNGEWSINDVN-------AVSKIAANAVNGIVTFTQNINERIKLM------------------------
3br2A           NLNGEWSINDVNAVS---KIAANAVNGIVTFTHEQNI---------------------------------
3dewA           TRGLFRDLHAVNSALALAGVNYFFLSTLATEGLTSHSPDQDEELIRQYV---------------------
2dtzB           NLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNG-------------------
3cdlB           QKDGRLKPVDPGFAA---TQHALLKSFAFWPQVTFNAALLTPQEQSNVVE----SALNFLGWYEI-----
3bniA           ADTLVQLAFRVAPDGDEKIIEEARELLRAY----------------------------------------
3br1D           NLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNG-------------------
2dg8A           FDPGTARQLDALIEGL------------------------------------------------------
3bqzB           NLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNG-------------------
2dg8D           FDPGTARQLDALIEGL------------------------------------------------------
2d6yA           QERGVI---TDAIPAPDLLFLLVAANWAVVVPQKRILVGGGDAGTDGLRD----SIKKAARRIV------
2dg8B           FDPGTARQLDALIEGL------------------------------------------------------
3br5B           NLNGEWSINDVNAVS---KIAANAVNGIVTFTHEQNI---------------------------------
3colB           LHGVVFSTIHTHTTNISKGRYAQDQYTFGD----------------------------------------
2dg8C           TARQLDAL--------------------------------------------------------------
3bniB           ADTLVQLAAPDGDEKIIEEARELLRAYLG-----------------------------------------
3crjD           IDEGVFTDVDAEHVT---RSLLTIIDGARTRAVLDDTE--ELETARQTAS--------------------
3egqB           ----------------------------------------------------------------------
3bqyA           TPGGGGPLDEATL----REAVAAGTYPHLAATLPVLTSTDFTAHFEFGL---------------------
3egqA           ----------------------------------------------------------------------
2dt5A           IEIALLTVPREAAQKAADLLVAAG----------------------------------------------
3crjB           IDEGVFTDVDAEHVT---RSLLTIIDGARTRAVLDDTE--ELETARQTAS--------------------
3br2B           NLNGEWSINDVNAVS-------------------------------------------------------
1aerB           ----------------------------------------------------------------------
3crjA           DEGVFTDVDAEHV----TRSLLTIIDGARTRAVLDDTE--ELETARQTAS--------------------
3br1B           NLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNG-------------------
3bjbD           ----------------------------------------------------------------------
3br6B           NLNGEWSINDVNAVS----KIAANAVNGIVTFTHEQNINERIKLMNKFSQ--------------------
3crjC           IDEGVFTDVDAEHVTR---SLLTIIDGARTRAVLDDTEELET----------------------------
2bjcA           ----------------------------------------------------------------------
1cjgA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AFDQxxxxxxxxxxxxxxxxxxxxxx
3b6cA           RFE-----------------------
3b6cB           RFE-----------------------
3c2bB           S-------------------------
3b6aA           RFE-----------------------
3c07A           VHEL----------------------
3e7qB           --------------------------
3bjbF           --------------------------
3bjbE           --------------------------
3c2bA           S-------------------------
3c07B           --------------------------
3bjbC           --------------------------
3bhqA           --------------------------
3colA           --------------------------
3e7qA           --------------------------
3bjbB           --------------------------
1bjyB           L-------------------------
1bjzA           L-------------------------
3ccyA           --------------------------
3br6A           --------------------------
3dpjE           --------------------------
3dpjA           --------------------------
3b6aB           RFE-----------------------
3dcfB           --------------------------
2dg7A           --------------------------
1du7A           L-------------------------
3cwrB           --------------------------
3br5E           --------------------------
3br0B           --------------------------
1a6iA           L-------------------------
3br0A           --------------------------
3b81A           --------------------------
3dcfA           --------------------------
3bjbA           --------------------------
3bruA           --------------------------
1bj0A           --------------------------
3cjdB           --------------------------
3cdlA           --------------------------
3bt9B           --------------------------
3dpjB           --------------------------
3cjdA           --------------------------
3bruB           --------------------------
3cwrA           --------------------------
3br5D           --------------------------
3br3A           --------------------------
3dpjF           --------------------------
3br5A           --------------------------
3br2E           --------------------------
3btiB           --------------------------
3br2D           --------------------------
3br3B           --------------------------
3bqzA           --------------------------
2d6yB           --------------------------
2eh3A           --------------------------
2dtzD           --------------------------
3br2A           --------------------------
3dewA           --------------------------
2dtzB           --------------------------
3cdlB           --------------------------
3bniA           --------------------------
3br1D           --------------------------
2dg8A           --------------------------
3bqzB           --------------------------
2dg8D           --------------------------
2d6yA           --------------------------
2dg8B           --------------------------
3br5B           --------------------------
3colB           --------------------------
2dg8C           --------------------------
3bniB           --------------------------
3crjD           --------------------------
3egqB           --------------------------
3bqyA           --------------------------
3egqA           --------------------------
2dt5A           --------------------------
3crjB           --------------------------
3br2B           --------------------------
1aerB           --------------------------
3crjA           --------------------------
3br1B           --------------------------
3bjbD           --------------------------
3br6B           --------------------------
3crjC           --------------------------
2bjcA           --------------------------
1cjgA           --------------------------