[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07796.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dxjF.bssp"
#ERROR : Can't open dsspfile "3c57A.bssp"

## Summary of PDB Search
:188
    8e-12  11%  3dxjF  [x.x.x] RNA POLYMERASE PRICIPAL SIGMA FACTOR (RPOD)
    4e-04  24%  3c57A  [x.x.x] TWO COMPONENT TRANSCRIPTIONAL REGULATORY PROTEIN
:188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxVRDDEAALDIVQDAMIKLAEKYGDKSAAELPPLFQRILQNTIHDW
3dxjF           -------------------------TGRGLSFLDLIQEGNQGLVEKFEYKRRFKFSTYATWWIRQAINRA
3c57A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FRRQKVRNTWVTLFSNLRDEREGDDSDLLDTLEAQAGTEMAESSADKVERAQVMHIIEQEIQRLPTRQRE
3dxjF           IADQARTIRIPVHMVETINKLSRTARQLQQ----------------ELGREPTYEEIAEAMGPGWDAKRV
3c57A           ---------------------------------------------------------------LTDQERT


                         +         .         .         .         .         *         .:210
query           AFLMRYWEDMDVAETAAVMGCSEGSVKTHCSRATHTLAQALRAxxxxx
3dxjF           EETLKIAQEPVSLETPIGDEKDSFYGDFIPDEHLPSPVDAA-------
3c57A           LLGLLS-EGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRT-----