[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07810.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dm6A.bssp"
#ERROR : Can't open dsspfile "2eerB.bssp"
#ERROR : Can't open dsspfile "2cdbC.bssp"
#ERROR : Can't open dsspfile "3cosD.bssp"
#ERROR : Can't open dsspfile "2cdbA.bssp"
#ERROR : Can't open dsspfile "2eihA.bssp"
#ERROR : Can't open dsspfile "3b70A.bssp"
#ERROR : Can't open dsspfile "2cd9B.bssp"
#ERROR : Can't open dsspfile "2cdaB.bssp"
#ERROR : Can't open dsspfile "1e3lB.bssp"
#ERROR : Can't open dsspfile "2c0cA.bssp"
#ERROR : Can't open dsspfile "2c0cB.bssp"
#ERROR : Can't open dsspfile "1e3eA.bssp"
#ERROR : Can't open dsspfile "1axeA.bssp"
#ERROR : Can't open dsspfile "1a71A.bssp"
#ERROR : Can't open dsspfile "2cd9A.bssp"
#ERROR : Can't open dsspfile "1e3lA.bssp"
#ERROR : Can't open dsspfile "2cdbB.bssp"
#ERROR : Can't open dsspfile "2cdaA.bssp"
#ERROR : Can't open dsspfile "2dphA.bssp"
#ERROR : Can't open dsspfile "2eerA.bssp"
#ERROR : Can't open dsspfile "1e3eB.bssp"
#ERROR : Can't open dsspfile "1axgA.bssp"
#ERROR : Can't open dsspfile "1d1tA.bssp"
#ERROR : Can't open dsspfile "2dq4A.bssp"
#ERROR : Can't open dsspfile "2cf5A.bssp"
#ERROR : Can't open dsspfile "3cosA.bssp"
#ERROR : Can't open dsspfile "1bxzA.bssp"
#ERROR : Can't open dsspfile "1ee2A.bssp"
#ERROR : Can't open dsspfile "1d1sA.bssp"
#ERROR : Can't open dsspfile "2d8aA.bssp"
#ERROR : Can't open dsspfile "2b5vA.bssp"
#ERROR : Can't open dsspfile "2b5wA.bssp"
#ERROR : Can't open dsspfile "3b6zA.bssp"
#ERROR : Can't open dsspfile "2dfvA.bssp"
#ERROR : Can't open dsspfile "1cdoA.bssp"
#ERROR : Can't open dsspfile "1e3jA.bssp"
#ERROR : Can't open dsspfile "2b83A.bssp"
#ERROR : Can't open dsspfile "1dlgA.bssp"
#ERROR : Can't open dsspfile "2dg2A.bssp"
#ERROR : Can't open dsspfile "3e8wA.bssp"
#ERROR : Can't open dsspfile "3eeqB.bssp"
#ERROR : Can't open dsspfile "2ebjA.bssp"
#ERROR : Can't open dsspfile "3dwiA.bssp"
#ERROR : Can't open dsspfile "3dwgB.bssp"
#ERROR : Can't open dsspfile "3dwgA.bssp"
#ERROR : Can't open dsspfile "3c3pB.bssp"
#ERROR : Can't open dsspfile "1dl5A.bssp"
#ERROR : Can't open dsspfile "2eguA.bssp"
#ERROR : Can't open dsspfile "1dl5B.bssp"
#ERROR : Can't open dsspfile "3dkiA.bssp"
#ERROR : Can't open dsspfile "3d3jA.bssp"
#ERROR : Can't open dsspfile "1ch6A.bssp"
#ERROR : Can't open dsspfile "2bhtD.bssp"
#ERROR : Can't open dsspfile "3dwiB.bssp"
#ERROR : Can't open dsspfile "3c85D.bssp"
#ERROR : Can't open dsspfile "3dkiB.bssp"
#ERROR : Can't open dsspfile "3cvjA.bssp"
#ERROR : Can't open dsspfile "3e90B.bssp"
#ERROR : Can't open dsspfile "3c85C.bssp"
#ERROR : Can't open dsspfile "3e90D.bssp"
#ERROR : Can't open dsspfile "1d6sA.bssp"
#ERROR : Can't open dsspfile "3ctmB.bssp"
#ERROR : Can't open dsspfile "2cnbB.bssp"
#ERROR : Can't open dsspfile "2cfcA.bssp"

## Summary of PDB Search
:334
    6e-54  20%  2dm6A  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    1e-53  28%  2eerB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-52  16%  2cdbC  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    3e-52  17%  3cosD  [x.x.x] ALCOHOL DEHYDROGENASE 4
    4e-52  17%  2cdbA  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    6e-52  35%  2eihA  [x.x.x] ALCOHOL DEHYDROGENASE
    6e-52  18%  3b70A  [x.x.x] ENOYL REDUCTASE
    3e-51  16%  2cd9B  [x.x.x] GLUCOSE DEHYDROGENASE
    3e-51  16%  2cdaB  [x.x.x] GLUCOSE DEHYDROGENASE
    3e-51  16%  1e3lB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    5e-51  23%  2c0cA  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    1e-50  21%  2c0cB  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    4e-50  16%  1e3eA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    1e-49  18%  1axeA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    4e-49  18%  1a71A  [b.35.1 - c.2.1] LIVER ALCOHOL DEHYDROGENASE
    6e-49  16%  2cd9A  [x.x.x] GLUCOSE DEHYDROGENASE
    8e-49  16%  1e3lA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    1e-48  16%  2cdbB  [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
    1e-48  16%  2cdaA  [x.x.x] GLUCOSE DEHYDROGENASE
    2e-48  16%  2dphA  [x.x.x] FORMALDEHYDE DISMUTASE
    4e-48  29%  2eerA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-47  16%  1e3eB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
    2e-47  18%  1axgA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    3e-47  18%  1d1tA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    4e-46  24%  2dq4A  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    4e-46  22%  2cf5A  [x.x.x] CINNAMYL ALCOHOL DEHYDROGENASE
    6e-46  18%  3cosA  [x.x.x] ALCOHOL DEHYDROGENASE 4
    6e-46  19%  1bxzA  [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    1e-45  18%  1ee2A  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    3e-45  18%  1d1sA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
    2e-44  25%  2d8aA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    2e-44  15%  2b5vA  [x.x.x] GLUCOSE DEHYDROGENASE
    1e-43  15%  2b5wA  [x.x.x] GLUCOSE DEHYDROGENASE
    5e-43  18%  3b6zA  [x.x.x] ENOYL REDUCTASE
    7e-43  24%  2dfvA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    2e-42  19%  1cdoA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-42  23%  1e3jA  [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE
    4e-37  18%  2b83A  [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-31   9%  1dlgA  [d.68.2] UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
    7e-29  13%  2dg2A  [x.x.x] APOLIPOPROTEIN A-I BINDING PROTEIN
    8e-28   8%  3e8wA  [x.x.x] TAKEOUT-LIKE PROTEIN 1
    1e-26  10%  3eeqB  [x.x.x] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G
    2e-26  18%  2ebjA  [x.x.x] PYRROLIDONE CARBOXYL PEPTIDASE
    1e-17  13%  3dwiA  [x.x.x] CYSTEINE SYNTHASE B
    1e-17  11%  3dwgB  [x.x.x] CYSTEINE SYNTHASE B
    3e-17  10%  3dwgA  [x.x.x] CYSTEINE SYNTHASE B
    3e-16   9%  3c3pB  [x.x.x] METHYLTRANSFERASE
    8e-16  13%  1dl5A  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    1e-15  13%  2eguA  [x.x.x] CYSTEINE SYNTHASE
    4e-14  11%  1dl5B  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    5e-14  10%  3dkiA  [x.x.x] CYSTEINE SYNTHASE B
    9e-14   9%  3d3jA  [x.x.x] ENHANCER OF MRNA-DECAPPING PROTEIN 3
    1e-12   6%  1ch6A  [x.x.x] GLUTAMATE DEHYDROGENASE
    6e-12  12%  2bhtD  [x.x.x] CYSTEINE SYNTHASE B
    7e-12  12%  3dwiB  [x.x.x] CYSTEINE SYNTHASE B
    6e-11  11%  3c85D  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    2e-10  13%  3dkiB  [x.x.x] CYSTEINE SYNTHASE B
    1e-09  12%  3cvjA  [x.x.x] PUTATIVE PHOSPHOHEPTOSE ISOMERASE
    3e-09  18%  3e90B  [x.x.x] NS3 PROTEASE
    1e-07  12%  3c85C  [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
    1e-07  19%  3e90D  [x.x.x] NS3 PROTEASE
    4e-04  22%  1d6sA  [c.79.1] O-ACETYLSERINE SULFHYDRYLASE
    5e-04  35%  3ctmB  [x.x.x] CARBONYL REDUCTASE
    7e-04  10%  2cnbB  [x.x.x] UDP-GALACTOSE-4-EPIMERASE
    9e-04  24%  2cfcA  [x.x.x] 2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKAIEIREYGAPEVLQETQRPDPEPKAGEILIRVAAAGINRPDVFQRTGNYPVPPGASDLPGLEVAGVVV
2dm6A           AKSWTLKKHFQQSDFELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKEGAV----MMGQQVARVVE
2eerB           MRAMRLVEIGKPLKLED--IPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNLRIVEDLGGHEIAGRIE
2cdbC           MKAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGADREIVNGKLKDFLV----LGHEAIGVVE
3cosD           CKAAIAWEAGKPLCIEE--VEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPV-IVGHEAAGIVE
2cdbA           MKAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGADREIVNGKLKGKDFLV--LGHEAIGVVE
2eihA           MRAVVMRARGGPEVLEVADLPVPEPGPKEVRVRLKAAALNHLDVWVRKGVASPKLGVVDAVGPGVEGFAP
3b70A           QTALTVNDHDEVTVWNA--APCPMLPRDQVYVRVEAVAINPSDTKMRGQFATPWAF----LGTDYAGTVV
2cd9B           MKAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGTDREIVNGKLTLGKD-FLVLGHEAIGVVE
2cdaB           MKAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGTDREIVNGKLGKDFLV---LGHEAIGVVE
1e3lB           CKAAIAWKTGSPLCIEE--IEVSPPKACEVRIQVIATCVCHTDINATDPKKKALFPV--VLGHECAGIVI
2c0cA           MQKLVVTRLSPNAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVV
2c0cB           MQKLVVTRLSPNAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVV
1e3eA           CKAAIAWKTGSPLCIEE--IEVSPPKACEVRIQVIATCVCPTDINATDPKKKALFPV--VLGHECAGIVE
1axeA           CKAAVLWEEKKPFSIEE--VEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPV--IAGHEAAGIVE
1a71A           CKAAVLWEEKKPFSIEE--VEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVI--AGHEAAGIVE
2cd9A           MKAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGTDREIVNGKLTLSKGK--DFLVLGHEAIG
1e3lA           CKAAIAWKTGSPLCIEE--IEVSPPKACEVRIQVIATCVCHTDINATDPKKKALFPVV--LGHECAGIVE
2cdbB           MKAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGADREIVNGKLGKDFLV---LGHEAIGVVE
2cdaA           MKAIIVKPPNAGVQVKDVDEKKL-DSYGKIKIRTIYNGICGTDREIVNGKLKGKDFL--VLGHEAIGVVE
2dphA           NKSVVYHGTRDLTVPYPKLEHNNRKLEHAVILKVVSTNICGSDQHIYRGRFIVPKGHV--LGHEITGEVV
2eerA           MRAMRLVEIGKPLKLED--IPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNLRIVEDLLGHEIAGRIE
1e3eB           CKAAIAWKTGSPLCIEE--IEVSPPKACEVRIQVIATCVCPTDINATDPKKKALFPV--VLGHECAGIVI
1axgA           CKAAVLWEEKKPFSIEE--VEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPV--IAGHEAAGIVE
1d1tA           CKAAVLWEQKQPFSIEE--IEVAPPKTKEVRIKILATGICRTDDHVIKGTMVSKFPVI--VGHEATGIVE
2dq4A           MRALAK--LAPEEGLTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDAWARGRIRPVTGHEFSGVVE
2cf5A           TTGWAARDPSGILSPYT--YTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYP-MVPGHEVVGEVV
3cosA           CKAAIAWEAGKPLCIEE--VEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPV-IVGHEAAGIVS
1bxzA           MKGFAMLSIGKVGW---IEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGGSEVKDFKP
1ee2A           CKAAVLWEQKKPFSIEE--VEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVAPLPVI--AGHEAAGIVE
1d1sA           CKAAVLWEQKQPFSIEE--IEVAPPKTKEVRIKILATGICRTDDHVIKGTMVSKFP--VIVGHEATGIVE
2d8aA           -KVAIKTKPGYGAELVE--VDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPIGHEVAGEVV
2b5vA           MKAIAVKRGR----PVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVVV
2b5wA           MKAIAVKRGEDRPVVIE--KPRPEPESGEALVRTLRVGVCGTDHEVIAGGHGGFPEGEDHLVLGHEAVGV
3b6zA           QTALTVNDHDEVTVWNA--APCPMLPRDQVYVRVEAVAINPSDTKMRGQFATPWAF----LGTDYAGTVV
2dfvA           -KVAIKTKPGYGAELVE--VDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPPGVEVSVETH
1cdoA           CKAAVAWEANKPLVIEE--IEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKDGF-PVVLGHEGAGIVE
1e3jA           LSAV----LYKQNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIAIVKDPMVIGHEASGTVV
2b83A           MKGFAMLG---INKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGANMILGGSEVKDFKPGDRVI
1dlgA           --------------MKLLTQLGTKVERGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQVS
2dg2A           ----------------------------------------------------------------------
3e8wA           ----------------------------------------------------------------------
3eeqB           ------------------------------------------------------------DAFSAGETIK
2ebjA           ----------------------------------------------------------------------
3dwiA           ----------------------------------------------------------------------
3dwgB           ----------------------------------------------------------------------
3dwgA           ----------------------------------------------------------------------
3c3pB           ----------------------------------------------------------------------
1dl5A           ----------------------------------------------------------------------
2eguA           ----------------------------------------------------------------------
1dl5B           ----------------------------------------------------------------------
3dkiA           ----------------------------------------------------------------------
3d3jA           ----------------------------------------------------------------------
1ch6A           VRGIL---RIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSHQRTPCKGGIRALASLMTYKCAVVDVPF
2bhtD           ----------------------------------------------------------------------
3dwiB           ----------------------------------------------------------------------
3c85D           ----------------------------------------------------------------------
3dkiB           ----------------------------------------------------------------------
3cvjA           ----------------------------------------------------------------------
3e90B           HKWNGQDEVQMIVVEPGKNVKNVRTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIM
3c85C           ----------------------------------------------------------------------
3e90D           HKWNGQDEVQMIVVEPGKNVKNVRTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIM
1d6sA           ----------------------------------------------------------------------
3ctmB           ----------------------------------------------------------------------
2cnbB           ----------------------------------------------------------------------
2cfcA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GGDLSHPANRFGLKAGDRVCALVQGGGYAELCTAPIEQCLPVPEGLTDIEAAALPETFFTVWSNVFDRGQ
2dm6A           SK----NSAFPAGSIVLAQSGW-TTHFISDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTAYFGLLEVCG
2eerB           ----EVGDEVVGYSKGDLVAVNPWEGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTYRAVRKASL
2cdbC           ESYHGFSQGDLVMPVNRRGCIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQ
3cosD           DQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAK
2cdbA           ESYHGFSQGDLVMPVNRRGCIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQ
2eihA           GDEVVINAGEDNLCPRYQILGEHRHGTYAEYVVLPEANLAPKPKNLSFEEAAAIPLTFLTAWQMVVDKLG
3b70A           AVGSDVT----HIQVGDRVYGAQNEGAFSQYTVTRGRVWAKIPKGLSFEQAAALPAGISTAGLAMKLLGL
2cd9B           ----ESYHGFSQGDLVMPVGEFGEAGIMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQ
2cdaB           RNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQ
1e3lB           DQELMEDRTSRFTCKGRSIYHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAK
2c0cA           AL----GLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLS
2c0cB           AL----GLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLS
1e3eA           DQELMEDRTSRFTCKGRSIYHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAK
1axeA           RGTMQDGTSRFTCR-GKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAK
1a71A           SIGEGVTTVRPGDKVGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAK
2cd9A           ----VVEESYHGFSQGDLVMPVNRRGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQ
1e3lA           SQELMEDRTSRFTCKGRSIYHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAK
2cdbB           ES----YHGFSQGDLVMPVNIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQ
2cdaA           RNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQ
2dphA           EKGSDVELMDIGDLGAFGFDLKGWSGGQAEYVLVPYADYMLLKFGDKEQAMEKIKDLTLISDILPTGFHG
2eerA           ----EVGDEVVGYSKGDLVAVNPWEGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTYRAVRKASL
1e3eB           DQELMEDRTSRFTCKGRSIYHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAK
1axgA           ----SIGEGVTTVRPGDKVIHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAK
1d1tA           SIGEGVTTVKPGDKVGKPVHHFLNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGK
2dq4A           AVGPGVRRPQVGDHVSHACPACRTGGGFAEYVVVPAENAWVNPKDLPFEVAAILEPFGNAVHTVYAGSGV
2cf5A           SPCERDLEQYCPSYNDVYINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGL
3cosA           DQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTGYGAAINNAK
1bxzA           GDRVVVPHQHSGGMLAGWKFSNVGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADI
1ee2A           SIGEGVTTVRPGDKRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLVGCGFSTGYGSAVKVAK
1d1sA           SIGEGVTTVKPGDKVGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGK
2d8aA           GDYVSVETHIVCGKCYTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVD---TVLAG
2b5vA           DPNDTELEEGDIVVPASGTNEYFERDQMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASR
2b5wA           VVDPNDTELEEGRPPASGTNIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASR
3b6zA           AVGSDVT----HIQVGDRVYGAQNEGAFSQYTVTRGRVWAKIPKGLSFEQAAALPAGISTAGLAMKLLGL
2dfvA           IVCGKCYACRRGVCQNTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEPLGNAVDTVLAGPIS
1cdoA           ----SVGPGVTEFQPGEKVIPLFISQTFSQYTVVNQIAVAKIDPSAPLDTVCLLGCGVSTGFGAAVNTAK
1e3jA           ----KVGKNVKHLKKGDRVAVEPGVGNLARYYVHAADFCHKLPDNVSLEEGALLEPLSVGVHACRRAGVQ
2b83A           VPCTTPDWRSLEVQAGFPQHSNFKDGVFGEYFHVNDADLAILPKDMPLENAVMITDMMTTGFHGA-ELAD
1dlgA           ----LPGGSAIGARPVDLHIFGLEK--LGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAAT
2dg2A           -------------------------LSQEEAQAVDQELFNEYQFSVDQLELAGLS--CATAIAKAYPPTS
3e8wA           ----------------------------------------------------------------------
3eeqB           EK----LKSFEIPVVHYRYKDAEIETIWKCYDAMALEGATRIVCKYAKEDPAIVCIDDKINYVIP-----
2ebjA           ------------------VTGFEPFGSLEHNPSQALLDLLPSEVDGKPLRKAVLPVDAEALGEALEDLHR
3dwiA           ------------MTRYDSLLQALGNPRWDDGRDGPHVRLWAKLEDRNP-TGSIKDRPAVRMIEQAEADGL
3dwgB           -----------QALGNTPLVGLQRSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIEQAE-ADGL
3dwgA           -----------QALGNTPLVGLQRSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIE-------Q
3c3pB           -------------------------SRIGAYLDGLLPEADPVVAAEQIARERNIPIVDRQTGRLLYLLAR
1dl5A           ---------------SDHIAKAFLEEEFLTKSYPLSYVYEDIVLVSYDDGEEYSTSSQPSLMALFMEWVG
2eguA           -------------RTVNSITELIGDVKLNRIVDEDSADVYLKLEFMNPGSSVKDRIALAMIEA-AEKAGK
1dl5B           ---------GVSDHIAKAFLE-IPREEFLTKSYPLSYVYEDIVLVSYDDGEEYSTSSQPSLMALFMEWVG
3dkiA           -----------QALGNTPLVGLQRSPRWDDGRDGPHVRLWAKLEDRNP--TGSIDRPAVRMIEQAEADGL
3d3jA           -------------------------IVPSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLEMTG
1ch6A           ----GGAKAGVKINPKNYTGPGVDSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGR----
2bhtD           ----------------STLEQTIGNTPLVKLQRMGPDNGSEVWLKLEGNPAGSVDRAALSMIVEAEKRGR
3dwiB           ------------MTRYDSLLQALGNRWDDGRDGPHVRLWAK-LEDRNPTGSIKDRPAVRMIEQAE-ADGL
3c85D           ------------------------------------------------ILGGRIGTGAYDELR--AISLG
3dkiB           ------------MARYDSLLQALGNPRWDDGRDGPHVRLWAKLEDRNPTGSIDRP--AVRMIEQAEADGL
3cvjA           ------------AVNGGRFYVFGSGHSHEEIYNRAGGLALVTALLHERPNKSTYLERIEGLSKSYLKLHQ
3e90B           PNG----SYISAIVQGKRMDEPI-----------------------------------------------
3c85C           ----------------------------------------------------------------------
3e90D           PN----GSYISAIVQGKRM---------------------------------------------------
1d6sA           ------------------------------------------VESRNPSFSVACRIGANMIWDAE-KRGV
3ctmB           ---------------------------------------MGEIESYCNKELGPLPTKAPTLSKNVLDLFS
2cnbB           ----------------------------------------------------------------------
2cfcA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGKGPRGAAETLLIQGGSSGIGTTAIQIAKALGFKVFVTAGSDDKCKACESLGADRAINYKTQDFVAEVK
2dm6A           VKGGE-----TVLVSAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEAL
2eerB           DPSKTL------VVIGAGGGLGTMAIQIAKAVSGATIIGVDVREEALEAKRAGADYVINASSQDPVSEIR
2cdbC           KRVPVWTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLK
3cosD           -----VTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDCLNPRDLHPIQEVI
2cdbA           KRVPVWTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLK
2eihA           VRPG-----DDVLVMAAGSGVSVAAIQIAKLFGARVIATAGSEDKLRRAKALGADETVNYTHPDWPKEVR
3b70A           PLPSPSADQPYVLVYGGSTATATVTMQMLRL-SGYIPIATCSPHNFDLAKSRGAEEVFDYRAPNLAQTIR
2cd9B           KRCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLK
2cdaB           KRVPVWTCDCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLK
1e3lB           VTPG-----STCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDPVQDVI
2c0cA           EG-------KKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLK
2c0cB           -------EGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLK
1e3eA           VTPG-----STCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDKPVQVI
1axeA           VTQG-----STCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKKPIQVL
1a71A           VTQG-----STCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKKPIQVL
2cd9A           KRCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLK
1e3lA           VTPG-----STCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDPVQDVI
2cdbB           KRCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLK
2cdaA           KRVPVWTCDCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLK
2dphA           CVSAGVKPGSHVYI-AGAGPVGRCAAAGARLLGAAVIVGDQNPERLKLLSDAGFETIDLRNSAPLRDQID
2eerA           DPSKTLV------VIGAGGGLGTMAIQIAKAVSGATIIGVDVREALEAAKRAGADYVINASSQDPVSEIR
1e3eB           V-----TPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDPVQDVI
1axgA           VTQ-----GSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKPIQEVL
1d1tA           VKPGST------CVVFGLGGVGSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTKPISVL
2dq4A           SGKSVL--------ITGAGPIGLMAAMVVRASGAGPILVSDPNPYRLAFARPYADRLVNPLEEDLLEVVR
2cf5A           KQPGLRGGI------LGLGGVGHMGVKIAKAMGHHVTVISSSNKKREALQDLGADDYVIGSDQAKMSELA
3cosA           VTPG-----STCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDCLNPRDLHPIQEVI
1bxzA           EL-------GATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAKYYGATDIVNYKDGPIESQIM
1ee2A           VTQGST-----CAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKPIQEVL
1d1sA           VKPGST------CVVFGLGGVGSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTPISEVL
2d8aA           PISGKS------VLITGAGPLGLLGIAVAKASGAYPVIVSPSDFRRELAKKVGADYVINPFEEDVVKEVD
2b5vA           SAFDWDP--SSAFVL-GNGSLGLLTLAMLKVDDKGYENLYGRRDRPDPTIDIIEELDATYVDSRQTPVED
2b5wA           SAFDWDP--SSAFV-LGNGSLGLLTLAMLKVDDKGYENCLGRRDRPDPTIDIIEELDATYVDSRQTPVED
3b6zA           PLPSPSADPVYVLVYGGSTATATVTMQMLRL-SGYIPIATCSPHNFDLAKSRGAEEVFDYRAPNLAQTIR
2dfvA           ---------GKSVLITGAGPLGLLGIAVAKASGAYPVIVSPSDFRRELAKKVGADYVINP-FEEDVVKEV
1cdoA           VEPGSTCAV------FGLGAVGLAAVMCHSAGAKRIIAVDLNPDKFEKAKVFGATDFVNPNDHSEPISVL
1e3jA           LGTTV--------LVIGAGPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVVDPAKIIERIR
2b83A           IQMG----SSVVVIGIGAVGLMGIA-GAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVM
1dlgA           LAEGT-----TIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRVLPDRIETGTFL
2dg2A           SKSP-----PTVLVICGPGNNGGVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKDIPFLGEPPEPV
3e8wA           ----------------SGLQFTLKEGKLKGLKGAVIDNVKWDLKKKNIEVDFHLDATVHYTAGGRILILP
3eeqB           -------------LLGGHWGANDIARELSVILNSTPIITKLSIERIANILIAKIINPE-----NIVKINA
2ebjA           EGPK-----AVLHLGLAEDRPVLTLERLAVNLDFPRPDNRGRVLEDLPIVPGGPL---ALPARFPVKPVL
3dwiA           LRPGAT------ILEPTSGNTGISLAMAARLKGYRLICVMPENERRQLLELYGAQIIFSAGSNTAVATAK
3dwgB           LRPGAT------ILEPTSGNTGISLAMAARLKGYRLICVMPSVERRQLLELYGAQIIFSAANTAVKELAA
3dwgA           AEADGLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPSVERRQLLELYGAQIIFSAAEGGSNTAVA
3c3pB           IKQPQL------VVVPGDGLGCASWWFARAISISSRVVIDPDRDNVEHARRLHDNGLIDRVELQVGDPLG
1dl5A           LDKG-----MRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGIENVIFVCGDGYY
2eguA           LKPGDT------IVEPTSGNTGIGLAMVAAAKGYKAVLVMPDTERRNLLRAYGAELVLTPGAQGMIAKAE
1dl5B           LDKG-----MRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGIENVIFVCGDGYY
3dkiA           LRPGAT------ILEPTSGNTGISLAMAARLKGYRLICVMPENERRQLLELYGAQIIFSAAEGGSNTAVA
3d3jA           VLLGQRPTVALLCGPHVKGAQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVS--SL
1ch6A           ----------------------------------------------------------------------
2bhtD           IKPG------DVLIEATSGNTGIALAMIAALKGYRMKLL-MPDERRAAMRAYGAELIMEGARDLAANRGE
3dwiB           LRPGAT------ILEPTSGNTGISLAMAARLKGYRLICVMPSVERRQLLELYGAQIIFSAASNTAKELAA
3c85D           IEINVISGDVKLVLLAPHHQGNQTALEQLQRRNYKGQIAAEYPDQLEGLLESGVDAAFNIYSEAGSGFAR
3dkiB           LRPGAT------ILEPTSGNTGISLAMAARLKGYRLICVMPENERRQLLELYGAQIIFS-----------
3cvjA           VTNK-----DVIIISNSGRNTVPVEAIESRNIGAKVIATSKHSQKVTSRH---KSGKKLYEYADVVLDNG
3e90B           ----------------------------------------------------------------------
3c85C           ---------HAQVLILGG-RIGTGAYDELRARYGKISGIEIREEAAQQHRSEGRNVISGDATDP---DFW
3e90D           ----------------------------------------------------------------------
1d6sA           LKPG------VELVEPTNGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGA-------------
3ctmB           LGK-------VASVTGSSGGIG------------------------------------------------
2cnbB           ----------RVLVCGGAGYIGSHFVRALLRDTNHSVVIV--DSLVGTHGKSDHVETRENVARKLQQSDG
2cfcA           ------------IVTGASSGNGLAIATRFLARGDRVAALDLSAETLEET---------------------


                         .         .         .         +         .         .         .:280
query           ALTEGKGVDVILDMVAGSYLARELSCIADDGRIVIIALLGGGKAEIPLGDILRRRITITGSTLRPRPASF
2dm6A           KKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYPPGPSPESIIYKQLRIEGFIVYRWQGDV
2eerB           RITQGKGADAVIDLNNSEKTLSIPYVLAKQGKYVMVGL-FGADLKYHAPLITLNEVQFIGSLVGNQSDFL
2cdbC           DSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQKPHFQ
3cosD           IELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTPEELIIGRTINGTFFGGWK---
2cdbA           DSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQKPHFQ
2eihA           RLTGGKGADKVVDHTGALYFEGVIKATANGGRIAIAGASSGYEGTLPFAHVFYRQLSILGSTMASKSR--
3b70A           TYT-KNNLRYALDCITNVESTTFAAIGRAGGHYVSLNPFPETRKMVTTDWTLGPTIFGEGSTWPAPYGRP
2cd9B           DSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYQEIVHTNKTIIGLVNGQKPHFQ
2cdaB           DSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQKPHFQ
1e3lB           TELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGAKVDEMTIPTVDVILGRSINGTFFGGWK--S
2c0cA           QEY-PEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSKLLKKSASVQGFFLNHYLSKY
2c0cB           QEY-PEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLNHYLSKYQAA
1e3eA           TELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGAKVDEMTIPTVDVILGRSINGTFFGGWK---
1axeA           TEMSNGGVDFSFEVIGRLDTMVTLSCCQEAYGVSVIVGVPPDQNLSMNPMLLLSGRTWKGAIFGGFKSKD
1a71A           TEMSNGGVDFSFEVIGRLDTMVTSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFK--S
2cd9A           DSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLTLQEIVHTNKTIIGLVNGQKPHFQ
1e3lA           TELTAGGVDYSLDCAGTAQTLKAVDCTVLGWGSCTVV-GAKVDEMTIPTVDVILGRSINGTFFGGWKSVD
2cdbB           DSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTIVHTNKTIIGLVNGQKPHFQ
2cdaA           DSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYQEIVHTNKTIIGLVNGQKPHFQ
2dphA           QILGKPEVDCGVDAVGFGALNSLFDVVRAGGAIGIPGIYVGSDPDPVNKDAGSGRLHLDFGKMWTKSIRI
2eerA           RITQGKGADAVIDLNNSEKTLSIPYVLAKQGKYVMVGLFGA-DLKYHAPLITLNEVQFIGSLVGNQSDFL
1e3eB           TELTAGGVDYSLDCAGTAQTLKAVDCTVLGWGSCTVV-GAKVDEMTIPTVDVILGRSINGTFFGGWKSVD
1axgA           TEMSNGGVDFSFEVIGRLDTMVTALSCCQEAVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKSKD
1d1tA           SEMTGNNVGYTFEVILETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKS--
2dq4A           RVTGSGVEVLLEFSGNEAAIHQGLMALIPGGEARILGIPSDPIRFDLAGELVMRGITAFGIAGRRLWQTW
2cf5A           -----DSLDYVIDTVPVHHALEPLSLLKLDGKLILMG-VINNPLQFLTPLLMLGRKVITGSFIGSMKE--
3cosA           IELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTGVAAGSKGLTVFPEELIIGRTINGTFFGGWK---
1bxzA           NLTEGKGVDAAI--IAGDIMATAVKIVKPGGTIANVN-YFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGG
1ee2A           TEMSNGGVDFSFEVIGRLDTMVAALSCCQEGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFKS--
1d1sA           SEMTGNNVGYTFEVIGHLETMIDALCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLK---
2d8aA           ITDGNGVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKALTIYGITGRHLWETW
2b5vA           VPDVYEQMDFIYEATGFPKHAIQVQALAPNGVGALLGVPSDWAFEVDAGEMVLHNKALVGSVNSHVEHFE
2b5wA           VPDVYEQMDFIYEATGFPKHAIQVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVGSVNSHV
3b6zA           TYTKN-NLRYALDCITESTTFCFAAIGRAGGHYVSLNPFPRKMVTTDWTLGPTIFGEGSTWPAPYGRPGS
2dfvA           DITDGNGVDVFLEFSGAPKALEQLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKALTIYGITGRHLWETW
1cdoA           SKMTNGGVDFSLECVGNVGVMRNLESCLKGWGVSVLVGWTDLHDVATRPIQLIAGRTWKGSMFGGFK---
1e3jA           S-AIGDLPNVTIDCSGNEKCITIGINITRTGGTLMLVGMGSQMVTVPLVNACAREIDIKSVFRYCND---
2b83A           KLTNGKGVDRVIMAGGGSETLSQVSMVKPGGIISNINYHGSGDALLIPRVEWMAHKTIKGGLCPGGRLRA
1dlgA           VAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIET---GEDWISLDMHGKRPKAVTVRTAPHPAFPTDM
2dg2A           ----DELYELVVDAIFGFSFKGDVREPFHSVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHF
3e8wA           ITGDGQMKLKLKNIHIHLVVSYEMEKDAEGVDHVIF-----KKYTVTFDVKDNAQFGLTNLFNGNKELSD
3eeqB           ALLRDESICIDGINVNFPENIKVCSYIISLRDKEYKDKIVVWLKPLKISIGIGSKKDVKMEEIRDGIYKE
2ebjA           ARWREAGIPGRPSLSAGSYLCNQLYRLPEEVPVGFLHL--------------------------------
3dwiA           ELAATNPSWVMLYQYGNPANTDS-----------------------------------------------
3dwgB           TNPSWVMLYQYGNNTDSHYCGTGPELLADLPEITHF----------------------------------
3dwgA           -----TAKELAATNPSWVMLYQYGNPANTDSHYCGTGP--------------------------------
3c3pB           IAAGQRDIDILFDCDVFADVLERNRCLAKNALLIAVNALRREFNHHRRRDFFTT----------------
1dl5A           GVPEFSPYDVIFVTVGVDEVPETFTQLKEGGRVIVPINLKLSRRQPA-----------------------
2eguA           ELVREHGYFMPTTGK-------------------------------------------------------
1dl5B           GVPEFSPYDVIFVTVGVDEVPETFTQLKEGGRVIVPINLKLSRRQPAF---LFKKKDPYLVGNYKLETRF
3dkiA           -----TAKELAATNPSWVMLYQYGNPANTDSHYCGTGP--------------------------------
3d3jA           KDLPTSPVDLVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPVHIDAKWSLALGLPLPLGEHAG
1ch6A           ----------------------------------------------------------------------
2bhtD           GKLLDQFNNPDNPKAHYTTTGPEIWQQTGGRITHFVSSMGTTGTITGVSEFMREQ---------------
3dwiB           TNPSWVMLYQYGNNTDSHYCGTGPELLADLPEIHFVAGLG------------------------------
3c85D           HVCKQLEPQFT-----------------------------------------------------------
3dkiB           ----------------------------------------------------------------------
3cvjA           APVGDAGFQIANSEIYSGATSDSIGCFLAQALIVETLHLLVQQGFEPPVFKSSNGADLYNDKIFNE----
3e90B           ----------------------------------------------------------------------
3c85C           ERILDTGHVKLVLLAPHHQGNQTLEQLQRRNYKGQIAAIAEYPDQLEGLLESGVDAAFNIYS--------
3e90D           ----------------------------------------------------------------------
1d6sA           ----------------------------------------------------------------------
3ctmB           ----------------------------------------------------------------------
2cnbB           PKPPWADRYAALEVGDVRNEDFLNGVFTRHGPIDAVVHMCAFLAVGESVRD-------------------
2cfcA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KGAIAQALHQNVWPLLASGKIKPVIHKVFPAAQAADAHRLMESSEHIGKIVLTW
2dm6A           REKALRDL----MKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVT-
2eerB           G----------IMSLAEAGKVKPMVTKTMKLEEANEAIDNLENFKAVGRQVLV-
2cdbC           QAVVHLASWK----TLYPKAAKMLITKTVSINDEKELLKVLEKEHGEIKIRILW
3cosD           ----SVDSIPKLVTDYKNKKFNALVTHTLPFDKISEAFDLMNQGKSIRTILI--
2cdbA           QAVVHLAS----WKTLYPKAAKMLITKTVSINDEKELLKVLEKEHGEIKIRILW
2eihA           --------LFPILRFVEEGKLKPVVGQVLPLEAAAEGHRLLEERRVFGKVVLQ-
3b70A           GSEEERQFGEDLWRLVEDGRLVHLRVVQGGFDHIKQGMELVRKGELSGEKLVV-
2cd9B           QAVVHLASWK----TLYPKAAKMLITKTVSINDEKELLKVLEKEHGEIKIRILW
2cdaB           QAVVHLAS----WKTLYPKAAKMLITKTVSINDEKELLKVLEKEHGEIKIRILW
1e3lB           VDSVPNLVS---DYKNKKFDLDLLVTHALPFESINDAIDLMKEGKSIRTILT--
2c0cA           QAAMSHLLESGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVE-
2c0cB           MSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVE-
1e3eA           ---SVDSVPNLVS-DYKNKKFDLLVTHALPFESINDAIDLMKEGKSIRTILT--
1axeA           SVPKLVA-----DFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTIL---
1a71A           KDSVPKLVA---DFMAKKFALDPLITHVLPFEKINEGFDLLRSGESIRTIL---
2cd9A           QAVVHLASWK----TLYPKAAKMLITKTVSINDEKELLKVLEKEHGEIKIRILW
1e3lA           SVPNLVSDYKN-----KKFDLDLLVTHALPFESINDAIDLMKEGKSIRTILT--
2cdbB           QAVVHLASWK----TLYPKAAKMLITKTVSINDEKELLKVLEKEHGEIKIRILW
2cdaA           QAVVHLASWK----TLYPKAAKMLITKTVSINDEKELLKVLEKEHGEIKIRILW
2dphA           MTGMARHLTEAILWDQMPYLSKVMNIEVITLDQAPDGYAKFDKG-SPAKFVIDP
2eerA           G----------IMSLAEAGKVKPMVTKTMKLEEANEAIDNLENFKAVGRQVL--
1e3eB           S-------VPNLVSDYKNKKFDLLVTHALPFESINDAIDLMKEGKSIRTILT--
1axgA           SVPKLVADFMA-----KKFALDPLITHVLPFEKINEGFDLLRSGESIRTIL---
1d1tA           -----RDDVPKLVTEFLAKKFDQLITHVLPFKKISEGFELLNSGQSIRTVLT--
2dq4A           MQGTA---------LVYSGRVDPLLTHRLPLSRYREAFGLLASG-QAVKVILDP
2cf5A           --------TEEMLEFCKEKGLSSIIE-VVKMDYVNTAFERLEKNDVRYRFVVDV
3cosA           ----SVDSIPKLVTDYKNKKFDALVTHTLPFDKISEAFDLMNQGKSIRTILI--
1bxzA           RLRMERLID-----LVFYKRVDPVTHVFRGFDNIEKAFMLMKDKPDLIKPVVI-
1ee2A           -----KDSVPKLVADFMAKKFAPLITHVLPFEKINEGFDLLRSGKSIRTILT--
1d1sA           ----SRDDVPKLVTEFLAKKFDQLITHVLPFKKISEGFELLNSGQSIRTVLT--
2d8aA           ---------YTVSRLLQSGKLNLITHKYKGFDKYEEAFELRAG--KTGKVVF--
2b5vA           AATV-------TFTKLPKWFLEDLVTGVHPLSEFEAAFDDD---DTTIKTAIEF
2b5wA           EHFEAATVT---FTKLPKWFLEDLVTGVHPLSEFEAAF---DDDDTTIKTAIEF
3b6zA           EEQFGEDLWRIAGQLVEDGRLVPLRVVQGGFDHIKQGMELVRKGELSGEKLV--
2dfvA           ---------YTVSRLLQSGKLNLITHKYKGFDKYEEAFELRA-GKTGKVVFL--
1cdoA           ----GKDGVPKMVKAYLDKKVKEFITHRMPLESVNDAIDLMKHG-KCIRTVLS-
1e3jA           ---YPIALE---MVASGRCNVKQLVTHSFKLEQTVDAFEAARKKANTIKVMISC
2b83A           ---------EMLRDMVVYNRVDLVTHVYHGFDHIEEALLLMKDPKDLIKAVVI-
1dlgA           QAQFTLLNLVAEG-----TGVITETIFENRFMHVPELIRMGAHAEIESNTVICH
2dg2A           TGRYHYLGGRFVPPA---------LEKKYQLNLPSYPDTECV------------
3e8wA           TMTFLNQNWKQVSEEFGKPVMEAAA--KKIFKNIKHFLAKV-------------
3eeqB           EVKKIADEFNVRFRLVNEEEINNFNPCLTPPKGVAEISALIAGGRN-SKLILRK
2ebjA           ------------------------------------------------------
3dwiA           ------------------------------------------------------
3dwgB           ------------------------------------------------------
3dwgA           ------------------------------------------------------
3c3pB           ------------------------------------------------------
1dl5A           ------------------------------------------------------
2eguA           ------------------------------------------------------
1dl5B           ------------------------------------------------------
3dkiA           ------------------------------------------------------
3d3jA           RIYLCDIGI----PQQVFQEVGINYHSPFGCKFVIPLH----------------
1ch6A           ------------------------------------------------------
2bhtD           ------------------------------------------------------
3dwiB           ------------------------------------------------------
3c85D           ------------------------------------------------------
3dkiB           ------------------------------------------------------
3cvjA           ------------------------------------------------------
3e90B           ------------------------------------------------------
3c85C           ------------------------------------------------------
3e90D           ------------------------------------------------------
1d6sA           ------------------------------------------------------
3ctmB           ------------------------------------------------------
2cnbB           ------------------------------------------------------
2cfcA           ------------------------------------------------------