[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PDB for rmet0:ABF07859.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ej5A.bssp"
#ERROR : Can't open dsspfile "2ej5B.bssp"
#ERROR : Can't open dsspfile "1dciA.bssp"
#ERROR : Can't open dsspfile "1ef9A.bssp"
#ERROR : Can't open dsspfile "1dubA.bssp"
#ERROR : Can't open dsspfile "2dubE.bssp"
#ERROR : Can't open dsspfile "1dubB.bssp"
#ERROR : Can't open dsspfile "2dubD.bssp"
#ERROR : Can't open dsspfile "2dubA.bssp"
#ERROR : Can't open dsspfile "1ef8A.bssp"
#ERROR : Can't open dsspfile "1ef8B.bssp"
#ERROR : Can't open dsspfile "1ef8C.bssp"
#ERROR : Can't open dsspfile "2a7kC.bssp"
#ERROR : Can't open dsspfile "2a7kF.bssp"
#ERROR : Can't open dsspfile "3bptA.bssp"
#ERROR : Can't open dsspfile "2a7kG.bssp"
#ERROR : Can't open dsspfile "2a7kE.bssp"
#ERROR : Can't open dsspfile "2a7kB.bssp"
#ERROR : Can't open dsspfile "2a7kH.bssp"
#ERROR : Can't open dsspfile "2a7kD.bssp"
#ERROR : Can't open dsspfile "2a81A.bssp"
#ERROR : Can't open dsspfile "2a7kA.bssp"
#ERROR : Can't open dsspfile "2a7kI.bssp"
#ERROR : Can't open dsspfile "3bf0C.bssp"
#ERROR : Can't open dsspfile "3bezC.bssp"
#ERROR : Can't open dsspfile "3bf0A.bssp"
#ERROR : Can't open dsspfile "3bppA.bssp"
#ERROR : Can't open dsspfile "3bf0D.bssp"
#ERROR : Can't open dsspfile "2a7sA.bssp"
#ERROR : Can't open dsspfile "2bzrC.bssp"
#ERROR : Can't open dsspfile "3bezD.bssp"
#ERROR : Can't open dsspfile "2bzrD.bssp"
#ERROR : Can't open dsspfile "2bzrF.bssp"
#ERROR : Can't open dsspfile "3bf0B.bssp"
#ERROR : Can't open dsspfile "3bezA.bssp"
#ERROR : Can't open dsspfile "2cbyA.bssp"
#ERROR : Can't open dsspfile "2bzrA.bssp"
#ERROR : Can't open dsspfile "2bzrB.bssp"
#ERROR : Can't open dsspfile "2deoB.bssp"
#ERROR : Can't open dsspfile "2cbyG.bssp"
#ERROR : Can't open dsspfile "2cbyD.bssp"
#ERROR : Can't open dsspfile "2deoA.bssp"
#ERROR : Can't open dsspfile "3ejvA.bssp"
#ERROR : Can't open dsspfile "2c8tA.bssp"

## Summary of PDB Search
:259
    4e-51  31%  2ej5A  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II
    2e-48  31%  2ej5B  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II
    2e-48  24%  1dciA  [c.14.1] DIENOYL-COA ISOMERASE
    4e-48  25%  1ef9A  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    1e-47  28%  1dubA  [c.14.1] 2-ENOYL-COA HYDRATASE
    3e-47  28%  2dubE  [c.14.1] 2-ENOYL-COA HYDRATASE
    5e-47  28%  1dubB  [c.14.1] 2-ENOYL-COA HYDRATASE
    5e-46  28%  2dubD  [c.14.1] 2-ENOYL-COA HYDRATASE
    2e-45  28%  2dubA  [c.14.1] 2-ENOYL-COA HYDRATASE
    3e-45  26%  1ef8A  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    3e-44  26%  1ef8B  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    2e-43  24%  1ef8C  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    4e-39  24%  2a7kC  [x.x.x] CARB
    7e-39  25%  2a7kF  [x.x.x] CARB
    2e-38  19%  3bptA  [x.x.x] 3-HYDROXYISOBUTYRYL-COA HYDROLASE
    3e-38  24%  2a7kG  [x.x.x] CARB
    4e-38  24%  2a7kE  [x.x.x] CARB
    4e-38  23%  2a7kB  [x.x.x] CARB
    5e-38  24%  2a7kH  [x.x.x] CARB
    2e-37  24%  2a7kD  [x.x.x] CARB
    4e-36  26%  2a81A  [x.x.x] CARB
    4e-36  23%  2a7kA  [x.x.x] CARB
    6e-34  24%  2a7kI  [x.x.x] CARB
    4e-30   8%  3bf0C  [x.x.x] PROTEASE 4
    2e-26  12%  3bezC  [x.x.x] PROTEASE 4
    2e-26  14%  3bf0A  [x.x.x] PROTEASE 4
    5e-25  12%  3bppA  [x.x.x] 1510-N MEMBRANE PROTEASE
    1e-24  12%  3bf0D  [x.x.x] PROTEASE 4
    1e-24  13%  2a7sA  [x.x.x] PROBABLE PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    3e-24  11%  2bzrC  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    5e-24  10%  3bezD  [x.x.x] PROTEASE 4
    1e-22  14%  2bzrD  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    1e-22  14%  2bzrF  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    4e-22  13%  3bf0B  [x.x.x] PROTEASE 4
    1e-21  10%  3bezA  [x.x.x] PROTEASE 4
    4e-21  17%  2cbyA  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    2e-20  12%  2bzrA  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    2e-20  11%  2bzrB  [x.x.x] PROPIONYL-COA CARBOXYLASE BETA CHAIN 5
    2e-20  12%  2deoB  [x.x.x] 441AA LONG HYPOTHETICAL NFED PROTEIN
    4e-20  17%  2cbyG  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    7e-20  17%  2cbyD  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
    3e-19  13%  2deoA  [x.x.x] 441AA LONG HYPOTHETICAL NFED PROTEIN
    8e-19  12%  3ejvA  [x.x.x] UNCHARACTERIZED PROTEIN WITH CYSTATIN-LIKE FOLD
    3e-05  17%  2c8tA  [x.x.x] ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC SUBUNIT 1
:259

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTAQLLSERVDSTLVLTISNPEARNALHPDIYXXXXXXXXXXXRDDSIRAVILTGADGVFCAGGNLNRLL
2ej5A           MYETIRYEVKGQVAWLTLNRPDQLNAFTEQMNAEVTKALKQAGADPNVRCVVITGAGRAFCAGEDLD---
2ej5B           MYETIRYEVKGQVAWLTLNRPDQLNAFTEQMNAEVTKALKQAGADPNVRCVVITGAGRAFCAGEDLSDH-
1dciA           ----QVTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMA
1ef9A           MSYQVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSVFSAGHDIHE--
1dubA           -----KKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM-
2dubE           -----KKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGAD-----
1dubB           -----KKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM-
2dubD           -----KKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQ
2dubA           -----KKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM-
1ef8A           MSYQVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSVFSAGHDIHELD
1ef8B           MSYQVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSVFSAGHDIDPLS
1ef8C           MSYQVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDLSYD
2a7kC           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEV
2a7kF           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAESFSAGGDFNEVK
3bptA           ----VLLGKKGCTGVITLNRPKFLNALTLNIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCAGGDI-RVI
2a7kG           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDEVKQ
2a7kE           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEV
2a7kB           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEV
2a7kH           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEV
2a7kD           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEV
2a81A           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVGGAERSFSAGGDFNEVK
2a7kA           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEV
2a7kI           ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEV
3bf0C           --------------LLDISGVDKPDRLQENSLFDIVNTIRQAKDDRNITGIVMDLKNFAGGDQPSMQY--
3bezC           ----------RGALLLDISGVI-VDKPQENSLFDIVNTIRQAKDDRNITGIVDLK----NFAGG------
3bf0A           -------DTGDSIGVVFANGADGEETQGNVGGDTTAAQIRDARLDPKVKAIVLRV----NSPGGSVTASE
3bppA           ------------------------GQITSYTYDQFDRYITIAEQDNAEAIIIELDTPGGRADAMMN----
3bf0D           -------------LLLDISGVDKPDSLQENSLFDIVNTIRQAKDDRNITGIVMDLKNFAGGDQPSMQYI-
2a7sA           -------IDGRPVGIVANQPTHFAGCLDINASEKAARFVRTCDCFN--IPIVMLVDVPGFLPGTDQEYNG
2bzrC           IVVGFGRIDGRPVGIVANQPTHFAGCLDINASEKAARFVRTCDCFN--IPIVMLVDVPGFLPGTDQEYNG
3bezD           ----------RGALLLDISGVIVDKPDQENSLFDIVNTIRQAKDDRNITGIVDLKNFAGGDQPSQYIG--
2bzrD           --------------IFSQDATVFGGSLGEVYGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLY
2bzrF           --------------IFSQDATVFGGSLGEVYGEKIVKVQELAIKTGRPLIGINDGAGARIQEGVVSLGLY
3bf0B           ------------ALLLDISGVIVDKPDQENSLFDIVNTIRQAKDDRNITGIVMDLKNFAGGDQPS-----
3bezA           -------------LLLDISGVI-VDKPQENSLFDIVNTIRQAKDDRNITGIVDLKNFAGGDQPSQYIG--
2cbyA           -------------------------------------------RLLSERIIFLGSEVNDEIANRLCAQIL
2bzrA           ----------RPVGIVANQPTHFAGCLDINASEKAARFVRTCDCFN--IPIVMLVDVPGFLPGTDQE---
2bzrB           --------------IVANQPTHFAGCLDINASEKAARFVRTCDCFN--IPIVMLVDVPGFLPGTDQE---
2deoB           ----------------IVYVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDTPGGRADANIVQ---
2cbyG           -------------------------------------------RLLSERIIFLGSEVNDEIANRLCAQIL
2cbyD           -------------------------------------------RLLSERIIFLGSEVNDEIANRLCAQIL
2deoA           -----------------------KGQITSYTYDQFDRYITIAEQDNAEAIIIELDTPGGRADANI-----
3ejvA           ----------------------------------------------------------------------
2c8tA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GNRSQPPSVQADSIEVLNQWIESFHAFPKPIIAAVEGPAAGAGFSLVLACDFVVAASDAKFVMAYVKVGL
2ej5A           --------HGDVLRSRYAPMMKALHHLEKPVVAAVNGAAAGAGMSLALACDFRLLSEKASFAPAFIHVGL
2ej5B           ---------GDVLRSRYAPMMKALHHLEKPVVAAVNGAAAGAGMSLALACDFRLLSEKASFAPAFIHVGL
1dciA           SDVARIAWYLRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGL
1ef9A           --LPSGGRDPLSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV
1dubA           ----QNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
2dubE           -----IKEMQNRTFQDCYSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
1dubB           ----QNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
2dubD           NRT--------FQDCYSGKHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
2dubA           ---------QNRTFQDCYSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
1ef8A           P---------LSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV
1ef8B           YDDP------------LRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV
1ef8C           DPL--------------RQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV
2a7kC           KQLSRSEDIEEW-IDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kF           QLSRSEDI--EEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
3bptA           SEAEKAKQKIAPVFFREEYLNNAVGSCQKPYVALIHGITGG-GVGLSVHGQFRVATEKCLF-APETAIGL
2a7kG           LSRSEDI---EEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kE           KQLSRSEDIEEW-IDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kB           KQLSRSEDIEEWIDR-VIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kH           KQLSRSEDIEEW-IDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kD           K---QLSEDIEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a81A           QLSRSEDIEEW--IDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kA           KQLRSEDI--EEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
2a7kI           KQLRSEDIEEW--IDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
3bf0C           -----------------IGKALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDLHGFATN-
3bezC           -----------DQPSQYIGKALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDLHGFATNG
3bf0A           VIRAE---------------LAAARAAGKPVVVSMGGMAASGGYWISTPANYIVANPSTLTGS----IGI
3bppA           ----------------IVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLIAMAPGTSIGACRPILGY
3bf0D           ------------------GKALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDLHGFATNG
2a7sA           IIR--------RGAKLLYAYGEATVPKITVITRKAYGGAYCVMGSKDMGCDVNLAWPTAQIAVMGASGAV
2bzrC           IIRR------------GAKLLYAYGEATVPKITVITRKAYGGAY---CVMGSKDMGCDVNLAWPTAQIAV
3bezD           -------------------KALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDLHGFATNG
2bzrD           SRI---------------FRNNILASGVIPQISLIMGAAAGGHVYSPALTDFVIMVDQTSQMF-------
2bzrF           SRI---------------FRNNILASGVIPQISLIMGAAAGGHVYSPALTDFVIMVDQTSQ---------
3bf0B           -------------MQYIGKALKEFRDSGKPVYAVGEN-YSQGQYYLASFANKIWLSPQGVVDLHGFATNL
3bezA           -------------------KALKEFRDSGKPVYAVGENYSQGQYYLASFANKIWLSPQGVVDLHGFATNG
2cbyA           LLAAEDASSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKRYALPHARILMHQPIAIQ
2bzrA           ---------YNGIIRRGAKLLYAYGEATVPKITVITRKAYGGA---YCVMGSKDMGCDVNLAWPTAQIAV
2bzrB           ---------YNGIIRRGAKLLYAYGEATVPKITVITRKAYGGA---YCVMGSKDMGCDVNLAWPTAQIAV
2deoB           -------------------RIQQSKIPVIIYVYPPGASAASAGTYIALGSH-LIAAPGTSIGACRTNYFI
2cbyG           LLAAEDASSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKRYALPHARILMHQPIAIQ
2cbyD           LLAAEDASSPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKRYALPHARILMHQPIAIQ
2deoA           -----------------VQRIQQSKIPVIIYVYPPGASAASAGTYIALGSH-LIAAPGTSIGACRTNYFI
3ejvA           --------------------------------------------------------------APEATIEI
2c8tA           ---------------------------PCDIATYAMGMAASMGEFLLAAGTKRYALPHARILMHQPLIAI


                         +         .         .         .         .         *         .:210
query           TPDGGGSYEIARMLPRQLASEIMMEGKPVDPARLAHFGIVNRVAAPGQALTEALRIAENLAKESPNAVSG
2ej5A           VPDAGHLYYLPRLVGRAKALELAVLGEKVTAEEAAALGLATKVIPLSDWEEEVKQFAERLSAMPTKAIGL
2ej5B           VPDAGHLYYLPRLVGRAKALELAVLGEKVTAEEAAALGLATKVIPLSDWEEEVKQFAERLSAMPTKAIGL
1dciA           AADVGTLQRLPKVINRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAFALAADISSKSPVAVQG
1ef9A           PYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
1dubA           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
2dubE           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
1dubB           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
2dubD           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
2dubA           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
1ef8A           PYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
1ef8B           PYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
1ef8C           PYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
2a7kC           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kF           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
3bptA           FPDVGGGYFLPRL-QGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLALEEDLLALKSPSKENIASVL
2a7kG           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kE           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kB           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kH           GC-SVGAAILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kD           GC-SVGAAILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a81A           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kA           GCSVGAAILG-FTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
2a7kI           GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
3bf0C           ---GLYYKSLLDKLKV--STHVFRVGTYKSAVEPFIRDDMSPAAREADSRWIGELWQNYLNTVAANRQIP
3bezC           LYYKSKVSTHVFRVGTYKSAVEPFIRDDSPAAREADSRWIGEL-WQNYLNTVAANRQIPAEQVFPGAQGL
3bf0A           FGVITTVENSLDSIGV--HTDGVSTSPLADVSITRALPPEAQLMMQLSIENGYKRFITLVADARHSTPEQ
3bppA           SQNGSIIEAPPAIRNATIAEEFITKDLSLTPEEALKYGVIEVVARDNELLKKSNGMKTKIPVNGRYVTLN
3bf0D           LYKLKVSTHVFRVGTYKSAVEPFIRDDMSPAAREADSRWIGEL-WQNYLNTVAANRQIPAEQVFPGAQGL
2a7sA           GYRQQLAEAAANGDKLRLRLQQEYEDTLVNPYVAAERGYVDAVIPPSHTRGYIGTALRLLERKIAQLPPK
2bzrC           MGASG----AVGFVYRRLRLQQEYEDTLVNPYVAAERGYVGAVIPPSHTRGYIGTALRLLERKKKHGN--
3bezD           LYYKSKVSTHVFRVGTYKSAVEPFIRDDSPAAREADSRWIGEL-WQNYLNTVAANRQIPAEQVFPGAQGL
2bzrD           -------ITGPDVIKTVTGEEVTMEELGGAHTHMAKSGTAHYAASGEQAFDYVRELLSYLPPNNSTDAPR
2bzrF           -----MFITGPDVIKTVTGEEVTMEELGGAHTHMAKSGTAHYAASGEQAFDYVRELLSYLPPNNSTDAPR
3bf0B           LDKLKVSTHVFRVGTYKSAVEPFIRDDMSPAAREADSRWIGEL-WQNYLNTVAANRQIPAEQVFPGAQGL
3bezA           LYYKSKVSTHVFRVGTYKSAVEPFIRDDSPAAREADSRWIGEL-WQNYLNTVAANRQIPAEQVFPGAQGL
2cbyA           AEQFAVIKKEMFRQPIERIEADSDRDRWFTAAEALEYGFVDHIITR------------------------
2bzrA           MGASGAVGFVYRQQIDKLRLQQEYEDTLVNPYVAAERGYVGAVIPPSHTRGYIGTALRLLERKKKHGN--
2bzrB           MGASGAVGFVYL------RLQQEYEDTLVNPYVAAERGYVGAVIPPSHTRGYIGTALRLLERKKKHGN--
2deoB           AYIKSLAQESGRN--ATIAEEFITKDLSLTPEEALKYGVIEVVARINELLKKSNGKTKIPVNGRYVTLNF
2cbyG           AEQFAVIKKEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHI---------------------------
2cbyD           AEQFAVIKKEMFRLPIERIEADSDRDRWFTAAEALEYGFVDHIITRAH----------------------
2deoA           AYIKSLAQESGRNATI--AEEFITKDLSLTPEEALKYGVIEVVARINELLKKSNGKTKIPVNGRYVTLNF
3ejvA           VDAVGGASRSISRLEGRDAIRVAVRQAPHGYRAWSQNVVNAPIIVIEGDHAVLDAQFVFSILAAEVPDGG
2c8tA           QAEQFALNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHI---------------------------


                         .         .         .         +         .         .         .:280
query           IKSLINHAGTATLTEHLAAERDSFVAALHHKDGGEGISAFLEKRKPNYR
2ej5A           IKRLLRESEETTFDRYLEREAECQRIAGLTSDHREGVKAFFEKRKPLFQ
2ej5B           IKRLLRESEETTFDRYLEREAECQRIAGLTSDHREGVKAFFEKRKPLFQ
1dciA           SKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKDSKSI
1ef9A           IKEELRVLGEAHTMNSDEFERGMRRAVYDSEDYQEGMNAFLEKRKPNFV
1dubA           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
2dubE           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
1dubB           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
2dubD           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
2dubA           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
1ef8A           IKEELRVLGEAHTMNSDEFERGMRRAVYDSEDYQEGMNAFLEKRKPNFV
1ef8B           IKEELRVLGEAHTMNSDEFERGMRRAVYDSEDYQEGMNAFLEKRKPNFV
1ef8C           IKEELRVLGEAHTMNSDEFERGMRRAVYDSEDYQEGMNAFLEKRKPNFV
2a7kC           TKRAVNKPFIHLLEQTRDASKAVHKAAFQARDA----------------
2a7kF           TKRAVNKPFIHLLEQTRDASK----------------------------
3bptA           ENYHTESK--IDRDKSFILEEHDKINSCFSANTVEEIIENLQQDGSSF-
2a7kG           TKRAVNKPFIHLLEQTRDASKAVH-------------------------
2a7kE           TKRAVNKPFIHLLEQTRDASKAVHKAAFQAR------------------
2a7kB           TKRAVNKPFIHLLEQTRDASKAVH-------------------------
2a7kH           TKRAVNKPFIHLLEQTRDASKAVHKA-----------------------
2a7kD           TKRAVNKPFIHLLEQTRDASKAVH-------------------------
2a81A           TKRAVNKPFIHLLEQTRDASKAVHKAAFQ--------------------
2a7kA           TKRAVNKPFIHLLEQTRDASKAVH-------------------------
2a7kI           TKRAVNKPFIHLLEQTRDASKA---------------------------
3bf0C           AEQVFPGAQGLLEGLTKTGGDTAKYALENK-------------------
3bezC           LEGLTKTGGDTAKYALENKLVD---------------------------
3bf0A           IDKIAQDAKANGLVDSLGDFDDAVAKA----------------------
3bppA           FTNVEVRYLAPSFKDKLISY-----------------------------
3bf0D           LEGLTKTGGD---------------------------------------
2a7sA           KHGNV--------------------------------------------
2bzrC           -------------------------------------------------
3bezD           LEGLTKTGGDT--------------------------------------
2bzrD           YQAAAPTG-----------------------------------------
2bzrF           YQAAAP-------------------------------------------
3bf0B           LEGLTKTG-----------------------------------------
3bezA           LEGLTKTGGDT--------------------------------------
2cbyA           -------------------------------------------------
2bzrA           -------------------------------------------------
2bzrB           -------------------------------------------------
2deoB           TNVEVR-YLAPSFKDKLISY-----------------------------
2cbyG           -------------------------------------------------
2cbyD           -------------------------------------------------
2deoA           TNVEVR-YLAPSFKDKLISY-----------------------------
3ejvA           WPTGTFG----AQGRIVPIEAGQYRLTLRTVADGWVISARIEHRLPAF-
2c8tA           -------------------------------------------------